| Section Name |
Section ID |
Section Path |
| T4-Sandbox-2026-Homepage |
206330 |
/newhomepage/ |
| Build Example |
206695 |
/newhomepage/buildexample/ |
| Inner Page |
207434 |
/newhomepage/buildexample/innerpage/ |
| Components Library |
206696 |
/newhomepage/componentslibrary/ |
| 2026 Video Hero |
206713 |
/newhomepage/componentslibrary/2026videohero/ |
| 2026 Image Hero |
206726 |
/newhomepage/componentslibrary/2026imagehero/ |
| 2026 Routing Panel |
206727 |
/newhomepage/componentslibrary/2026routingpanel/ |
| 2026 Statistics |
206728 |
/newhomepage/componentslibrary/2026statistics/ |
| 2026 CTA Panel |
206729 |
/newhomepage/componentslibrary/2026ctapanel/ |
| 2026 Featured News |
206730 |
/newhomepage/componentslibrary/2026featurednews/ |
| 2026 Featured Events |
206731 |
/newhomepage/componentslibrary/2026featuredevents/ |
| Digital Team Sandbox |
206936 |
/newhomepage/digitalteamsandbox/ |
| lw-testpage |
206938 |
/newhomepage/digitalteamsandbox/lw-testpage/ |
| sy-testpage |
206970 |
/newhomepage/digitalteamsandbox/sy-testpage/ |
| ll-testpage |
206973 |
/newhomepage/digitalteamsandbox/ll-testpage/ |
| 404 |
203008 |
/404/ |
| Academics |
206301 |
/academics/ |
| Colleges and Schools |
53269 |
/academics/schools.shtml |
| Study Abroad |
206482 |
https://www.luc.edu/studyabroad/ |
| Departments and Programs |
53268 |
/academics/depts.shtml |
| Calendars and Schedules |
53253 |
/academics/schedules/index.shtml |
| Fall 2025 - 2028 Academic Calendars |
53264 |
/academics/schedules/fall/academic_calendar.shtml |
| Spring 2026 - 2028 Academic Calendars |
53263 |
/academics/schedules/spring/academic_calendar.shtml |
| Summer Sessions Academic Calendar |
53262 |
/academics/schedules/summer/academic_calendar.shtml |
| Fall 2026 Registration Access Schedule |
53259 |
/academics/schedules/fall/access_schedule.shtml |
| Spring 2026 Registration Access Schedule |
53258 |
/academics/schedules/spring/access_schedule.shtml |
| Summer 2026 Registration Access Schedule |
53257 |
/academics/schedules/summer/access_schedule.shtml |
| J-Term Registration and Class Schedule |
59068 |
/academics/schedules/j-termschedule/ |
| J-Term 2026 Registration Access Schedule |
69894 |
/academics/schedules/j-term2026registrationaccessschedule/ |
| Final Exam Schedules |
53260 |
/academics/schedules/spring/exam_schedule.shtml |
| Class Holidays |
53255 |
/academics/schedules/classholiday.shtml |
| footer |
60179 |
/academics/schedules/footer/ |
| site_logo |
199647 |
/academics/schedules/sitelogo/ |
| Online Programs |
206484 |
https://gpem.luc.edu/portal/program-finder?dm=629c8ff1-d379-4e3d-857a-3ee26ae5b168 |
| Catalog |
206485 |
https://catalog.luc.edu/ |
| Admission & Aid |
206332 |
/admissions-aid/ |
| Undergraduate |
206486 |
https://www.luc.edu/undergrad/ |
| Graduate and Professional International Admissions |
206490 |
https://gpem.luc.edu/portal/admission?tab=international-requirements |
| Graduate |
206487 |
https://gpem.luc.edu/portal/admission?tab=home |
| Tuition & Fees |
206491 |
https://www.luc.edu/bursar/tuitionfees/ |
| Adult Education |
206488 |
https://www.luc.edu/scps/ |
| Financial Aid |
206535 |
https://www.luc.edu/finaid/ |
| January Term |
206492 |
https://www.luc.edu/januaryterm/ |
| Undergraduate International Admissions |
206489 |
https://www.luc.edu/undergrad/admissions/internationalstudents/ |
| Summer Sessions |
206493 |
https://www.luc.edu/summer/ |
| Apply Now |
53836 |
/apply.html |
| Request for Information |
53840 |
/requestinformation/ |
| Research |
206341 |
/research/ |
| Undergraduate Research |
206495 |
https://www.luc.edu/celts/programs/undergraduateresearch/ |
| Centers & Institutes |
206494 |
https://www.luc.edu/academics/collegesandschools#centersandinstitutes |
| Office of the Vice Provost of Research |
206496 |
https://www.luc.edu/ovpr/ |
| Community & Faith |
206350 |
/community-faith/ |
| Jesuit Catholic Identity |
206497 |
https://www.luc.edu/mission/ |
| Campus Ministry |
206499 |
https://www.luc.edu/campusministry/ |
| Interfaith Community |
206498 |
https://www.luc.edu/campusministry/faithtraditions/ |
| Community Service & Action |
206500 |
https://www.luc.edu/serve/ |
| Campus Life |
206342 |
/campuslife/ |
| Athletics |
206502 |
https://loyolaramblers.com |
| Fitness & Recreation |
206507 |
https://www.luc.edu/campusrec/ |
| Clubs & Activities |
206503 |
https://www.luc.edu/studentengagement |
| Student Belonging |
206508 |
https://www.luc.edu/belonging/ |
| Housing |
206504 |
https://www.luc.edu/reslife/ |
| Museum of Art |
206509 |
https://www.luc.edu/luma/ |
| Dining |
206505 |
https://luc.mydininghub.com/en |
| Campus Safety |
206510 |
https://www.luc.edu/safety/ |
| Health & Wellness |
206506 |
https://www.luc.edu/wellness/ |
| About |
206345 |
/about/ |
| Loyola at a Glance |
206511 |
/about/loyolaataglance/ |
| University Leadership |
83334 |
/universityleadership/ |
| Accreditation |
188950 |
/accreditation/ |
| Visit Campus |
206473 |
/visit/ |
| Loyola and Chicago |
206512 |
/about/loyolaandchicago/ |
| Contact Us |
53522 |
/about/contactus.shtml |
| Rankings and Reputation |
206758 |
/about/rankingsandreputation/ |
| Hotels / Accommodations |
93585 |
/about/hotels/ |
| Water Tower Campus |
53528 |
/about/wtc/index.shtml |
| Lake Shore Campus |
53524 |
/about/lakeshore.shtml |
| Health Sciences Campus |
53526 |
/about/maywood.shtml |
| Prominent Alumni |
53520 |
/keyfacts/alumni.shtml |
| University Awards |
92931 |
/universityawards/ |
| Current Students |
206423 |
/currentstudents/ |
| Career Centers |
53298 |
/students/careers/ |
| Faculty & Staff |
206466 |
/faculty-staff/ |
| Alumni |
197984 |
/alumni/ |
| site_logo |
205446 |
/alumni-dev/sitelogo/ |
| Footer |
205447 |
/alumni-dev/footer/ |
| cta |
205451 |
/alumni-dev/cta/ |
| social media |
205448 |
/alumni-dev/socialmedia/ |
| modules-events |
205449 |
/alumni-dev/modules-events/ |
| right_column |
205518 |
/alumni-dev/rightcolumn/ |
| About Us |
205452 |
/alumni-dev/aboutus/ |
| Jesuit Mission |
205453 |
/alumni-dev/aboutus/jesuitmission/ |
| Constituent Engagement Team |
205454 |
/alumni-dev/aboutus/constituentengagementteam/ |
| Profiles |
205455 |
/alumni-dev/aboutus/constituentengagementteam/profiles/ |
| right_column |
205510 |
/alumni-dev/aboutus/constituentengagementteam/profiles/rightcolumn/ |
| Loyola University Chicago Alumni Association |
205456 |
/alumni-dev/aboutus/loyolauniversitychicagoalumniassociation/ |
| Profiles |
205457 |
/alumni-dev/aboutus/loyolauniversitychicagoalumniassociation/profiles/ |
| right_column |
205511 |
/alumni-dev/aboutus/loyolauniversitychicagoalumniassociation/profiles/rightcolumn/ |
| Council of Regents of Loyola University Chicago |
206698 |
/alumni/aboutus/councilofregentsofloyolauniversitychicago/ |
| Profiles |
206699 |
/alumni/aboutus/councilofregentsofloyolauniversitychicago/profiles/ |
| Events |
205458 |
/alumni-dev/events/ |
| Alumni Weekend |
205459 |
/alumniweekend/ |
| Atlantic 10 Tournament 2026 |
205460 |
/alumni/events/atlantic10tournament2026/ |
| Event Refund Policy |
205561 |
/alumni/events/eventrefundpolicy/ |
| Event Photos |
207152 |
/alumni/events/eventphotos/ |
| Communities & Interests |
205461 |
/alumni-dev/communitiesinterests/ |
| Alumni Networks |
205462 |
/alumni/communitiesinterests/alumninetworks/ |
| Arrupe Alumni Network |
205463 |
/alumni-dev/communitiesinterests/affinitynetworks/arrupealumninetwork/ |
| Black Light Speaker Series & Resources |
205466 |
/alumni-dev/communitiesinterests/affinitynetworks/blacklightspeakerseriesresources/ |
| Black Alumni Network |
205464 |
/alumni/communitiesinterests/alumninetworks/blackalumninetwork/ |
| Loyola Dance Alumni Network |
205467 |
/alumni-dev/communitiesinterests/affinitynetworks/loyoladancealumninetwork/ |
| Graduates of the Last Decade (GOLD) Alumni |
205465 |
/alumni-dev/communitiesinterests/affinitynetworks/graduatesofthelastdecadegoldalumni/ |
| Latino Alumni Network |
205469 |
/alumni/communitiesinterests/alumninetworks/latinoalumninetwork/ |
| Mundelein College & Gannon Scholar Alumnae Network |
205470 |
/alumni/communitiesinterests/alumninetworks/mundeleincollegegannonscholaralumnaenetwork/ |
| Muslim Alumni Network |
205471 |
/alumni-dev/communitiesinterests/affinitynetworks/muslimalumninetwork/ |
| Nursing Alumni Network |
207452 |
/alumni/communitiesinterests/alumninetworks/nursingalumninetwork/ |
| Polish American Alumni Network |
207455 |
/alumni/communitiesinterests/alumninetworks/polishamericanalumninetwork/ |
| Public Service Affinity Group (PSAG) |
205472 |
/alumni-dev/communitiesinterests/affinitynetworks/publicserviceaffinitygrouppsag/ |
| Loyola Rome Alumni Network |
205468 |
/alumni/communitiesinterests/alumninetworks/loyolaromealumninetwork/ |
| Rugby Alumni Network |
205473 |
/alumni/communitiesinterests/alumninetworks/rugbyalumninetwork/ |
| Theatre Alumni Network |
205474 |
/alumni/communitiesinterests/alumninetworks/theatrealumninetwork/ |
| Regional Rambler Communities |
205475 |
/alumni-dev/communitiesinterests/regionalramblercommunities/ |
| Schools & Institutes |
205476 |
/alumni/communitiesinterests/schoolsinstitutes/ |
| Spirituality |
205477 |
/alumni-dev/communitiesinterests/spirituality/ |
| Parents & Families |
205478 |
/alumni/communitiesinterests/parentsfamilies/ |
| Friends & Donors |
205480 |
/alumni-dev/communitiesinterests/friendsdonors/ |
| Benefits & Career Resources |
205481 |
/alumni-dev/benefitscareerresources/ |
| Career Success |
205482 |
/alumni-dev/benefitscareerresources/careersuccess/ |
| Continuing Education |
205483 |
/alumni-dev/benefitscareerresources/careersuccess/continuingeducation/ |
| Networking |
205484 |
/alumni-dev/benefitscareerresources/careersuccess/networking/ |
| Alumni Discounts & Benefits |
205485 |
/alumni-dev/benefitscareerresources/alumnidiscountsbenefits/ |
| Library Access |
205486 |
/alumni-dev/benefitscareerresources/libraryaccess/ |
| Weddings |
205487 |
https://www.luc.edu/weddings |
| Yearbooks |
205489 |
/alumni-dev/benefitscareerresources/yearbooks/ |
| In Memoriam |
205488 |
/alumni-dev/benefitscareerresources/inmemoriam/ |
| LoyolaLinked |
205490 |
/alumni-dev/benefitscareerresources/loyolalinked/ |
| News & Stories |
205491 |
/alumni-dev/newsstories/ |
| Loyola Magazine |
205492 |
https://news.luc.edu/magazine/ |
| Class Notes |
205493 |
/alumni-dev/newsstories/classnotes/ |
| Alumni Awards |
205494 |
/alumni-dev/newsstories/alumniawards/ |
| Celebrating Loyola Nurse Veterans |
205495 |
/alumni-dev/newsstories/celebratingloyolanurseveterans/ |
| Alumni Spotlight |
205496 |
/alumni-dev/newsstories/alumnispotlight/ |
| Julie Roche Mudge (BSN ‘86 & MSN ‘12) |
205497 |
/alumni-dev/newsstories/alumnispotlight/julierochemudgebsn86msn12/ |
| Genevieve Gonnigan (BA ’19) |
205498 |
/alumni-dev/newsstories/alumnispotlight/genevievegonniganba19/ |
| Cara Walsh (BA ’20) |
205499 |
/alumni-dev/newsstories/alumnispotlight/carawalshba20/ |
| Natalie Pieper (BA '18) |
205500 |
/alumni-dev/newsstories/alumnispotlight/nataliepieperba18/ |
| Father Edward Siebert, S.J. BA ‘90 |
205501 |
/alumni-dev/newsstories/alumnispotlight/fatheredwardsiebertsjba90/ |
| Sameer Sawaqed (BBA ’19) |
205502 |
/alumni-dev/newsstories/alumnispotlight/sameersawaqedbba19/ |
| Ellenore Angelidis (BA ’91) |
205503 |
/alumni-dev/newsstories/alumnispotlight/ellenoreangelidisba91/ |
| Brandhyze (Stanley) Smith |
205504 |
/alumni-dev/newsstories/alumnispotlight/brandhyzestanleysmith/ |
| Mark Nathan (BA ’03) |
205505 |
/alumni-dev/newsstories/alumnispotlight/marknathanba03/ |
| Austin Runde (BS ‘21 & MS ‘23) |
207147 |
/alumni/newsstories/alumnispotlight/austinrundebs21ms23/ |
| Dennis Gates (M.D. '65) |
207310 |
/alumni/newsstories/alumnispotlight/dennisgatesmd65/ |
| School of Law Announces Creation of the Aréanah Preston Memorial Scholarship |
205506 |
/alumni-dev/newsstories/schooloflawannouncescreationoftheareanahprestonmemorialscholarship/ |
| Loyola Love Stories |
205507 |
/alumni-dev/newsstories/loyolalovestories/ |
| Dan Ziemniak (JFRC ’12 & BA & BS ’14) and Anna Ziemniak (JFRC ’12 & BS ’14) |
205508 |
/alumni-dev/newsstories/loyolalovestories/danziemniakjfrc12babs14andannaziemniakjfrc12bs14/ |
| Donte Ingram (BASC ’18) and Brady Ingram (BS ’18) |
205509 |
/alumni-dev/newsstories/loyolalovestories/donteingrambasc18andbradyingrambs18/ |
| cta |
188956 |
/cta/ |
| social media |
188957 |
/socialmedia/ |
| site_logo |
188953 |
/sitelogo/ |
| Footer |
53533 |
/footer/ |
| Search |
104905 |
/search/index.php |
| feed |
110333 |
/search/feed/index.xml |
| keymatch |
110332 |
/search/keymatch/ |
| Search Alt |
111021 |
/searchalt/index.shtml |
| UMC |
163780 |
/umc/ |
| site_logo |
163781 |
/umc/sitelogo/ |
| social media |
163785 |
/umc/socialmedia/ |
| Footer |
163782 |
/umc/footer/ |
| modules-programming |
163794 |
/umc/modules-programming/ |
| About UMC |
163789 |
/umc/aboutumc/ |
| What We Do |
186886 |
/umc/aboutumc/whatwedo/ |
| Staff Directory |
186926 |
/umc/aboutumc/staffdirectory/ |
| Policies |
189490 |
/umc/aboutumc/policies/ |
| Filming and Photography on Campus |
195816 |
/umc/aboutumc/policies/filmingandphotographyoncampus/ |
| Internal Communications |
195818 |
/umc/aboutumc/policies/internalcommunications/ |
| Media Relations Policy |
195820 |
/umc/aboutumc/policies/mediarelationspolicy/ |
| Social Media Policy |
195822 |
/umc/aboutumc/policies/socialmediapolicy/ |
| Our Work |
163793 |
/umc/ourwork/ |
| Overview |
195986 |
/umc/ourwork/ |
| Advertising |
187154 |
/umc/ourwork/advertising/ |
| Marcom Contacts Advertising |
187726 |
/umc/ourwork/advertising/marcomcontactsadvertising/ |
| Branding |
190330 |
/umc/ourwork/branding/ |
| Communications |
177148 |
/umc/ourwork/communications/ |
| Marcom Contacts Communications |
187727 |
/umc/ourwork/communications/marcomcontactscommunications/ |
| Content |
177149 |
/umc/ourwork/content/ |
| Assets |
191524 |
/umc/ourwork/content/assets/ |
| Creative and Design |
177150 |
/umc/ourwork/creativeanddesign/ |
| Digital |
177151 |
/umc/ourwork/digital/ |
| Digital Marketing Internship |
198442 |
/umc/ourwork/digital/digitalmarketinginternship/ |
| right_column |
71416 |
/web/rightcolumn/ |
| Web Accessibility |
205024 |
/web/webaccessibility/ |
| Accessibility Conformance Report |
207226 |
/umc/ourwork/digital/webaccessibility/accessibilityconformancereport/ |
| right_column |
207235 |
/umc/ourwork/digital/webaccessibility/rightcolumn/ |
| PDF Usage |
206131 |
/umc/ourwork/digital/pdfusage/ |
| PDF Checklist |
206145 |
/umc/ourwork/digital/pdfusage/pdfchecklist/ |
| FlowPaper |
205042 |
/web/pdfremediation/flowpaper/ |
| Web Support |
206336 |
/umc/ourwork/digital/websupport/ |
| Profiles |
184513 |
/web/profiles/ |
| Media and Public Relations |
177152 |
/umc/ourwork/mediaandpublicrelations/ |
| Project Management and Production |
163854 |
/umc/ourwork/projectmanagementandproduction/ |
| Schools and Unit Marketing Communications |
187398 |
/umc/ourwork/schoolsandunitmarketingcommunications/ |
| Social Media |
187052 |
/umc/ourwork/socialmedia/ |
| Brand Identity |
186909 |
/umc/brandidentity/ |
| Overview |
195985 |
/umc/brandidentity/ |
| Brand Components |
189266 |
/umc/brandidentity/brandcomponents/ |
| Brand Logo |
178623 |
/umc/brandidentity/brandcomponents/brandlogo/ |
| Colors |
181458 |
/umc/brandidentity/brandcomponents/colors/ |
| Fonts |
179737 |
/umc/brandidentity/brandcomponents/fonts/ |
| Creative Standards |
189267 |
/umc/brandidentity/creativestandards/ |
| Editorial |
196022 |
/umc/resources/editorialstyleguide/ |
| Photography |
178628 |
/umc/brandidentity/creativestandards/photography/ |
| Charts and Graphics |
186020 |
/umc/brandidentity/creativestandards/chartsandgraphics/ |
| Maps |
187275 |
/umc/brandidentity/creativestandards/maps/ |
| Usage Guidelines |
189268 |
/umc/brandidentity/usageguidelines/ |
| Outlook Email Signatures |
186980 |
/umc/brandidentity/usageguidelines/outlookemailsignatures/ |
| Business Cards |
190322 |
/umc/brandidentity/usageguidelines/businesscards/ |
| Letterhead |
199858 |
/umc/brandidentity/usageguidelines/letterhead/ |
| Downloads |
190225 |
/umc/brandidentity/downloads/ |
| Work With Us |
163790 |
/umc/workwithus/ |
| Initiate Project |
189527 |
/umc/workwithus/initiateproject/ |
| Digital Screen Request |
189528 |
/umc/workwithus/digitalscreenrequest/ |
| Photography Request |
189530 |
/umc/workwithus/photographyrequest/ |
| PhotoShelter Access |
189529 |
/umc/workwithus/photoshelteraccess/ |
| Website Revision Request |
189526 |
/umc/workwithus/websiterevisionrequest/ |
| Resources |
178620 |
/umc/resources/ |
| Editorial Style Guide |
186979 |
/umc/resources/editorialstyleguide/ |
| Email Marketing |
177142 |
/umc/resources/emailmarketing/ |
| Hiring Freelancers |
187270 |
/umc/resources/hiringfreelancers/ |
| Photography |
163851 |
/umc/resources/photography/ |
| Videography |
206971 |
/umc/resources/videography/ |
| Web Training |
177146 |
/umc/resources/webtraining/ |
| University Calendar |
190331 |
/calendar/guidelines/ |
| Logos |
196294 |
/umc/brandidentity/brandcomponents/brandlogo/ |
| Colors |
196295 |
/umc/brandidentity/brandcomponents/colors/ |
| Fonts |
196296 |
/umc/brandidentity/brandcomponents/fonts/ |
| Print Templates |
196297 |
/umc/brandidentity/usageguidelines/ |
| Visual Identity Quick Links |
204403 |
/umc/resources/visualidentityquicklinks/ |
| University Bookstore |
54437 |
/bookstore/ |
| Sandbox |
146589 |
/sandbox/ |
| 2021 Universal Template |
161243 |
/sandbox/samplesite2021/ |
| Interior Page 1 |
163373 |
/sandbox/samplesite2021/interiorpage1/ |
| Interior Page 1A |
161246 |
/sandbox/samplesite2021/interiorpage1/interiorpage1a/ |
| Elevated Page |
161422 |
/sandbox/samplesite2021/elevatedpage/ |
| Interior Page 3 |
161865 |
/sandbox/samplesite2021/interiorpage3/ |
| site_logo |
161244 |
/sandbox/samplesite2021/sitelogo/ |
| Footer |
161247 |
/sandbox/samplesite2021/footer/ |
| custom_css_test |
161867 |
/sandbox/samplesite2021/customcsstest/ |
| custom_js |
161866 |
/sandbox/samplesite2021/customjs/ |
| I Links |
161420 |
/sandbox/samplesite2021/ilinks/ |
| cta |
161421 |
/sandbox/samplesite2021/cta/ |
| social media |
161248 |
/sandbox/samplesite2021/socialmedia/ |
| Pattern Library - CODE |
163372 |
/sandbox/samplesite2021/patternlibrary-code/ |
| Standards |
161392 |
/sandbox/samplesite2021/patternlibrary-code/standards/ |
| Typography |
161245 |
/sandbox/samplesite2021/patternlibrary-code/typography/ |
| Forms |
161393 |
/sandbox/samplesite2021/patternlibrary-code/forms/ |
| Panels |
161424 |
/sandbox/samplesite2021/patternlibrary-code/panels/ |
| Panels - General |
161394 |
/sandbox/samplesite2021/patternlibrary-code/panels/panels-general/ |
| Panels - Image Combinations |
161395 |
/sandbox/samplesite2021/patternlibrary-code/panels/panels-imagecombinations/ |
| Panels - Interactive |
161417 |
/sandbox/samplesite2021/patternlibrary-code/panels/panels-interactive/ |
| Panels - Images Responsive Resize |
161423 |
/sandbox/samplesite2021/patternlibrary-code/panels/panels-imagesresponsiveresize/ |
| Templates |
152227 |
/sandbox/templates/ |
| Global |
156334 |
/sandbox/templates/global/ |
| custom_css |
156381 |
/sandbox/templates/global/customcss/ |
| site_logo |
156383 |
/sandbox/templates/global/sitelogo/ |
| Footer |
156384 |
/sandbox/templates/global/footer/ |
| Global Homepage |
147900 |
/sandbox/templates/globalhomepage/ |
| custom_css |
159165 |
/sandbox/templates/globalhomepage/customcss/ |
| custom_js |
154153 |
/sandbox/templates/globalhomepage/customjs/ |
| site_logo |
147902 |
/sandbox/templates/globalhomepage/sitelogo/ |
| home_content |
159166 |
/sandbox/templates/globalhomepage/homecontent/ |
| modules |
153994 |
/sandbox/templates/globalhomepage/modules/ |
| I Links |
154164 |
/sandbox/templates/globalhomepage/ilinks/ |
| CTA |
154166 |
/sandbox/templates/globalhomepage/cta/ |
| Alert Banner |
154151 |
/sandbox/templates/globalhomepage/alertbanner/ |
| Global Interior |
152234 |
/sandbox/templates/globalhomepage/globalinterior/ |
| custom_css |
159164 |
/sandbox/templates/globalhomepage/globalinterior/customcss/ |
| Full Width |
154155 |
/sandbox/templates/globalhomepage/globalinterior/fullwidth/ |
| Version 2 |
154156 |
/sandbox/templates/globalhomepage/globalinterior/fullwidth/version2/ |
| custom_js |
154159 |
/sandbox/templates/globalhomepage/globalinterior/fullwidth/customjs/ |
| Faculty & Staff Directory Sample |
155098 |
/sandbox/templates/globalhomepage/globalinterior/facultystaffdirectorysample/ |
| custom_css |
155104 |
/sandbox/templates/globalhomepage/globalinterior/facultystaffdirectorysample/customcss/ |
| Assets |
146981 |
/sandbox/assets/ |
| Assets - Random Pool |
128187 |
/sandbox/assets-randompool/ |
| random-images-2020-2021 |
146641 |
/sandbox/assets-randompool/random-images-2020-2021/ |
| random-images-2022-2023 |
152140 |
/sandbox/assets-randompool/random-images-2022-2023/ |
| random-images-2024 |
192514 |
/sandbox/assets-randompool/random-images-2024/ |
| GPEM Assets |
185780 |
/sandbox/gpem/ |
| lwheeler |
146830 |
/sandbox/lwheeler/ |
| Test Page - Directory |
207516 |
/sandbox/lwheeler/directory/ |
| Test Page - Anchor Links |
207499 |
/sandbox/lwheeler/testpage-anchorlinks/ |
| Test Page - Modal |
206566 |
/sandbox/lwheeler/testpage-modal/ |
| Message - A bright light of knowledge |
206567 |
/sandbox/lwheeler/testpage-modal/message-abrightlightofknowledge/ |
| UAO News & Stories |
205321 |
/sandbox/lwheeler/uaonewsstories/ |
| items |
205322 |
/sandbox/lwheeler/uaonewsstories/items/ |
| Sample Story Page |
205339 |
/sandbox/lwheeler/uaonewsstories/samplestorypage/ |
| right_column |
205341 |
/sandbox/lwheeler/uaonewsstories/rightcolumn/ |
| Test Page - Video CDN |
205191 |
/sandbox/lwheeler/testvideocdn/ |
| Repeaters |
205007 |
/sandbox/lwheeler/repeaters/ |
| Blank Template |
204957 |
/sandbox/lwheeler/blanktemplate/ |
| monthly-calendar-sample |
204235 |
/sandbox/lwheeler/monthly-calendar/index.php |
| Test Page - HB |
201325 |
/sandbox/lwheeler/testpage-hb/ |
| Test Page for Mobile w/ Anchor Links Menu |
204792 |
/sandbox/lwheeler/testpageformobilewanchorlinksmenu/ |
| Upcoming Sessions |
204705 |
https://www.luc.edu/bargaining-dev/#d.en.958711 |
| Statements |
204710 |
https://www.luc.edu/bargaining-dev/#d.en.958594 |
| LUC Bargaining Team for CAS |
204706 |
https://www.luc.edu/bargaining-dev/#d.en.958620 |
| SEIU Local 73 Bargaining Team |
204707 |
https://www.luc.edu/bargaining-dev/#d.en.958621 |
| Current Agreements |
204708 |
https://www.luc.edu/bargaining-dev/#d.en.958622 |
| Updates |
204709 |
https://www.luc.edu/bargaining-dev/#d.en.958598 |
| anchorlinksJS |
204791 |
/sandbox/lwheeler/testpageformobilewanchorlinksmenu/anchorlinksjs/ |
| A-Z Index |
204227 |
/sandbox/lwheeler/a-zindex/ |
| site_logo |
204020 |
/sandbox/lwheeler/sitelogo/ |
| Arrupe - Annual Report - DEV |
204846 |
/patternlibrary/arrupe-annualreport-dev/ |
| Publications Templates |
204847 |
/patternlibrary/arrupe-annualreport-dev/publicationstemplates/ |
| Modal - Panel |
204864 |
/patternlibrary/arrupe-annualreport-dev/publicationstemplates/modal-panel/ |
| SCPS - Impact Report - DEV |
204869 |
/patternlibrary/scps-impactreport-dev/ |
| Publications Templates |
204871 |
/patternlibrary/scps-impactreport-dev/publicationstemplates/ |
| Modal |
204888 |
/patternlibrary/scps-impactreport-dev/publicationstemplates/modal/ |
| Statistics - Group of Four + Background Color |
204881 |
/patternlibrary/scps-impactreport-dev/publicationstemplates/statistics-groupoffourbackgroundcolor/ |
| mmorrison6 |
146823 |
/sandbox/mmorrison6/ |
| Summer Sessions Panel Fixes |
146841 |
/sandbox/mmorrison6/summersessionspanelfixes/ |
| About Summer Sessions |
146842 |
/sandbox/mmorrison6/summersessionspanelfixes/aboutsummersessions/ |
| custom_css |
146844 |
/sandbox/mmorrison6/summersessionspanelfixes/customcss/ |
| Commencement 3.0 TEST DEV |
149870 |
/sandbox/mmorrison6/commencement30testdev/ |
| commencement images |
149889 |
/sandbox/mmorrison6/commencement30testdev/commencementimages/ |
| Quinlan - DEV 08032020 |
151783 |
/sandbox/mmorrison6/quinlan-dev08032020/ |
| MM-internal |
159268 |
/sandbox/mmorrison6/mm-internal/ |
| Moser Leadership Tips for Quinlan |
159417 |
/sandbox/mmorrison6/moserleadershiptipsforquinlan/ |
| custom_css |
159419 |
/sandbox/mmorrison6/moserleadershiptipsforquinlan/customcss/ |
| OLD - Sample Site for Duplication |
163901 |
/sandbox/mmorrison6/samplesite/ |
| Digital Magazine Panel Documentation |
163916 |
/sandbox/mmorrison6/samplesite/digitalmagazinepaneldocumentation/ |
| QUIZ |
168801 |
/sandbox/mmorrison6/quiz/ |
| Sample Site for Duplication |
177416 |
/sandbox/mmorrison6/samplesite/ |
| Elevated Page |
177426 |
/sandbox/mmorrison6/samplesite/elevatedpage/ |
| Timeline-DEV |
199890 |
/sandbox/mmorrison6/samplesite/timeline-dev/ |
| IMAGES |
179822 |
/sandbox/mmorrison6/images/ |
| sravenscraft |
146822 |
/sandbox/sravenscraft/ |
| banner_insert |
124734 |
/bannerinsert/ |
| OOP - Random Image |
195977 |
/sandbox/sravenscraft/random-image-hero/ |
| CourseLeaf-Homepage-DEV |
184464 |
/sandbox/sravenscraft/courseleaf-homepage-dev/ |
| site_logo |
184469 |
/sandbox/sravenscraft/courseleaf-homepage-dev/sitelogo/ |
| CourseLeaf Cards |
184560 |
/sandbox/sravenscraft/courseleaf-homepage-dev/courseleafcards/ |
| The Loyola Project - PARALLAX |
168332 |
/sandbox/sravenscraft/theloyolaproject-parallax/ |
| Parkinson Pillar - DEV |
168340 |
/sandbox/sravenscraft/parkinsonpillar-dev/ |
| Pope Francis |
168248 |
/sandbox/sravenscraft/popefrancis/index.shtml |
| LUC Homepage Dev V2 |
162969 |
/sandbox/sravenscraft/luchomepagedevv2/ |
| LUC Homepage Dev V1 |
162944 |
/sandbox/sravenscraft/luchomepagedevv1/ |
| The Loyola Project - DEV |
168153 |
/sandbox/sravenscraft/theloyolaproject-dev/ |
| ARI Homepage |
160843 |
/sandbox/sravenscraft/arihomepage/ |
| home_content |
160877 |
/sandbox/sravenscraft/arihomepage/homecontent/ |
| home_audience |
160879 |
/sandbox/sravenscraft/arihomepage/homeaudience/ |
| About |
160882 |
/sandbox/sravenscraft/arihomepage/about/ |
| Mission |
160883 |
/sandbox/sravenscraft/arihomepage/about/mission/ |
| Overview |
160887 |
/sandbox/sravenscraft/arihomepage/about/overview/ |
| Diversity, Equity, and Inclusion |
160891 |
https://www.luc.edu/diversityandinclusion/ |
| LUC Template 2020 - Patterns |
148855 |
/sandbox/sravenscraft/luc-template-patterns/ |
| Commencement - HOME - UPDATE |
159470 |
/sandbox/sravenscraft/commencement-home-update/ |
| site_logo |
159473 |
/sandbox/sravenscraft/commencement-home-update/sitelogo/ |
| Footer |
159474 |
/sandbox/sravenscraft/commencement-home-update/footer/ |
| hero |
159475 |
/sandbox/sravenscraft/commencement-home-update/hero/ |
| LUC Homepage Random Images - October 2020 |
155306 |
/sandbox/sravenscraft/luchomepagerandomimages-october2020/ |
| SES Landing Page |
156718 |
/sandbox/sravenscraft/dev-ses-landing-page/ |
| ses-assets |
156719 |
/sandbox/sravenscraft/dev-ses-landing-page/ses-assets/ |
| site_logo |
156720 |
/sandbox/sravenscraft/dev-ses-landing-page/sitelogo/ |
| footer |
156723 |
/sandbox/sravenscraft/dev-ses-landing-page/footer/ |
| School of Environmental Sustainability Landing Page - UPDATE |
158862 |
/sandbox/sravenscraft/dev-seslandingthree/ |
| DEV-Strategic Plan |
159688 |
/sandbox/sravenscraft/strategic-plan-1873/ |
| custom_css |
159689 |
/sandbox/sravenscraft/strategic-plan-1873/customcss/ |
| custom_js |
159690 |
/sandbox/sravenscraft/strategic-plan-1873/customjs/ |
| home_content |
159706 |
/sandbox/sravenscraft/strategic-plan-1873/homecontent/ |
| DEV - Sample Site |
159828 |
/sandbox/sravenscraft/strategic-plan-1873/dev-samplesite/ |
| custom_css |
159829 |
/sandbox/sravenscraft/strategic-plan-1873/dev-samplesite/customcss/ |
| custom_js |
159830 |
/sandbox/sravenscraft/strategic-plan-1873/dev-samplesite/customjs/ |
| DEV-Commencement |
159847 |
/sandbox/sravenscraft/commencement-virtual-1873/ |
| custom_css |
159848 |
/sandbox/sravenscraft/commencement-virtual-1873/customcss/ |
| custom_js |
159849 |
/sandbox/sravenscraft/commencement-virtual-1873/customjs/ |
| home_content |
159914 |
/sandbox/sravenscraft/commencement-virtual-1873/homecontent/ |
| site_logo |
159915 |
/sandbox/sravenscraft/commencement-virtual-1873/sitelogo/ |
| footer |
159916 |
/sandbox/sravenscraft/commencement-virtual-1873/footer/ |
| Commencement 2021 - Assets |
160004 |
/sandbox/sravenscraft/commencement-virtual-1873/commencement2021-assets/ |
| Quinlan School of Business |
160435 |
/sandbox/sravenscraft/qsb/ |
| Accordion Only TEST |
161501 |
/sandbox/sravenscraft/accordiononlytest/ |
| Accordion Only TEST - BLANK |
161851 |
/sandbox/sravenscraft/accordiononlytest-blank/ |
| OVPR - Office of the Vice-Provost for Research - DEV |
183531 |
/sandbox/sravenscraft/ovpr-dev/ |
| T4 Tutorials |
176969 |
/sandbox/t4tutorials/ |
| site_logo |
176970 |
/sandbox/t4tutorials/sitelogo/ |
| Footer |
176971 |
/sandbox/t4tutorials/footer/ |
| cta |
176972 |
/sandbox/t4tutorials/cta/ |
| About |
176979 |
/sandbox/t4tutorials/about/ |
| Team |
176992 |
/sandbox/t4tutorials/team/ |
| Faculty and Staff |
176993 |
/sandbox/t4tutorials/team/facultyandstaff/ |
| arthurtest |
196461 |
/sandbox/arthurtest/ |
| test - ccj projects |
204014 |
/sandbox/arthurtest/test-ccjprojects/ |
| test-hold |
206501 |
/sandbox/arthurtest/test-hold/ |
| kguerrero4 Sandbox |
198947 |
/sandbox/kguerrero4/ |
| site_logo |
198948 |
/sandbox/kguerrero4/sitelogo/ |
| Footer |
198949 |
/sandbox/kguerrero4/footer/ |
| I Links |
198950 |
/sandbox/kguerrero4/ilinks/ |
| social media |
198952 |
/sandbox/kguerrero4/socialmedia/ |
| modules-programming |
198960 |
/sandbox/kguerrero4/modules-programming/ |
| Universal Template Default |
198969 |
/sandbox/kguerrero4/universaltemplate/ |
| Full Width Page |
198967 |
/sandbox/kguerrero4/fullwidthpage/ |
| Stories & News |
198961 |
/sandbox/kguerrero4/storiesnews/ |
| archive |
198962 |
/sandbox/kguerrero4/storiesnews/archive/ |
| Version 2 |
198963 |
/sandbox/kguerrero4/storiesnews/version2/ |
| archive |
198964 |
/sandbox/kguerrero4/storiesnews/version2/archive/ |
| Version 3 |
198965 |
/sandbox/kguerrero4/storiesnews/version3/ |
| archive |
198966 |
/sandbox/kguerrero4/storiesnews/version3/archive/ |
| Directory |
198979 |
/sandbox/kguerrero4/directory/ |
| Version 1 |
198980 |
/sandbox/kguerrero4/directory/v1/ |
| Profiles |
198981 |
/sandbox/kguerrero4/directory/v1/profiles/ |
| Version 2 |
198982 |
/sandbox/kguerrero4/directory/v2/ |
| Profiles |
198983 |
/sandbox/kguerrero4/directory/v2/profiles/ |
| Version 3 |
198984 |
/sandbox/kguerrero4/directory/v3/ |
| Directory w/ Search and Filter Buttons |
198985 |
/sandbox/kguerrero4/directory/v4/ |
| Profiles |
198986 |
/sandbox/kguerrero4/directory/v4/profiles/ |
| Graduate Students |
199316 |
/sandbox/kguerrero4/directory/graduatestudents/ |
| Profiles |
199317 |
/sandbox/kguerrero4/directory/graduatestudents/profiles/ |
| Sample Interior Page |
198972 |
/sandbox/kguerrero4/sampleinteriorpage/ |
| PDFs |
198973 |
/sandbox/kguerrero4/pdfs/ |
| Sample Page |
198974 |
/sandbox/kguerrero4/samplepage/ |
| Interior Page 1 (PCO) |
198975 |
/sandbox/kguerrero4/samplepage/interiorpage1pco/ |
| Interior Page 2 (Tabs 1) |
198976 |
/sandbox/kguerrero4/samplepage/interiorpage2tabs1/ |
| Interior Page 3 (Tabs 2) |
198977 |
/sandbox/kguerrero4/samplepage/interiorpage3tabs2/ |
| My Test Page |
198987 |
/sandbox/kguerrero4/mytestpage/ |
| right_column |
198988 |
/sandbox/kguerrero4/mytestpage/rightcolumn/ |
| ocarpenter Sandbox |
198991 |
/sandbox/ocarpentersandbox/ |
| site_logo |
198992 |
/sandbox/lnaqvi/sitelogo/ |
| Footer |
198993 |
/sandbox/lnaqvi/footer/ |
| cta |
198995 |
/sandbox/lnaqvi/cta/ |
| I Links |
198994 |
/sandbox/lnaqvi/ilinks/ |
| social media |
198996 |
/sandbox/lnaqvi/socialmedia/ |
| modules-programming |
199004 |
/sandbox/lnaqvi/modules-programming/ |
| Universal Template Default |
199013 |
/sandbox/lnaqvi/universaltemplate/ |
| Interior Page 1 |
198997 |
/sandbox/lnaqvi/interiorpage1/ |
| right_column |
198999 |
/sandbox/lnaqvi/interiorpage1/rightcolumn/ |
| Full Width Page |
199001 |
/sandbox/lnaqvi/interiorpage1/fullwidthpage/ |
| Stories & News |
199005 |
/sandbox/lnaqvi/storiesnews/ |
| archive |
199006 |
/sandbox/lnaqvi/storiesnews/archive/ |
| Version 2 |
199007 |
/sandbox/lnaqvi/storiesnews/version2/ |
| archive |
199008 |
/sandbox/lnaqvi/storiesnews/version2/archive/ |
| Version 3 |
199009 |
/sandbox/lnaqvi/storiesnews/version3/ |
| archive |
199010 |
/sandbox/lnaqvi/storiesnews/version3/archive/ |
| Directory |
199023 |
/sandbox/lnaqvi/directory/ |
| Version 1 |
199024 |
/sandbox/lnaqvi/directory/v1/ |
| Profiles |
199025 |
/sandbox/lnaqvi/directory/v1/profiles/ |
| Version 2 |
199026 |
/sandbox/lnaqvi/directory/v2/ |
| Profiles |
199027 |
/sandbox/lnaqvi/directory/v2/profiles/ |
| Version 3 |
199028 |
/sandbox/lnaqvi/directory/v3/ |
| Directory w/ Search and Filter Buttons |
199029 |
/sandbox/lnaqvi/directory/v4/ |
| Profiles |
199030 |
/sandbox/lnaqvi/directory/v4/profiles/ |
| Assets |
199017 |
/sandbox/lnaqvi/assets/ |
| Link to PDF |
204720 |
https://www.luc.edu/media/lucedu/finaid/forms/2025-2026forms/2025-2026pdfs/ImmaculataScholarshipApp_2025-26.pdf |
| syarwick |
190482 |
/sandbox/syarwick/ |
| site_logo |
190484 |
/sandbox/syarwick/sitelogo/ |
| I Links |
190485 |
/sandbox/syarwick/ilinks/ |
| cta |
190494 |
/sandbox/syarwick/cta/ |
| social media |
190495 |
/sandbox/syarwick/socialmedia/ |
| Grade Point Average Calculator |
199549 |
/sandbox/syarwick/tryingdifferentcontenttypes/gpa_calculator.shtml |
| Image Sizing |
200717 |
/sandbox/syarwick/tryingdifferentcontenttypes/imagesizing/ |
| modules-programming |
192164 |
/sandbox/syarwick/modules-programming/ |
| Footer |
190486 |
/sandbox/syarwick/footer/ |
| Resources |
201525 |
/sandbox/syarwick/resources/ |
| Testing Grounds |
202443 |
/sandbox/syarwick/testinggrounds/ |
| Page Content Only Testing |
202444 |
/sandbox/syarwick/testinggrounds/pagecontentonlytesting/ |
| Template Test |
202454 |
/sandbox/syarwick/testinggrounds/templatetest/ |
| Panel Divider |
202455 |
/sandbox/syarwick/testinggrounds/paneldivider/ |
| Image Content |
202456 |
/sandbox/syarwick/testinggrounds/imagecontent/ |
| Universal Image with Caption |
202457 |
/sandbox/syarwick/testinggrounds/universalimagewithcaption/ |
| Universal Media Card Item |
202458 |
/sandbox/syarwick/testinggrounds/universalmediacarditem/ |
| Universal Intro Text |
202459 |
/sandbox/syarwick/testinggrounds/universalintrotext/ |
| Universal Section Header |
202460 |
/sandbox/syarwick/testinggrounds/universalsectionheader/ |
| Universal Statistic Item |
202461 |
/sandbox/syarwick/testinggrounds/universalstatisticitem/ |
| Universal Hero Image |
202462 |
/sandbox/syarwick/testinggrounds/universalheroimage/ |
| Accordion Item – Nested |
202465 |
/sandbox/syarwick/testinggrounds/accordionitemnested/ |
| Universal Button Text |
202466 |
/sandbox/syarwick/testinggrounds/universalbuttontext/ |
| Universal Infobox - NEEDS UPDATED |
202467 |
/sandbox/syarwick/testinggrounds/universalinfobox-needsupdated/ |
| Lead Image |
203404 |
/sandbox/syarwick/testinggrounds/leadimage/ |
| Universal Panel Button CTA |
203406 |
/sandbox/syarwick/testinggrounds/universalpanelbuttoncta/ |
| Universal Programming Panel |
203407 |
/sandbox/syarwick/testinggrounds/universalprogrammingpanel/ |
| modules-programming |
203546 |
/sandbox/syarwick/testinggrounds/universalprogrammingpanel/modules-programming/ |
| Universal Refer Panel |
203547 |
/sandbox/syarwick/testinggrounds/universalreferpanel/ |
| Universal Tab Panel |
203548 |
/sandbox/syarwick/testinggrounds/universaltabpanel/ |
| Tabs |
203549 |
/sandbox/syarwick/testinggrounds/tabs/ |
| Universal Video Card Item |
203550 |
/sandbox/syarwick/testinggrounds/universalvideocarditem/ |
| Universal Blockquote |
203552 |
/sandbox/syarwick/testinggrounds/universalblockquote/ |
| Universal Blockquote with Image Overlay |
203553 |
/sandbox/syarwick/testinggrounds/universalblockquotewithimageoverlay/ |
| Universal Buttons Panel |
203554 |
/sandbox/syarwick/testinggrounds/universalbuttonspanel/ |
| Universal Announcement Bar |
203555 |
/sandbox/syarwick/testinggrounds/universalannouncementbar/ |
| Universal Image Grid Panel |
203556 |
/sandbox/syarwick/testinggrounds/universalimagegridpanel/ |
| Universal LGS Buttons |
203557 |
/sandbox/syarwick/testinggrounds/universallgsbuttons/ |
| Modal |
204280 |
/sandbox/syarwick/testinggrounds/modal/ |
| Table |
204281 |
/sandbox/syarwick/testinggrounds/table/ |
| audio file embed |
204282 |
/sandbox/syarwick/testinggrounds/audiofileembed/ |
| Directory Feed |
204283 |
/sandbox/syarwick/testinggrounds/directoryfeed/ |
| Profiles |
204291 |
/sandbox/syarwick/testinggrounds/directoryfeed/profiles/ |
| Lead Video Embed |
204284 |
/sandbox/syarwick/testinggrounds/leadvideoembed/ |
| Table Accordion |
204285 |
/sandbox/syarwick/testinggrounds/tableaccordion/ |
| Universal 2 Column Image Left or Image Right |
204286 |
/sandbox/syarwick/testinggrounds/universal2columnimageleftorimageright/ |
| Universal Audience Nav |
204287 |
/sandbox/syarwick/testinggrounds/universalaudiencenav/ |
| Universal Events Panel |
204288 |
/sandbox/syarwick/testinggrounds/universaleventspanel/ |
| modules-events |
204297 |
/sandbox/syarwick/testinggrounds/universaleventspanel/modules-events/ |
| Universal List Card Item |
204289 |
/sandbox/syarwick/testinggrounds/universallistcarditem/ |
| Universal News Panel |
204290 |
/sandbox/syarwick/testinggrounds/universalnewspanel/ |
| News |
204293 |
/sandbox/syarwick/testinggrounds/universalnewspanel/news/ |
| Word Documents |
204206 |
/sandbox/syarwick/worddocuments/ |
| docments |
204207 |
/sandbox/syarwick/worddocuments/docments/ |
| colors |
207021 |
/sandbox/syarwick/colors/ |
| Subscribe |
207469 |
/sandbox/syarwick/subscribe/ |
| Pattern Library |
60585 |
/patternlibrary/ |
| Framework |
177250 |
/patternlibrary/framework/ |
| right_column |
185670 |
/patternlibrary/framework/rightcolumn/ |
| Typography |
163428 |
/patternlibrary/typography/ |
| right_column |
185731 |
/patternlibrary/typography/rightcolumn/ |
| Design Patterns |
188257 |
/patternlibrary/designpatterns/ |
| Panels - General |
177252 |
/patternlibrary/designpatterns/panels-general/ |
| modules-programming |
177275 |
/patternlibrary/designpatterns/panels-general/modules-programming/ |
| Panels - Charts |
185669 |
/patternlibrary/designpatterns/panels-charts/ |
| Panels - Interactive |
177253 |
/patternlibrary/designpatterns/panels-interactive/ |
| Modal - Page Content Only |
189984 |
/patternlibrary/designpatterns/panels-interactive/modal-pagecontentonly/ |
| Modal - Carousel |
189985 |
/patternlibrary/designpatterns/panels-interactive/modal-carousel/ |
| Panels - Image Combinations |
177251 |
/patternlibrary/designpatterns/panels-imagecombinations/ |
| Panels - Video Hero |
205520 |
/patternlibrary/designpatterns/panels-videohero/ |
| Storytelling |
188258 |
/patternlibrary/storytelling/ |
| Story - Prototype - Tier Two |
185704 |
/patternlibrary/storytelling/story-prototype-tiertwo/ |
| Resources |
188561 |
/patternlibrary/resources/ |
| Publications Templates |
204454 |
/patternlibrary/publicationstemplates/ |
| Landing Page - TOC |
204466 |
/patternlibrary/development/publicationstemplates/landingpage-toc/ |
| Landing Page - Modal Content - Message |
204727 |
/patternlibrary/development/publicationstemplates/landingpage-toc/landingpage-modalcontent-message/ |
| Landing Page - Modal Content - Story |
205205 |
/patternlibrary/development/publicationstemplates/landingpage-toc/landingpage-modalcontent-story/ |
| Accordion Group |
204473 |
/patternlibrary/development/publicationstemplates/accordiongroup/ |
| Accordion Group + Nested Accordions |
204468 |
/patternlibrary/development/publicationstemplates/accordiongroupnestedaccordions/ |
| Blockquote |
204478 |
/patternlibrary/development/publicationstemplates/blockquote/ |
| Blockquote + Background Image |
204479 |
/patternlibrary/development/publicationstemplates/blockquotebackgroundimage/ |
| Hero Image + Overview |
204481 |
/patternlibrary/development/publicationstemplates/heroimageoverview/ |
| Image Group - One + Two + Caption |
204504 |
/patternlibrary/development/publicationstemplates/imagegroup-onetwocaption/ |
| Link |
204778 |
/patternlibrary/development/publicationstemplates/link/ |
| Media Cards - Group of Two |
204471 |
/patternlibrary/development/publicationstemplates/mediacards-groupoftwo/ |
| Media Cards - Group of Three + White Background |
205283 |
/patternlibrary/development/publicationstemplates/mediacards-groupofthreewhitebackground/ |
| Media Cards - Group of Three + Extra Light Gray Background |
204755 |
/patternlibrary/development/publicationstemplates/mediacards-groupofthreeextralightgraybackground/ |
| Media Cards - Group of Four - Two Rows of Two Cards + White Background |
204469 |
/patternlibrary/development/publicationstemplates/mediacards-groupoffour-tworowsoftwocardswhitebackground/ |
| Media Cards - Group of Four - Two Rows of Two Cards + Extra Light Gray Background |
205284 |
/patternlibrary/development/publicationstemplates/mediacards-groupoffour-tworowsoftwocardsextralightgraybackground/ |
| Media Cards - Group of Six |
204470 |
/patternlibrary/development/publicationstemplates/mediacards-groupofsix/ |
| Media Cards - One Column - Stacked |
204472 |
/patternlibrary/development/publicationstemplates/mediacards-onecolumn-stacked/ |
| Modal |
204684 |
/patternlibrary/development/publicationstemplates/modal/ |
| Modal Content |
204685 |
/patternlibrary/development/publicationstemplates/modal/modalcontent/ |
| Section Label |
205401 |
/patternlibrary/development/publicationstemplates/sectionlabel/ |
| Statistics - Group of Three + Background Color |
204475 |
/patternlibrary/development/publicationstemplates/statistics-groupofthreebackgroundcolor/ |
| Statistics - Group of Three + Background Image |
204476 |
/patternlibrary/development/publicationstemplates/statistics-groupofthreebackgroundimage/ |
| Statistics - Group of Six + Background Image |
205414 |
/patternlibrary/development/publicationstemplates-master/statistics-groupofsixbackgroundimage/ |
| Tabs Ensemble - Group of Three Subjects |
204477 |
/patternlibrary/development/publicationstemplates/tabsensemble-groupofthreesubjects/ |
| Story |
204784 |
/patternlibrary/development/publicationstemplates/story/ |
| Testing Ground |
204682 |
/testingground/ |
| site_logo |
204688 |
/testingground/sitelogo/ |
| I Links |
204689 |
/testingground/ilinks/ |
| social media |
204690 |
/testingground/socialmedia/ |
| cta |
204691 |
/testingground/cta/ |
| Content Types |
204687 |
/testingground/contenttypes/ |
| Universal Hero Video |
204686 |
/testingground/contenttypes/universalherovideo/ |
| Default |
204683 |
/testingground/contenttypes/universalherovideo/default/ |
| Sample Page |
205096 |
/testingground/contenttypes/universalherovideo/default/samplepage/ |
| Content Centered |
204692 |
/testingground/contenttypes/universalherovideo/contentcentered/ |
| Sample Page |
205095 |
/testingground/contenttypes/universalherovideo/contentcentered/samplepage/ |
| Video Only |
204693 |
/testingground/contenttypes/universalherovideo/videoonly/ |
| Sample Page |
205097 |
/testingground/contenttypes/universalherovideo/videoonly/samplepage/ |
| Static Image |
204694 |
/testingground/contenttypes/universalherovideo/staticimage/ |
| Universal Statistic Item |
206133 |
/testingground/contenttypes/universalstatisticitem/ |
| Default |
206134 |
/testingground/contenttypes/universalstatisticitem/default/ |
| Sample Page |
206135 |
/testingground/contenttypes/universalstatisticitem/default/samplepage/ |
| Maroon Background |
206136 |
/testingground/contenttypes/universalstatisticitem/maroonbackground/ |
| Sample Page |
206137 |
/testingground/contenttypes/universalstatisticitem/maroonbackground/samplepage/ |
| Gold Background |
206138 |
/testingground/contenttypes/universalstatisticitem/goldbackground/ |
| Sample Page |
206139 |
/testingground/contenttypes/universalstatisticitem/goldbackground/samplepage/ |
| Image Background |
206142 |
/testingground/contenttypes/universalstatisticitem/imagebackground/ |
| Sample Page |
206143 |
/testingground/contenttypes/universalstatisticitem/imagebackground/samplepage/ |
| Universal 2 Column Image Left or Image Right |
206154 |
/testingground/contenttypes/universal2columnimageleftorimageright/ |
| Default |
206155 |
/testingground/contenttypes/universal2columnimageleftorimageright/default/ |
| Sample Page |
206156 |
/testingground/contenttypes/universal2columnimageleftorimageright/default/samplepage/ |
| Right Image |
206157 |
/testingground/contenttypes/universal2columnimageleftorimageright/rightimage/ |
| Sample Page |
206158 |
/testingground/contenttypes/universal2columnimageleftorimageright/rightimage/samplepage/ |
| Lead Image |
206212 |
/testingground/contenttypes/leadimage/ |
| Default |
206213 |
/testingground/contenttypes/leadimage/default/ |
| Sample Page |
206214 |
/testingground/contenttypes/leadimage/default/samplepage/ |
| Full Overlay |
206215 |
/testingground/contenttypes/leadimage/fulloverlay/ |
| Sample Page |
206216 |
/testingground/contenttypes/leadimage/fulloverlay/samplepage/ |
| Accordion Item |
206246 |
/testingground/contenttypes/accordionitem/ |
| Default |
206247 |
/testingground/contenttypes/accordionitem/default/ |
| Sample Page |
206248 |
/testingground/contenttypes/accordionitem/default/samplepage/ |
| Template Guidance - DEV |
198071 |
/templateguidance-dev/ |
| Typography |
198072 |
/templateguidance-dev/typography/ |
| Content Types |
200760 |
/templateguidance-dev/contenttypes/ |
| Accordion Item |
200762 |
/templateguidance-dev/contenttypes/accordionitem/ |
| List of Resources |
201560 |
/templateguidance-dev/contenttypes/listofresources/ |
| Accordion Item Nested |
200763 |
/templateguidance-dev/contenttypes/accordionitemnested/ |
| Image Content |
200766 |
/templateguidance-dev/contenttypes/imagecontent/ |
| Lead Image |
201052 |
/templateguidance-dev/contenttypes/leadimage/ |
| Lead Image Example |
201053 |
/templateguidance-dev/contenttypes/leadimage/leadimageexample/ |
| Section Template |
200772 |
/templateguidance-dev/contenttypes/sectiontemplate/ |
| Universal Button Text |
200788 |
/templateguidance-dev/contenttypes/universalbuttontext/ |
| Universal Buttons Panel |
200789 |
/templateguidance-dev/contenttypes/universalbuttonspanel/ |
| Universal Hero Image |
200791 |
/templateguidance-dev/contenttypes/universalheroimage/ |
| Universal Image with Caption |
200795 |
/templateguidance-dev/contenttypes/universalimagewithcaption/ |
| Universal Infobox |
200796 |
/templateguidance-dev/contenttypes/universalinfobox/ |
| Universal Intro Text |
200797 |
/templateguidance-dev/contenttypes/universalintrotext/ |
| Universal LGS Buttons |
200798 |
/templateguidance-dev/contenttypes/universallgsbuttons/ |
| Universal Media Card Item |
200799 |
/templateguidance-dev/contenttypes/universalmediacarditem/ |
| Universal Programming Panel |
200800 |
/templateguidance-dev/contenttypes/universalprogrammingpanel/ |
| Universal Refer Panel |
200801 |
/templateguidance-dev/contenttypes/universalreferpanel/ |
| Universal Section Header |
200802 |
/templateguidance-dev/contenttypes/universalsectionheader/ |
| Universal Statistic Item |
200803 |
/templateguidance-dev/contenttypes/universalstatisticitem/ |
| right_column |
201561 |
/templateguidance-dev/contenttypes/rightcolumn/ |
| Images |
200726 |
/templateguidance-dev/images/ |
| Hero Images |
200743 |
/templateguidance-dev/images/heroimages/ |
| Image Optimization |
200718 |
/templateguidance-dev/images/imageoptimization/ |
| Image Sizing |
202453 |
/templateguidance-dev/images/imagesizing/ |
| Tutorials |
198101 |
/templateguidance-dev/tutorials/ |
| Overview Panel |
198088 |
/templateguidance-dev/tutorials/overviewpanel/ |
| Media Cards |
198243 |
/templateguidance-dev/tutorials/mediacards/ |
| Media Card Display Settings |
198436 |
/templateguidance-dev/tutorials/mediacards/mediacarddisplaysettings/ |
| Media Card Group Settings |
198423 |
/templateguidance-dev/tutorials/mediacards/mediacardgroupsettings/ |
| Media Card Images |
198495 |
/templateguidance-dev/tutorials/mediacards/mediacardimages/ |
| Sample Site for Duplication |
163420 |
/samplesite/ |
| site_logo |
163421 |
/samplesite/sitelogo/ |
| Footer |
163422 |
/samplesite/footer/ |
| I Links |
163423 |
/samplesite/ilinks/ |
| social media |
163425 |
/samplesite/socialmedia/ |
| modules-programming |
163704 |
/samplesite/modules-programming/ |
| Universal Template Default |
182289 |
/samplesite/universaltemplate/ |
| Elevated Page |
163429 |
/samplesite/elevatedpage/ |
| Interior Page 1 |
163427 |
/samplesite/interiorpage1/ |
| right_column |
168930 |
/samplesite/interiorpage1/rightcolumn/ |
| Full Width Page |
186960 |
/samplesite/interiorpage1/fullwidthpage/ |
| Story - Prototype |
169045 |
/samplesite/interiorpage1/story-prototype/ |
| Exposure Story - Embed |
187212 |
/samplesite/interiorpage1/exposurestory-embed/ |
| Image Sizing |
202452 |
/samplesite/interiorpage1/imagesizing/ |
| Full Width Page |
182286 |
/samplesite/fullwidthpage/ |
| Directory |
192223 |
/samplesite/directory/ |
| Version 1 |
184510 |
/samplesite/directory/v1/ |
| Profiles |
184511 |
/samplesite/directory/v1/profiles/ |
| Version 2 |
185530 |
/samplesite/directory/v2/ |
| Profiles |
185531 |
/samplesite/directory/v2/profiles/ |
| Version 3 |
185585 |
/samplesite/directory/v3/ |
| Directory w/ Search and Filter Buttons |
192064 |
/samplesite/directory/v4/ |
| Profiles |
192065 |
/samplesite/directory/v4/profiles/ |
| Stories & News |
167012 |
/samplesite/storiesnews/ |
| archive |
167013 |
/samplesite/storiesnews/archive/ |
| Version 2 |
184933 |
/samplesite/storiesnews/version2/ |
| archive |
184934 |
/samplesite/storiesnews/version2/archive/ |
| Version 3 |
188907 |
/samplesite/storiesnews/version3/ |
| archive |
188908 |
/samplesite/storiesnews/version3/archive/ |
| Sample Interior Page |
189696 |
/samplesite/sampleinteriorpage/ |
| Assets |
191348 |
/samplesite/assets/ |
| Sample Page |
191753 |
/samplesite/samplepage/ |
| Interior Page 1 (PCO) |
191823 |
/samplesite/samplepage/interiorpage1pco/ |
| Simple Site Sample |
197124 |
/samplehomepage/ |
| site_logo |
197127 |
/samplehomepage/sitelogo/ |
| Footer |
198262 |
/samplehomepage/footer/ |
| social media |
197126 |
/samplehomepage/socialmedia/ |
| cta |
198261 |
/samplehomepage/cta/ |
| modules-programming |
197125 |
/samplehomepage/modules-programming/ |
| Interior Page 1 |
197147 |
/samplehomepage/interiorpage1/ |
| Sample Link Section |
200723 |
/samplehomepage/stories/ |
| Overview |
199794 |
/samplehomepage/interiorpage1/ |
| Child Page 1 |
197149 |
/samplehomepage/interiorpage1/childpage1/ |
| Interior Page 2 |
197148 |
/samplehomepage/interiorpage2/ |
| subpage 1 |
206522 |
/samplehomepage/interiorpage2/subpage1/ |
| subpage 2 |
206523 |
/samplehomepage/interiorpage2/subpage2/ |
| Stories |
198392 |
/samplehomepage/stories/ |
| archive |
198393 |
/samplehomepage/stories/archive/ |
| Sample Story or News Page |
202409 |
/samplehomepage/stories/samplestory/ |
| Directory |
198394 |
/samplehomepage/directory/ |
| profiles |
198395 |
/samplehomepage/directory/profiles/ |
| Directory V2 |
201921 |
/samplehomepage/directoryv2/ |
| profiles |
201922 |
/samplehomepage/directoryv2/profiles/ |
| right_column |
199309 |
/samplehomepage/directoryv2/profiles/rightcolumn/ |
| Test Page |
205815 |
/samplehomepage/testpage/ |
| Test Page 1 |
200755 |
/samplehomepage/testpage1/ |
| Test Page 3 |
204774 |
/samplehomepage/testpage3/ |
| t4test |
203052 |
/t4test/ |
| I Links |
188955 |
/ilinks/ |
| modules-programming |
188965 |
/modules-programming/ |
| President’s Report |
205731 |
/presidentsreport/ |
| site_logo |
206183 |
/presidentsreport/sitelogo/ |
| Message - A bright light of knowledge |
205732 |
/pr25-012225-dev/message-abrightlightofknowledge/ |
| Research - Recognizing excellence |
205739 |
/pr25-012225-dev/research-recognizingexcellence/ |
| Research - Early humans |
205830 |
/pr25-012225-dev/research-earlyhumans/ |
| Research - Understanding obesity |
205740 |
/pr25-012225-dev/research-understandingobesity/ |
| Research - Political effectiveness |
205741 |
/pr25-012225-dev/research-politicaleffectiveness/ |
| Research - A.I. in the classroom |
205742 |
/pr25-012225-dev/research-aiintheclassroom/ |
| Research - Heavy drinking slower recovery |
205743 |
/pr25-012225-dev/research-heavydrinkingslowerrecovery/ |
| Research - Muskrats key to Great Lake health |
205744 |
/pr25-012225-dev/research-muskratskeytogreatlakehealth/ |
| Research - Anti-inflammatory to treat dry-eye |
205745 |
/pr25-012225-dev/research-anti-inflammatorytotreatdry-eye/ |
| Research - Local economies |
205832 |
/pr25-012225-dev/research-localeconomies/ |
| Research - Health risks for female athletes |
205746 |
/pr25-012225-dev/research-healthrisksforfemaleathletes/ |
| Sustainability - Climate Action Plan |
205747 |
/pr25-012225-dev/sustainability-climateactionplan/ |
| Athletics - Student athletes making a difference |
205748 |
/pr25-012225-dev/athletics-studentathletesmakingadifference/ |
| Athletics - By the numbers |
205845 |
/pr25-012225-dev/athletics-bythenumbers/ |
| Campus Plan - A vision for the future |
205749 |
/pr25-012225-dev/campusplan-avisionforthefuture/ |
| Innovation - Holistic Immigration Hub |
205750 |
/pr25-012225-dev/innovation-holisticimmigrationhub/ |
| Academics - By the numbers |
205886 |
/pr25-012225-dev/academics-bythenumbers/ |
| Mission - Generosity propels mission |
205920 |
/pr25-012225-dev/mission-generositypropelsmission/ |
| Mission - Center for Polish Diaspora |
205751 |
/pr25-012225-dev/mission-centerforpolishdiaspora/ |
| Mission - Sustainable food systems |
205752 |
/pr25-012225-dev/mission-sustainablefoodsystems/ |
| Mission - Opportunities for Arrupe students |
205753 |
/pr25-012225-dev/mission-opportunitiesforarrupestudents/ |
| Mission - Strengthening clinical education |
205754 |
/pr25-012225-dev/mission-strengtheningclinicaleducation/ |
| Mission - Honoring a son |
205755 |
/pr25-012225-dev/mission-honoringason/ |
| Loyola - By the numbers |
205914 |
/pr25-012225-dev/loyola-bythenumbers/ |
| Loyola - By the numbers - Charts |
205922 |
/pr25-012225-dev/loyola-bythenumbers-charts/ |
| 2024 Redirect |
206268 |
/presidentsreport/2024/ |
| LUC Navigation Landing Pages - DEV - 022526 |
206321 |
/lucnavigationlandingpages-dev-022526/ |
| UG Program Template Page - DEV |
206262 |
/ugprogramtemplatepage-dev/ |
| UX and Biometrics Lab - DEV |
205570 |
/uxandbiometricslab-dev/ |
| site_logo |
205571 |
/uxbiometricslab-dev/sitelogo/ |
| Footer |
205572 |
/uxandbiometricslab-dev/footer/ |
| social media |
205574 |
/uxandbiometricslab-dev/socialmedia/ |
| cta |
205575 |
/uxandbiometricslab-dev/cta/ |
| modules-programming |
205576 |
/uxandbiometricslab-dev/modules-programming/ |
| News |
205612 |
/uxandbiometricslab-dev/news/ |
| Blog |
205615 |
/uxandbiometricslab-dev/news/blog/ |
| archive |
205710 |
/uxandbiometricslab-dev/news/blog/archive/ |
| Talks |
205616 |
/uxandbiometricslab-dev/news/talks/ |
| archive |
205726 |
/uxandbiometricslab-dev/news/talks/archive/ |
| Media and Press |
205617 |
/uxandbiometricslab-dev/news/mediaandpress/ |
| archive |
207228 |
/uxandbiometricslab-dev/news/mediaandpress/archive/ |
| Lab Activity |
205618 |
/uxandbiometricslab-dev/news/labactivity/ |
| archive |
205725 |
/uxandbiometricslab-dev/news/labactivity/archive/ |
| About the Lab |
205613 |
/uxandbiometricslab-dev/aboutthelab/ |
| Current Team |
205619 |
/uxandbiometricslab-dev/aboutthelab/currentteam/ |
| Current Projects |
205620 |
/uxandbiometricslab-dev/aboutthelab/currentprojects/ |
| Publications |
205621 |
/uxandbiometricslab-dev/aboutthelab/publications/ |
| Collaborators |
205622 |
/uxandbiometricslab-dev/aboutthelab/collaborators/ |
| Partner Labs and Institutions |
205623 |
/uxandbiometricslab-dev/aboutthelab/partnerlabsandinstitutions/ |
| Past Research Assistants |
205624 |
/uxandbiometricslab-dev/aboutthelab/pastresearchassistants/ |
| Past Lab Fellows |
205625 |
/uxandbiometricslab-dev/aboutthelab/pastlabfellows/ |
| Student Research |
205614 |
/uxandbiometricslab-dev/studentresearch/ |
| Spring 2025 Student Research |
205626 |
/uxandbiometricslab-dev/studentresearch/spring2025studentresearch/ |
| Spring 2024 Student Research |
205627 |
/uxandbiometricslab-dev/studentresearch/spring2024studentresearch/ |
| CCJ0925 - DEV |
203975 |
/ccj-dev/ |
| site_logo |
203982 |
/ccj-dev/sitelogo/ |
| modules-programming |
203989 |
/ccj-dev/modules-programming/ |
| Projects |
203996 |
/ccj-dev/projects/ |
| Prosecutorial Performance Indicators |
204013 |
/ccj-dev/projects/prosecutorialperformanceindicators/ |
| modules-programming |
204015 |
/ccj-dev/projects/prosecutorialperformanceindicators/modules-programming/ |
| Publications - V1 |
206121 |
/ccj-dev/publications-v1/ |
| Publications - V2 |
203997 |
https://loyolaccj.org/blog |
| People |
203994 |
/ccj-dev/people/ |
| David E. Olson, PhD |
204031 |
https://www.luc.edu/criminaljustice/about/faculty/aggregatefacultypage/profiles/olson.shtml |
| Don Stemen, PhD |
204032 |
https://www.luc.edu/criminaljustice/about/faculty/aggregatefacultypage/profiles/stemen.shtml |
| Amanda Ward, PhD |
204033 |
https://www.luc.edu/curl/staff/index.shtml |
| Patrick Griffin, JD |
204034 |
https://www.luc.edu/criminaljustice/about/faculty/aggregatefacultypage/profiles/griffin.shtml |
| Branden DuPont, MS |
204035 |
/ccj-dev/people/brandendupontms/ |
| Work With Us |
203995 |
/ccj-dev/workwithus/ |
| News |
203990 |
/ccj-dev/news1/ |
| CCJ News |
203992 |
/ccj-dev/news/ |
| archive |
203991 |
/ccj-dev/news/archive/ |
| Center for Simulation Education |
199660 |
/simulation/ |
| site_logo |
199662 |
/hsc-simulation-dev/sitelogo/ |
| Footer |
199663 |
/hsc-simulation-dev/footer/ |
| cta |
199664 |
/hsc-simulation-dev/cta/ |
| social media |
199666 |
/hsc-simulation-dev/socialmedia/ |
| About CSE |
199874 |
/hsc-simulation-dev/aboutcse/ |
| profiles |
207171 |
/hsc-simulation-dev/aboutcse/cseteam/profiles/ |
| CSE Team |
199880 |
/hsc-simulation-dev/aboutcse/cseteam/ |
| profiles |
207360 |
/simulation/aboutcse/cseteam/csefaculty/profiles/ |
| Policy and Procedure Manual |
199881 |
/hsc-simulation-dev/aboutcse/policyandproceduremanual/ |
| CSE Equipment and Supplies |
199882 |
/hsc-simulation-dev/aboutcse/cseequipmentandsupplies/ |
| Medical Equipment Descriptions |
203387 |
/hsc-simulation-dev/aboutcse/cseequipmentandsupplies/medicalequipmentdescriptions/ |
| High-Fidelity Manikin Descriptions |
203388 |
/hsc-simulation-dev/aboutcse/cseequipmentandsupplies/high-fidelitymanikindescriptions/ |
| Physical Exam Skills Task Trainer Descriptions |
203391 |
/hsc-simulation-dev/aboutcse/cseequipmentandsupplies/physicalexamskillstasktrainerdescriptions/ |
| Procedural Task Trainer Descriptions |
203394 |
/hsc-simulation-dev/aboutcse/cseequipmentandsupplies/proceduraltasktrainerdescriptions/ |
| Selfridge Clinical Skills Center Equipment |
203392 |
/hsc-simulation-dev/aboutcse/cseequipmentandsupplies/selfridgeclinicalskillscenterequipment/ |
| Mundelein Equipment List |
203393 |
/hsc-simulation-dev/aboutcse/cseequipmentandsupplies/mundeleinequipmentlist/ |
| Our Services |
199875 |
/hsc-simulation-dev/ourservices/ |
| Facilities |
199876 |
/hsc-simulation-dev/facilities/ |
| Advanced Procedure Education Center (APEC) |
199883 |
/hsc-simulation-dev/facilities/advancedprocedureeducationcenterapec/ |
| Behavioral Health Simulation Lab, Water Tower Campus |
207466 |
/simulation/facilities/behavioralhealthsimulationlabwatertowercampus/ |
| Mundelein Center Nursing Simulation Lab |
199884 |
/hsc-simulation-dev/facilities/mundeleincenternursingsimulationlab/ |
| Selfridge Clinical Skills Center |
199885 |
/hsc-simulation-dev/facilities/selfridgeclinicalskillscenter/ |
| Stamm Procedural Training Center & Bedside Teaching Lab |
199886 |
/hsc-simulation-dev/facilities/stammproceduraltrainingcenterbedsideteachinglab/ |
| Walgreen Family Virtual Hospital |
199887 |
/hsc-simulation-dev/facilities/walgreenfamilyvirtualhospital/ |
| Faculty Resources |
199877 |
/hsc-simulation-dev/facultyresources/ |
| Standardized Participant Program |
199878 |
/hsc-simulation-dev/standardizedparticipantprogram/ |
| modules-programming |
207361 |
/simulation/modules-programming/ |
| A-Z Index |
30758 |
/a-zindex/ |
| cta |
206592 |
/a-zindex/cta/ |
| old_files |
89403 |
/a-zindex/oldfiles/ |
| site_background |
89383 |
/a-zindex/oldfiles/sitebackground/ |
| About LOCUS |
157117 |
/aboutlocus/ |
| site_logo |
157118 |
/aboutlocus/sitelogo/ |
| footer |
157119 |
/aboutlocus/footer/ |
| Student Resources |
158486 |
/aboutlocus/studentresources/ |
| Staff & Faculty Resources |
158922 |
/aboutlocus/stafffacultyresources/ |
| Administrative Forms |
159203 |
/aboutlocus/administrativeforms/ |
| Academic Advising |
124598 |
/advising/ |
| Navigate360 |
206809 |
/advising/navigate360/ |
| Schedule an Appointment |
207443 |
/advising/navigate360/scheduleanappointment/ |
| First and Second Year Academic Advising |
124599 |
/advising/firstandsecondyearacademicadvising/ |
| Contact Us |
124601 |
/advising/firstandsecondyearacademicadvising/contactus/ |
| Meet Your Advisor |
126110 |
/advising/firstandsecondyearacademicadvising/meetyouradvisor/ |
| Orientation |
126111 |
/advising/firstandsecondyearacademicadvising/orientation/ |
| Junior and Senior Academic Advising |
124602 |
/advising/juniorandsenioracademicadvising/ |
| College of Arts & Sciences |
126113 |
/advising/juniorandsenioracademicadvising/collegeofartssciences/ |
| Quinlan School of Business |
126114 |
/advising/juniorandsenioracademicadvising/quinlanschoolofbusiness/ |
| School of Communication |
126115 |
/advising/juniorandsenioracademicadvising/schoolofcommunication/ |
| School of Education |
126116 |
/advising/juniorandsenioracademicadvising/schoolofeducation/ |
| School of Environmental Sustainability |
126119 |
/advising/juniorandsenioracademicadvising/schoolofenvironmentalsustainability/ |
| Parkinson School of Health Sciences and Public Health |
126120 |
/advising/juniorandsenioracademicadvising/parkinsonschoolofhealthsciencesandpublichealth/ |
| Marcella Niehoff School of Nursing |
126117 |
/advising/juniorandsenioracademicadvising/marcellaniehoffschoolofnursing/ |
| School of Social Work |
126118 |
/advising/juniorandsenioracademicadvising/schoolofsocialwork/ |
| School of Continuing & Professional Studies |
202047 |
https://www.luc.edu/scps/studentexperience/onlinelearning/ |
| Specialty Advising |
124603 |
/advising/specialtyadvising/ |
| Achieving College Excellence |
126121 |
/advising/specialtyadvising/achievingcollegeexcellence/ |
| Student-Athlete Academic Services |
126122 |
/advising/specialtyadvising/student-athleteacademicservices/ |
| Pre-Health Advising |
126123 |
/advising/specialtyadvising/pre-healthadvising/ |
| Pre-Law Advising |
126125 |
/advising/specialtyadvising/pre-lawadvising/ |
| Success Skills & Support |
124604 |
/advising/successskillssupport/ |
| Getting Back on Track this Semester! |
126131 |
/advising/successskillssupport/gettingbackontrackthissemester/ |
| Tutoring Resources |
126129 |
/advising/successskillssupport/tutoringresources/ |
| Writing Center |
126130 |
/advising/successskillssupport/writingcenter/ |
| site_logo |
126107 |
/advising/sitelogo/ |
| Grade Point Average Calculator |
126132 |
/advising/gpacalculator/ |
| GPA Calculator |
199690 |
/advising/gpacalculator/launch/ |
| Test Page |
126135 |
/advising/testpage/ |
| Footer |
198566 |
/advising/footer/ |
| social media |
198568 |
/advising/socialmedia/ |
| cta |
198569 |
/advising/cta/ |
| Academic Affairs, Division of |
36148 |
/academicaffairs/index.shtml |
| site_logo |
36230 |
/academicaffairs/sitelogo/ |
| Footer |
36229 |
/academicaffairs/footer/ |
| cta |
198578 |
/academicaffairs/cta/ |
| modules-programming |
198577 |
/academicaffairs/modules-programming/ |
| social media |
198580 |
/academicaffairs/socialmedia/ |
| I Links |
198579 |
/academicaffairs/ilinks/ |
| About Us |
36141 |
/academicaffairs/aboutus/ |
| Organization Charts |
155358 |
/academicaffairs/aboutus/organizationcharts/ |
| Council of Deans |
201570 |
/universityleadership/leadershipandadministration/councilofdeans/ |
| Accreditation |
189054 |
https://www.luc.edu/accreditation/ |
| Colleges, Schools, and Institutes |
70194 |
http://luc.edu/academics/schools.shtml |
| Academic Business and Operations Team (ABOT) |
126846 |
/academicaffairs/aboutus/abot/ |
| Announcements |
201589 |
/academicaffairs/aboutus/announcements/ |
| archive |
201591 |
/academicaffairs/aboutus/announcements/archive/ |
| right_column |
201592 |
/academicaffairs/aboutus/announcements/rightcolumn/ |
| AJCU Conference |
89594 |
/academicaffairs/aboutus/announcements/ajcuconference/ |
| Map (PDF) |
90128 |
https://www.luc.edu/media/lucedu/academicaffairs/ajcu-conference/wtc%20map.pdf |
| AJCU Website |
89598 |
http://www.ajcunet.edu/ |
| Documents |
90737 |
/academicaffairs/aboutus/announcements/ajcuconference/documents/ |
| Events |
200661 |
/academicaffairs/aboutus/events/ |
| University Convocation |
202230 |
/signatureacademicevents/universityconvocation/ |
| Contact Us |
36145 |
/academicaffairs/aboutus/contactus/ |
| Academic Programs, Development, and Review |
36149 |
/academicaffairs/academicprogramsdevelopmentandreview/ |
| Academic Catalog |
36235 |
http://www.luc.edu/academics/catalog/undergrad/index.shtml |
| Curriculum Development |
99868 |
/academicaffairs/academicprograms/curriculumdevelopment/ |
| Board of Undergraduate Studies (BUS) |
99906 |
/academicaffairs/academicprograms/curriculumdevelopment/boardofundergraduatestudiesbus/ |
| Charge and Membership |
100367 |
/academicaffairs/academicprograms/curriculumdevelopment/boardofundergraduatestudiesbus/chargeandmembership/ |
| BUS Current Members 2025-2026 |
100541 |
/academicaffairs/academicprogramsdevelopmentandreview/curriculumdevelopment/boardofundergraduatestudiesbus/buscurrentmembers2025-2026/ |
| BUS Members 2025-2026 |
207417 |
/academicaffairs/academicprogramsdevelopmentandreview/curriculumdevelopment/boardofundergraduatestudiesbus/buscurrentmembers2025-2026/busmembers2025-2026/ |
| BUS Members 2024-2025 |
203903 |
/academicaffairs/academicprogramsdevelopmentandreview/curriculumdevelopment/boardofundergraduatestudiesbus/buscurrentmembers2024-2025/busmembers2024-2025/ |
| BUS Members 2023-2024 |
198493 |
/academicaffairs/academicprograms/curriculumdevelopment/boardofundergraduatestudiesbus/buscurrentmembers2024-2025/busmembers2023-2024/ |
| BUS Members 2022-23 |
188357 |
/academicaffairs/academicprograms/curriculumdevelopment/boardofundergraduatestudiesbus/buscurrentmembers2024-2025/busmembers2022-23/ |
| BUS Members 2021-22 |
180138 |
/academicaffairs/academicprograms/curriculumdevelopment/boardofundergraduatestudiesbus/buscurrentmembers2024-2025/busmembers2021-22/ |
| BUS Meeting Dates: 2026-2027 |
117604 |
/academicaffairs/academicprogramsdevelopmentandreview/curriculumdevelopment/boardofundergraduatestudiesbus/busmeetingdates2026-2027/ |
| BUS Meeting Dates: 2018-19 |
123636 |
/academicaffairs/academicprograms/curriculumdevelopment/boardofundergraduatestudiesbus/busmeetingdates2025-2026/busmeetingdates2018-19/ |
| BUS Meeting Dates: 2019-20 |
151789 |
/academicaffairs/academicprograms/curriculumdevelopment/boardofundergraduatestudiesbus/busmeetingdates2025-2026/busmeetingdates2019-20/ |
| BUS Meeting Dates: 2021-22 |
179580 |
/academicaffairs/academicprograms/curriculumdevelopment/boardofundergraduatestudiesbus/busmeetingdates2025-2026/busmeetingdates2021-22/ |
| BUS Meeting Dates: 2022-23 |
187132 |
/academicaffairs/academicprograms/curriculumdevelopment/boardofundergraduatestudiesbus/busmeetingdates2025-2026/busmeetingdates2022-23/ |
| BUS Meeting Dates: 2023-2024 |
194035 |
/academicaffairs/academicprograms/curriculumdevelopment/boardofundergraduatestudiesbus/busmeetingdates2025-2026/busmeetingdates2023-2024/ |
| BUS Meeting Dates: 2024-2025 |
202999 |
/academicaffairs/academicprograms/curriculumdevelopment/boardofundergraduatestudiesbus/busmeetingdates2025-2026/busmeetingdates2024-2025/ |
| BUS Meeting Dates 2025-2026 |
207421 |
/academicaffairs/academicprogramsdevelopmentandreview/curriculumdevelopment/boardofundergraduatestudiesbus/busmeetingdates2026-2027/busmeetingdates2025-2026/ |
| Operational Subcommittee |
157775 |
/academicaffairs/academicprogramsdevelopmentandreview/curriculumdevelopment/operationalsubcommittee/ |
| Charge |
157776 |
/academicaffairs/academicprograms/curriculumdevelopment/busgscboperationalsubcommittee/charge/ |
| Current Members |
157777 |
/academicaffairs/academicprograms/curriculumdevelopment/busgscboperationalsubcommittee/currentmembers/ |
| Graduate Studies Coordinating Board (GSCB) |
99905 |
/academicaffairs/academicprograms/curriculumdevelopment/graduatestudiescoordinatingboardgscb/ |
| Charge and Membership |
100545 |
/academicaffairs/academicprograms/curriculumdevelopment/graduatestudiescoordinatingboardgscb/chargeandmembership/ |
| GSCB Current Members: 2025-2026 |
100546 |
/academicaffairs/academicprogramsdevelopmentandreview/curriculumdevelopment/graduatestudiescoordinatingboardgscb/gscbcurrentmembers2025-2026/ |
| GSCB Members 2025-2026 |
207418 |
/academicaffairs/academicprogramsdevelopmentandreview/curriculumdevelopment/graduatestudiescoordinatingboardgscb/gscbcurrentmembers2025-2026/gscbmembers2025-2026/ |
| GSCB Members 2024-2025 |
203904 |
/academicaffairs/academicprogramsdevelopmentandreview/curriculumdevelopment/graduatestudiescoordinatingboardgscb/gscbcurrentmembers2024-2025/gscbmembers2024-2025/ |
| GSCB Members: 2023-2024 |
198458 |
/academicaffairs/academicprograms/curriculumdevelopment/graduatestudiescoordinatingboardgscb/gscbcurrentmembers2024-2025/gscbmembers2023-2024/ |
| GSCB Members: 2022-23 |
188339 |
/academicaffairs/academicprograms/curriculumdevelopment/graduatestudiescoordinatingboardgscb/gscbcurrentmembers2024-2025/gscbmembers2022-23/ |
| GSCB Members: 2021-22 |
180247 |
/academicaffairs/academicprograms/curriculumdevelopment/graduatestudiescoordinatingboardgscb/gscbcurrentmembers2024-2025/gscbmembers2021-22/ |
| GSCB Members: 2019-20 |
154338 |
/academicaffairs/academicprograms/curriculumdevelopment/graduatestudiescoordinatingboardgscb/gscbcurrentmembers2024-2025/gscbmembers2019-20/ |
| GSCB Members 2018-19 |
122972 |
/academicaffairs/academicprograms/curriculumdevelopment/graduatestudiescoordinatingboardgscb/gscbcurrentmembers2024-2025/gscbmembers2018-19/ |
| GSCB Members 2017-18 |
122969 |
/academicaffairs/academicprograms/curriculumdevelopment/graduatestudiescoordinatingboardgscb/gscbcurrentmembers2024-2025/gscbmembers2017-18/ |
| GSCB Members 2016-17 |
122968 |
/academicaffairs/academicprograms/curriculumdevelopment/graduatestudiescoordinatingboardgscb/gscbcurrentmembers2024-2025/gscbmembers2016-17/ |
| GSCB Meeting Dates: 2026-2027 |
117607 |
/academicaffairs/academicprogramsdevelopmentandreview/curriculumdevelopment/graduatestudiescoordinatingboardgscb/gscbmeetingdates2026-2027/ |
| GSCB Meeting Dates: 2018-19 |
123633 |
/academicaffairs/academicprograms/curriculumdevelopment/graduatestudiescoordinatingboardgscb/gscbmeetingdates2025-2026/gscbmeetingdates2018-19/ |
| GSCB Meeting Dates: 2019-20 |
151793 |
/academicaffairs/academicprograms/curriculumdevelopment/graduatestudiescoordinatingboardgscb/gscbmeetingdates2025-2026/gscbmeetingdates2019-20/ |
| GSCB Meeting Dates: 2021-22 |
179581 |
/academicaffairs/academicprograms/curriculumdevelopment/graduatestudiescoordinatingboardgscb/gscbmeetingdates2025-2026/gscbmeetingdates2021-22/ |
| GSCB Meeting Dates: 2022-23 |
187131 |
/academicaffairs/academicprograms/curriculumdevelopment/graduatestudiescoordinatingboardgscb/gscbmeetingdates2025-2026/gscbmeetingdates2022-23/ |
| GSCB Meeting Dates: 2024-2025 |
203000 |
/academicaffairs/academicprograms/curriculumdevelopment/graduatestudiescoordinatingboardgscb/gscbmeetingdates2025-2026/gscbmeetingdates2024-2025/ |
| GSCB Meeting Dates: 2025-2026 |
207419 |
/academicaffairs/academicprogramsdevelopmentandreview/curriculumdevelopment/graduatestudiescoordinatingboardgscb/gscbmeetingdates2026-2027/gscbmeetingdates2025-2026/ |
| Guidelines for New Program Development |
203403 |
/academicaffairs/academicprograms/curriculumdevelopment/guidelinesfornewprogramdevelopment/ |
| New Program Summary |
99975 |
/academicaffairs/academicprograms/curriculumdevelopment/newprogramsummary/ |
| Program Development |
99907 |
/academicaffairs/academicprograms/curriculumdevelopment/programdevelopment/ |
| Classroom Disengagement Strategies |
180803 |
/academicaffairs/academicprograms/curriculumdevelopment/classroomdisengagementstrategies/ |
| Curriculum Inventory Management System |
199263 |
/academicaffairs/academicprograms/curriculuminventorymanagementsystem/ |
| Goals for Undergraduate Education at Loyola |
37386 |
/academicaffairs/academicprograms/goals.shtml |
| Policy |
195195 |
/academicaffairs/academicprograms/policy/ |
| Science Education for New Civic Engagements and Responsibilities (SENCER) |
37368 |
/academicaffairs/academicprograms/sencer.shtml |
| Coordinated Learning and Assessment Supports (CLAS) |
185570 |
https://www.luc.edu/clas/ |
| EdAssist |
187278 |
/academicaffairs/academicprograms/edassist/ |
| Academic Programs |
87320 |
/academicaffairs/academicprograms/edassist/academicprograms/ |
| Program information |
120580 |
/academicaffairs/academicprograms/edassist/programinformation/ |
| Tuition reduction application |
120581 |
/academicaffairs/academicprograms/edassist/tuitionreductionapplication/ |
| Academic Programs |
203495 |
/academicaffairs/academicprogramsdevelopmentandreview/academicprograms/ |
| Engaged Learning Requirement |
154458 |
/celts/programs/engagedlearning/ |
| University Core |
36231 |
/core/index.shtml |
| Program Review Processes |
203496 |
/academicaffairs/academicprogramsdevelopmentandreview/programreviewprocesses/ |
| The Assessment Cycle |
203498 |
/academicaffairs/academicprogramsdevelopmentandreview/programreviewprocesses/theassessmentcycle/ |
| Develop/Review PLOs |
203508 |
/academicaffairs/academicprogramsdevelopmentandreview/programreviewprocesses/theassessmentcycle/developreviewplos/ |
| Map PLOs |
203509 |
/academicaffairs/academicprogramsdevelopmentandreview/programreviewprocesses/theassessmentcycle/mapplos/ |
| Assessment Strategies |
203510 |
/academicaffairs/academicprogramsdevelopmentandreview/programreviewprocesses/theassessmentcycle/assessmentstrategies/ |
| Analyze data |
203918 |
/academicaffairs/academicprogramsdevelopmentandreview/programreviewprocesses/theassessmentcycle/analyzedata/ |
| Use data to reflect |
203511 |
/academicaffairs/academicprogramsdevelopmentandreview/programreviewprocesses/theassessmentcycle/usedatatoreflect/ |
| Academic Program Review |
191578 |
/clas/continuousimprovementatloyola/academicprogramreview/ |
| Pre-Plan |
193745 |
/clas/continuousimprovementatloyola/academicprogramreview/pre-plan/ |
| Letter of Understanding |
191579 |
/clas/continuousimprovementatloyola/academicprogramreview/letterofunderstanding/ |
| Self Study |
191580 |
/clas/continuousimprovementatloyola/academicprogramreview/selfstudy/ |
| External Review and Report |
193741 |
/clas/continuousimprovementatloyola/academicprogramreview/externalreviewandreport/ |
| Action Planning |
193743 |
/clas/continuousimprovementatloyola/academicprogramreview/actionplanning/ |
| Action Plan Monitoring |
193744 |
/clas/continuousimprovementatloyola/academicprogramreview/actionplanmonitoring/ |
| FAQs |
184550 |
/clas/aboutclas/faqs/ |
| Annual Assessment of Academic Programs |
203500 |
/academicaffairs/academicprogramsdevelopmentandreview/programreviewprocesses/annualassessmentofacademicprograms/ |
| Vincent J. Duminuco, S.J Award for Assessment Leadership |
203506 |
/academicaffairs/academicprogramsdevelopmentandreview/programreviewprocesses/annualassessmentofacademicprograms/vincentjduminucosjawardforassessmentleadership/ |
| Assessment Expectations |
184548 |
/clas/aboutclas/assessmentexpectations/ |
| Additional Resources on Assessment Cycle |
184554 |
/academicaffairs/academicprogramsdevelopmentandreview/programreviewprocesses/annualassessmentofacademicprograms/additionalresourcesonassessmentcycle/ |
| Faculty Fellows |
203507 |
/academicaffairs/academicprogramsdevelopmentandreview/programreviewprocesses/annualassessmentofacademicprograms/facultyfellows/ |
| Annual Assessment Reports |
203916 |
/academicaffairs/academicprogramsdevelopmentandreview/programreviewprocesses/annualassessmentofacademicprograms/annualassessmentreports/ |
| Program Array |
205629 |
/academicaffairs/academicprogramsdevelopmentandreview/programarray/ |
| site_logo |
205630 |
/sandbox/syarwick/centerforfacultydevelopment/sitelogo/ |
| Program Array Review |
205635 |
/sandbox/syarwick/centerforfacultydevelopment/programarrayreview/ |
| FAQs |
205636 |
/programarray-dev/programarrayreview/faqs/ |
| Program Review Milestones |
205638 |
/programarray-dev/programarrayreview/programreviewmilestones/ |
| Program Review Working Group |
205639 |
/sandbox/syarwick/centerforfacultydevelopment/programarrayreview/programreviewworkinggroup/ |
| Core Curriculum Review |
205640 |
/sandbox/syarwick/centerforfacultydevelopment/corecurriculumreview/ |
| Core Review FAQs |
205641 |
/sandbox/syarwick/centerforfacultydevelopment/corecurriculumreview/corereviewfaqs/ |
| Core Review Milestones |
205664 |
/programarray-dev/corecurriculumreview/corereviewmilestones/ |
| Core Review Working Group |
205665 |
/programarray-dev/corecurriculumreview/corereviewworkinggroup/ |
| Get Involved |
205700 |
/programarray-dev/getinvolved/ |
| Faculty Affairs |
158474 |
/academicaffairs/facultyaffairs/ |
| Contact Us |
158475 |
/academicaffairs/facultyaffairs/contactus/ |
| Faculty Hiring |
158476 |
/academicaffairs/facultyaffairs/facultyhiring/ |
| Faculty Onboarding |
158484 |
/academicaffairs/facultyaffairs/facultyhiring/facultyonboarding/ |
| Faculty Orientation |
158485 |
/academicaffairs/facultyaffairs/facultyhiring/facultyorientation/ |
| Lakeside Faculty Resources |
158488 |
/academicaffairs/facultyaffairs/facultyhiring/facultyorientation/lakesidefacultyresources/ |
| Faculty Diversity Hiring Toolkit |
158909 |
/academicaffairs/facultyaffairs/facultyhiring/facultydiversityhiringtoolkit/ |
| Part-Time/Adjunct Faculty Stipend and Benefits |
200904 |
/academicaffairs/facultyaffairs/facultyhiring/part-timeadjunctfacultystipendandbenefits/ |
| Diversity |
158477 |
/academicaffairs/facultyaffairs/diversity/ |
| Faculty Appointments |
158479 |
/academicaffairs/facultyaffairs/facultyappointments/ |
| Appointments, Contracts and Titles |
159154 |
https://www.luc.edu/media/lucedu/academicaffairs/pdfs/FacTtls%20Revised%20for%202013-14.pdf |
| Honorific Designations |
158896 |
/academicaffairs/facultyaffairs/facultyappointments/honorificdesignations/ |
| Endowed Chairs and Professorships 2025 |
177704 |
/academicaffairs/facultyaffairs/facultyappointments/endowed-chairs-professors/ |
| Faculty Convocation |
163100 |
/facultyconvocation/ |
| 2024 |
197967 |
/facultyconvocation/2024/ |
| 2023 |
188071 |
/facultyconvocation/2023/ |
| 2021 Faculty Convocation |
163132 |
/facultyconvocation/2021/ |
| archive |
163129 |
/facultyconvocation/archive/ |
| Faculty Convocation - 2020 |
154626 |
/facultyconvocation/archive/2020/ |
| Previous Convocations |
70275 |
/facultyconvocation/archive/previousconvocations/ |
| 2017 |
105115 |
http://luc.edu/academicaffairs/convocation/previousconvocations/ |
| 2016 |
97821 |
http://luc.edu/academicaffairs/convocation/previousconvocations/ |
| 2015 |
87051 |
/facultyconvocation/archive/previousconvocations/ |
| 2014 |
70277 |
/facultyconvocation/archive/previousconvocations/ |
| 2013 |
70279 |
/facultyconvocation/archive/previousconvocations/ |
| 2012 |
70287 |
/facultyconvocation/archive/previousconvocations/ |
| 2011 |
70288 |
/facultyconvocation/archive/previousconvocations/ |
| 2018 |
154647 |
/facultyconvocation/archive/previousconvocations/2018/ |
| Shared Governance |
36274 |
https://www.luc.edu/academicaffairs/facultyaffairs/policiesandprocedures/sharedgovernance/ |
| Faculty Development |
158478 |
/academicaffairs/facultyaffairs/facultydevelopment/ |
| Center for Faculty Excellence |
158888 |
/academicaffairs/facultyaffairs/facultydevelopment/centerforfacultyexcellence/ |
| Faculty Pathway Series |
185515 |
/academicaffairs/facultyaffairs/facultydevelopment/centerforfacultyexcellence/facultypathwayseries/ |
| New Faculty Orientation |
185533 |
/academicaffairs/facultyaffairs/facultydevelopment/centerforfacultyexcellence/newfacultyorientation/ |
| Faculty Development Leave Program |
158889 |
/academicaffairs/facultyaffairs/facultydevelopment/facultydevelopmentleaveprogram/ |
| Summer Research Stipend |
158890 |
/academicaffairs/facultyaffairs/facultydevelopment/summerresearchstipend/ |
| Faculty Development Review Committee |
158892 |
/academicaffairs/facultyaffairs/facultydevelopment/facultydevelopmentreviewcommittee/ |
| Health Science Campus Faculty Resources |
158893 |
/academicaffairs/facultyaffairs/facultydevelopment/healthsciencecampusfacultyresources/ |
| Faculty Handbook |
36168 |
/academicaffairs/facultyaffairs/facultyhandbook/ |
| Policies and Procedures |
158480 |
/academicaffairs/facultyaffairs/policiesandprocedures/ |
| Concerns, Complaints, and Grievances |
158898 |
/academicaffairs/facultyaffairs/policiesandprocedures/concernscomplaintsandgrievances/ |
| Shared Governance |
158899 |
/academicaffairs/facultyaffairs/policiesandprocedures/sharedgovernance/ |
| University Senate |
158901 |
/academicaffairs/facultyaffairs/policiesandprocedures/sharedgovernance/universitysenate/ |
| Collective Bargaining Agreement |
158902 |
/academicaffairs/facultyaffairs/policiesandprocedures/sharedgovernance/collectivebargainingagreement/ |
| Review, Promotion and Tenure |
158481 |
/academicaffairs/facultyaffairs/reviewpromotionandtenure/ |
| Faculty Instructional Responsibilities and Workload |
158903 |
/academicaffairs/facultyaffairs/reviewpromotionandtenure/facultyinstructionalresponsibilitiesandworkload/ |
| Interfolio |
158906 |
/academicaffairs/facultyaffairs/reviewpromotionandtenure/interfolio/ |
| University Rank and Tenure Committee |
158907 |
/academicaffairs/facultyaffairs/reviewpromotionandtenure/universityrankandtenurecommittee/ |
| Faculty Appeals Committee |
158908 |
/academicaffairs/facultyaffairs/reviewpromotionandtenure/facultyappealscommittee/ |
| Center for Faculty Development |
205531 |
/centerforfacultydevelopment/ |
| Research |
201596 |
/ovpr/ |
| OGCE |
201597 |
/ogce/ |
| OIRA |
201598 |
/oira/ |
| Stories |
97853 |
/academicaffairs/stories/ |
| archive |
97854 |
/academicaffairs/stories/archive/ |
| Provision for Extension of Probationary Period for Tenure |
36185 |
/academicaffairs/provisionforextensionofprobationaryperiodfortenure/ |
| Search Committee Materials |
36186 |
/academicaffairs/searchcommitteematerials/ |
| University Rank and Tenure Committee |
36187 |
/academicaffairs/universityrankandtenurecommittee/ |
| Visiting Scholar Information |
36188 |
/academicaffairs/visitingscholarinformation/ |
| Commencement Videos |
151995 |
/academicaffairs/commencementvideos/ |
| Provost Search |
108247 |
/academicaffairs/provostsearch/ |
| Search Committee Members |
108572 |
/academicaffairs/provostsearch/searchcommitteemembers/ |
| Update on Provost Search |
116911 |
/academicaffairs/provostsearch/updateonprovostsearch/ |
| Provost Candidate Interview Schedule |
117323 |
/academicaffairs/provostsearch/interview-schedule/ |
| Board of Trustees |
117639 |
/academicaffairs/provostsearch/bot/ |
| 7/30/19 Provost Search Update |
126352 |
/academicaffairs/provostsearch/73019provostsearchupdate/ |
| 6/10/19 Provost Search Update |
126353 |
/academicaffairs/provostsearch/61019provostsearchupdate/ |
| 10/30/19 Provost Search Update |
127060 |
/academicaffairs/provostsearch/103019provostsearchupdate/ |
| Search Selection Process for new Dean of the College of Arts and Sciences |
129558 |
/academicaffairs/casdeansearch/ |
| Dean of the College of Arts and Sciences |
142575 |
/academicaffairs/casdeansearch/callfornominationsandapplications.shtml |
| Invitation to CAS Dean Finalists' Interviews |
146886 |
/academicaffairs/casdeansearch/invitationtocasdeanfinalistsinterviews/ |
| Documents |
70240 |
/academicaffairs/documents/ |
| Academic Continuity |
123865 |
/academiccontinuity/ |
| site_logo |
124049 |
/academiccontinuity/sitelogo/ |
| Lecture Courses |
123905 |
/academiccontinuity/lecturecourses/ |
| Lab Courses |
128459 |
/academiccontinuity/labcourses/ |
| Engaged Learning Courses |
128460 |
/academiccontinuity/engagedlearningcourses/ |
| Support |
200123 |
/academiccontinuity/support/ |
| Accreditation |
184963 |
/accreditation/ |
| site_logo |
184964 |
/accreditation/sitelogo/ |
| Footer |
184965 |
/accreditation/footer/ |
| Documents |
205444 |
/accreditation/documents/ |
| 2024-2025 |
185122 |
/accreditation/2024-2025/ |
| Comprehensive Evaluation |
185121 |
/accreditation/2024-2025/comprehensiveevaluation/ |
| HLC Leadership Team |
188351 |
/accreditation/2024-2025/comprehensiveevaluation/hlcleadershipteam/ |
| Opportunities to Participate |
188352 |
/accreditation/2024-2025/opportunitiestoparticipate/ |
| Quality Initiative Project |
185127 |
/accreditation/2024-2025/qualityinitiativeproject/ |
| Reaffirmation Briefing Document |
201359 |
/accreditation/2024-2025/reaffirmationbriefingdocument/ |
| 2014-2015 |
188884 |
/accreditation/2014-2015/ |
| Comprehensive Evaluation |
188350 |
/accreditation/2014-2015/comprehensiveevaluation/ |
| Internal Consultants to the Assurance Argument |
185123 |
/accreditation/2014-2015/comprehensiveevaluation/internalconsultantstotheassuranceargument/ |
| How to Participate in Accreditation |
185124 |
/accreditation/2014-2015/comprehensiveevaluation/howtoparticipateinaccreditation/ |
| 2015 ASSURANCE ARGUMENT |
185125 |
https://www.luc.edu/media/lucedu/academicaffairs/pdfs/Assurance-Argument.pdf |
| Mid-Cycle Review |
185126 |
/accreditation/2014-2015/mid-cyclereview/ |
| Policies and Processes |
185128 |
/accreditation/policiesandprocesses/ |
| Reaffirmation Briefing Document |
201367 |
/accreditation/reaffirmationbriefingdocument/ |
| ACE |
11593 |
/ace/ |
| site_logo |
11630 |
/ace/site_logo/ |
| social media |
198798 |
/ace/socialmedia/ |
| About ACE TRiO SSS |
66747 |
/ace/aboutacetriosss/ |
| Meet the ACE Staff |
66384 |
/ace/aboutacetriosss/meettheacestaff/ |
| Meet the ACE Peer Mentors |
69868 |
/ace/aboutacetriosss/meettheacepeermentors/ |
| Meet the ACE Student Ambassadors |
154646 |
/ace/aboutacetriosss/meettheacestudentambassadors/ |
| Meet the ACE Support Staff |
163606 |
/ace/aboutacetriosss/meettheacesupportstaff/ |
| Meet the ACE Master's Mentors |
154645 |
/ace/aboutacetriosss/meettheacemastersmentors/ |
| Meet the ACE Tutoring Team |
84842 |
/ace/aboutacetriosss/meettheacetutoringteam/ |
| Location |
66386 |
/ace/aboutacetriosss/location/ |
| Mission and Goals |
66385 |
/ace/aboutacetriosss/missionandgoals/ |
| TRIO Information |
66387 |
/ace/aboutacetriosss/trioinformation/ |
| Eligibility |
11633 |
/ace/eligibility.shtml |
| Application |
67917 |
/ace/aboutacetriosss/application/ |
| Expectations of Current ACE Scholars |
57731 |
/ace/aboutacetriosss/expectationsofcurrentacescholars/ |
| ACE Services |
68820 |
/ace/aceservices/ |
| ACE Advising |
68821 |
/ace/aceservices/aceadvising/ |
| ACE Tutoring |
68822 |
/ace/aceservices/acetutoring/ |
| right_column |
69609 |
/ace/aceservices/acetutoring/rightcolumn/ |
| Transition to College Mentoring |
69744 |
/ace/aceservices/transitiontocollegementoring/ |
| Graduate School and Career Mentoring |
68823 |
/ace/aceservices/graduateschoolandcareermentoring/ |
| Faculty Mentoring Program |
68824 |
/ace/aceservices/facultymentoringprogram/ |
| Financial Aid and Literacy |
68825 |
/ace/aceservices/financialaidandliteracy/ |
| Annual Continue to Dream Retreat |
69079 |
/ace/aceservices/annualcontinuetodreamretreat/ |
| right_column |
69140 |
/ace/aceservices/rightcolumn/ |
| ACE Scholar Highlight |
102175 |
/ace/aceservices/rightcolumn/acescholarhighlight/ |
| Resources |
66793 |
/ace/resources/ |
| Student Success Resources |
66463 |
/ace/resources/studentsuccessresources/ |
| Financial Aid Resources |
66546 |
/ace/resources/financialaidresources/ |
| Graduate School Resources |
57869 |
/ace/resources/graduateschoolresources/ |
| Internship - Research - Career Planning Resources |
66462 |
/ace/resources/internship-research-careerplanningresources/ |
| Financial Literacy Resources |
68834 |
/ace/resources/financialliteracyresources/ |
| College Terms Explained |
85571 |
/ace/resources/collegetermsexplained/ |
| Colleges Take Steps to Prepare Students for Careers |
99116 |
/ace/resources/collegestakestepstopreparestudentsforcareers/ |
| Documents |
69219 |
/ace/documents/ |
| modules-programming |
198797 |
/ace/modules-programming/ |
| Footer |
11658 |
/ace/footer/ |
| Advancement |
364 |
/advancement/ |
| About Advancement |
365 |
/advancement/aboutadvancement/ |
| Learn about giving |
54984 |
http://www.LUC.edu/giving |
| Directory |
182530 |
/advancement/aboutadvancement/directory/ |
| Profiles |
182531 |
/advancement/aboutadvancement/directory/profiles/ |
| right_column |
182550 |
/advancement/aboutadvancement/directory/rightcolumn/ |
| Current Campaigns |
368 |
/advancement/currentcampaigns/ |
| Resources |
367 |
/advancement/currentcampaigns/resources/ |
| Make a gift |
55008 |
http://www.LUC.edu/give |
| Information about giving |
55018 |
http://www.LUC.edu/giving |
| Corporate and Foundation Relations |
123503 |
/advancement/currentcampaigns/resources/corporateandfoundationrelations/ |
| Plan your gift |
55014 |
http://www.luc.edu/plannedgiving |
| Submit a class note |
55016 |
http://alumni.luc.edu/s/1548/alumni/index.aspx?sid=1548&gid=2&pgid=408 |
| Scholarship Campaign |
55718 |
http://www.luc.edu/scholarshipcampaign/ |
| Contact us |
55019 |
/advancement/contactus/ |
| Advancement Weekly |
104393 |
/advancement/advancementweekly/ |
| Subscribe Form |
104394 |
/advancement/advancementweekly/subscribeform/ |
| right_column |
55559 |
/advancement/rightcolumn/ |
| Footer |
412 |
/advancement/footer/ |
| site_logo |
413 |
/advancement/sitelogo/ |
| Advancement Division Orientation Portal |
28764 |
/advorientation/index.shtml |
| 15th Floor Seating Map |
28767 |
/advorientation/seating_map.html |
| 16th Floor Seating Map |
28768 |
/advorientation/seating_map_16.html |
| 17th Floor Seating Map |
28769 |
/advorientation/seating_map_17.html |
| P.A.L. sign up form |
28778 |
/advorientation/PAL_Sign_Up_Form.shtml |
| Footer |
29134 |
/advorientation/footer/ |
| site_logo |
207032 |
/advorientation/sitelogo/ |
| Advancement Intranet Home |
207033 |
/advdev/index.shtml |
| Advancement Intranet |
29329 |
/advdev/index.shtml |
| LUC Links |
29340 |
/advdev/luc/index.shtml |
| advancement newsletter archive |
29341 |
/advdev/luc/luc_advancement_newsletter.shtml |
| Documentation |
29343 |
/advdev/luc/luc_documentation.shtml |
| LUC Forms |
29345 |
/advdev/luc/luc_forms.shtml |
| Forms for luc home page pics |
30008 |
/advdev/luc/formsforluchomepagepics/ |
| Database Links |
79352 |
/advdev/luc/databaselinks/ |
| Footer |
29379 |
/advdev/footer/ |
| site_logo |
29380 |
/advdev/sitelogo/ |
| Scholarships |
29326 |
/advdev/scholarship_campaign.shtml |
| Advancement |
29328 |
/advdev/adv_proc.shtml |
| advancement imodules links |
29330 |
/advdev/Convio_links.shtml |
| Advancement Division Procedures |
29332 |
/advdev/adv_div_procedures.shtml |
| Advancement Information Services |
29333 |
/advdev/entity_update_form.shtml |
| advance web upgrade |
29334 |
/advdev/Advance_Leap.shtml |
| College of Arts & Sciences Advancement Resource Portal |
29339 |
/advdev/cas_resource.shtml |
| thank you. you are not done yet . . . |
29359 |
/advdev/newallocationrequestformthankyou.shtml |
| Forms |
29438 |
/advdev/forms/ |
| new allocation request form - luhs |
29354 |
/advdev/New_Allocation_Request_Form_LUHS.shtml |
| Office of Advancement Information Services Loyola University Chicago |
29355 |
/advdev/Advance_Access_Request_Form.shtml |
| LUHS FUNDRAISING OPT OUT FORM |
29348 |
/advdev/LUHS_Fundraising_Opt_Out_Form.shtml |
| ADVANCEMENT DIVISION - APPEAL CODE REQUEST FORM |
29331 |
/advdev/appeal_code_request.shtml |
| appeal code request form - luhs |
29336 |
/advdev/appeal_code_request_luhs.shtml |
| CVENT Event Request |
29337 |
/advdev/CVENT_Event_Request_Form.shtml |
| custom_js |
116159 |
/advdev/customjs/ |
| ANNUAL GIVING DEPARTMENT |
29335 |
/advdev/payroll_deduct_form.shtml |
| luc-transaction entry request form |
29347 |
/advdev/luc/forms/transaction_entry_request.shtml |
| Advancement Services - Assignment Removal Request |
29541 |
/advdev/remove_assignment_form.shtml |
| Advancement Division - Volunteer Tracking Submission |
29543 |
/advdev/volunteer_tracking_submission_form.shtml |
| Thank You |
29497 |
/advdev/thankyou.shtml |
| Research Request Form - Advancement Services |
29561 |
/advdev/researchrequest.shtml |
| Research Request Form - Val Foltz |
29562 |
/advdev/researchrequest_vf.shtml |
| Research Request Form - Val Foltz 2 |
29563 |
/advdev/researchrequest_ac.shtml |
| Research Request Form - Rebekah Danner |
29565 |
/advdev/researchrequest_rd.shtml |
| Research Request Form - LUMC |
29566 |
/advdev/researchrequest_bl.shtml |
| smartsheet_acknowledgement_sent |
49303 |
/advdev/forms/smartsheetacknowledgementsent/ |
| AIS Project Request |
53158 |
/advdev/forms/aisprojectrequest/ |
| CVENT Form Thanks |
87870 |
/advdev/forms/cventformthanks/ |
| Event Notification Form |
95627 |
/advdev/forms/eventnotificationform/index.shtml |
| Thank You |
95628 |
/advdev/forms/eventnotificationform/thankyou/index.shtml |
| Staff Directory |
29357 |
/advdev/staff_directory.shtml |
| Project Request Help |
53157 |
/advdev/projectrequesthelp/ |
| Operation Leap Frog |
54396 |
/advdev/operationleapfrog/ |
| Advancement & Development Awards |
29409 |
/advdev/advancementdevelopmentawards/ |
| Ronnie Jelinek Award |
29413 |
/advdev/advancementdevelopmentawards/ronniejelinekaward/ |
| Domino Award |
29415 |
/advdev/advancementdevelopmentawards/dominoaward/ |
| Thank You |
95483 |
/advdev/thankyou/ |
| African Studies and the African Diaspora |
12327 |
/africanstudies/ |
| site_logo |
12337 |
/africanstudies/site_logo/ |
| Footer |
12340 |
/africanstudies/footer/ |
| cta |
202221 |
/africanstudies/cta/ |
| Contact Us |
12329 |
/africanstudies/contact.shtml |
| Courses |
202212 |
https://catalog.luc.edu/undergraduate/arts-sciences/african-studies-african-diaspora/african-studies-african-diaspora-ba/#curriculumtext |
| Museums and Galleries |
12331 |
/africanstudies/museums.shtml |
| Requirements |
12332 |
/africanstudies/requirements.shtml |
| Resources |
12333 |
/africanstudies/resources.shtml |
| Alpha Sigma Nu |
23473 |
/alphasigmanu/ |
| About Us |
23476 |
/alphasigmanu/about_us.shtml |
| Executive Board |
23478 |
/alphasigmanu/Bios.shtml |
| Past Executive Boards |
52416 |
/alphasigmanu/pastexecutiveboards/ |
| Mission, History, & Milestones |
23483 |
/alphasigmanu/mission_purpose.shtml |
| Members |
23482 |
/alphasigmanu/student_directory.shtml |
| Members 2011-2012 |
52422 |
/alphasigmanu/members2011-2012/ |
| FAQs |
23480 |
/alphasigmanu/faq.shtml |
| Nominee Information |
168806 |
/alphasigmanu/nomineeinformation/ |
| News and Events |
188648 |
/alphasigmanu/newsandevents/ |
| archive |
202214 |
/alphasigmanu/newsandevents/archive/ |
| ASN Inducts 167 New Members |
205200 |
/alphasigmanu/newsandevents/asninducts167newmembers/ |
| ASN Inducts 142 New Members |
202217 |
/alphasigmanu/newsandevents/asninducts142newmembers/ |
| ASN Leadership Summit |
202215 |
/alphasigmanu/newsandevents/asnleadershipsummit/ |
| ASN Inducts 159 New Members |
202216 |
/alphasigmanu/newsandevents/asninducts159newmembers/ |
| Contact Us |
23477 |
/alphasigmanu/officers.shtml |
| Regalia & Apparel |
202209 |
https://www.alphasigmanu.org/shop |
| National Directory |
202210 |
http://www.alphasigmanu.org/members/login.php?returnto=%2Fmembers%2Findex.php |
| ASN Central Office |
90672 |
https://www.alphasigmanu.org |
| ASN Application Procedures |
100811 |
/alphasigmanu/asnapplicationprocedures/ |
| 2022 Induction Ceremony |
181058 |
/alphasigmanu/2022inductionceremony/ |
| site_logo |
202203 |
/alphasigmanu/sitelogo/ |
| cta |
202204 |
/alphasigmanu/cta/ |
| Footer |
23513 |
/alphasigmanu/footer/ |
| Alumni Leadership Initiative |
167179 |
/ali/ |
| site_logo |
167180 |
/ali/sitelogo/ |
| Footer |
167181 |
/ali/footer/ |
| I Links |
167182 |
/ali/ilinks/ |
| Alumni Weekend |
201726 |
/alumniweekend/ |
| site_logo |
201727 |
/alumniweekend/sitelogo/ |
| Footer |
201728 |
/alumniweekend/footer/ |
| social media |
201730 |
/alumniweekend/socialmedia/ |
| Full Schedule |
201733 |
/alumniweekend/fullschedule/ |
| Awards and Recognition |
203920 |
/alumniweekend/fullschedule/awardsandrecognition/ |
| Family Programming |
203921 |
/alumniweekend/fullschedule/familyprogramming/ |
| Registration |
201734 |
/alumniweekend/registration/ |
| Affinity Networks |
201735 |
/alumniweekend/affinitynetworks/ |
| Class Reunions |
201736 |
/alumniweekend/classreunions/ |
| Golden Ramblers 50th Reunion |
202471 |
/alumniweekend/classreunions/goldenramblers50threunion/ |
| Social Media Toolkit |
203998 |
/alumniweekend/classreunions/socialmediatoolkit/ |
| Travel & Accommodations |
201737 |
/alumniweekend/travelaccommodations/ |
| FAQs |
201738 |
/alumniweekend/faqs/ |
| Donor and Alumni Engagement |
204380 |
/alumniweekend/donorandalumniengagement/ |
| Alumni Weekend Photos |
204655 |
/alumniweekend/alumniweekendphotos/ |
| Andrew M. Greeley Center for Catholic Education (GCCE) |
184763 |
/gcce/ |
| site_logo |
184764 |
/gcce/sitelogo/ |
| I Links |
184769 |
/gcce/ilinks/ |
| social media |
184766 |
/gcce/socialmedia/ |
| modules-programming |
184767 |
/gcce/modules-programming/ |
| About Us |
184772 |
/gcce/aboutus/ |
| Center Staff |
184773 |
/gcce/aboutus/centerstaff/ |
| Profiles |
184841 |
/gcce/aboutus/centerstaff/profiles/ |
| History |
184774 |
/gcce/aboutus/history/ |
| Andrew M. Greeley |
184775 |
/gcce/aboutus/andrewmgreeley/ |
| Contact Us |
184776 |
/gcce/aboutus/contactus/ |
| News |
184836 |
/gcce/aboutus/news/ |
| archive |
184840 |
/gcce/aboutus/news/archive/ |
| What We Do |
184787 |
/gcce/whatwedo/ |
| Mustard Seed Project |
184795 |
/gcce/whatwedo/mustardseedproject/ |
| The Mustard Seed Project |
184798 |
/gcce/whatwedo/mustardseedproject/themustardseedproject/ |
| All Are Welcome |
184799 |
/gcce/whatwedo/mustardseedproject/allarewelcome/ |
| Certificate in Leading Inclusive Catholic Schools |
184800 |
/gcce/whatwedo/mustardseedproject/certificateinleadinginclusivecatholicschools/ |
| Exceptional Learners White Paper |
184801 |
/gcce/whatwedo/mustardseedproject/exceptionallearnerswhitepaper/ |
| Services |
184796 |
/gcce/whatwedo/services/ |
| Partnerships |
184797 |
/gcce/whatwedo/partnerships/ |
| Beyond Inclusion Conference 2026 |
205002 |
/gcce/whatwedo/beyondinclusionconference2026/ |
| Widening the Circle 2026 |
205383 |
/gcce/whatwedo/wideningthecircle2026/ |
| Designing the Learning Environment |
205384 |
/gcce/whatwedo/designingthelearningenvironment/ |
| Academics |
184778 |
/gcce/academics/ |
| LU ChOICE |
184779 |
/gcce/academics/luchoice/ |
| Frequently Asked Questions |
184782 |
/gcce/academics/luchoice/frequentlyaskedquestions/ |
| Documents |
184784 |
/gcce/academics/luchoice/documents/ |
| Magis |
184780 |
/gcce/academics/magis/ |
| Toolkit |
184777 |
/gcce/toolkit/ |
| Connected Classrooms Podcasts |
196418 |
/gcce/toolkit/connectedclassroomspodcasts/ |
| Creating a Classroom Culture through Literacy Webinar |
200715 |
/gcce/toolkit/creatingaclassroomculturethroughliteracywebinar/ |
| Spiritual Resources |
204412 |
/gcce/toolkit/spiritualresources/ |
| Catholic Education Job Postings |
184788 |
/gcce/catholiceducationjobpostings/ |
| Anthropology, Department of |
16590 |
/anthropology/ |
| site_logo |
16651 |
/anthropology/sitelogo/ |
| Footer |
16650 |
/anthropology/footer/ |
| cta |
200366 |
/anthropology/cta/ |
| modules-programming |
200121 |
/anthropology/modules-programming/ |
| About Us |
16591 |
/anthropology/about.shtml |
| Contact Us |
16592 |
/anthropology/contactus.shtml |
| Values Statement |
200122 |
/anthropology/valuesstatement/ |
| Academics |
16597 |
/anthropology/academics.shtml |
| BA in Anthropology |
16598 |
/anthropology/ba.shtml |
| BS in Anthropology |
16600 |
/anthropology/bs.shtml |
| BA in Sociology and Anthropology |
16599 |
/anthropology/anthropology-sociology.shtml |
| Minor in Anthropology |
16603 |
/anthropology/minor.shtml |
| Honors in Anthropology |
16602 |
/anthropology/honors.shtml |
| Capstone Experience |
62602 |
/anthropology/capstoneexperience/ |
| Archaeology Field School |
63924 |
/anthropology/archaeologyfieldschool/ |
| Rome Summer Course |
78455 |
/anthropology/romesummercourse/ |
| Faculty and Staff |
200394 |
/anthropology/facultyandstaff/ |
| Faculty and Staff |
200384 |
/anthropology/facultyandstaff/facultyandstaff/ |
| Profiles |
200385 |
/anthropology/facultyandstaff/facultyandstaff/profiles/ |
| right_column |
201900 |
/anthropology/facultyandstaff/facultyandstaff/profiles/rightcolumn/ |
| Emeriti Faculty |
200395 |
/anthropology/facultyandstaff/emeritifaculty/ |
| Profiles |
200396 |
/anthropology/facultyandstaff/emeritifaculty/profiles/ |
| right_column |
201901 |
/anthropology/facultyandstaff/emeritifaculty/profiles/rightcolumn/ |
| Dr. Paul S. Breidenbach |
70298 |
/anthropology/facultyandstaff/breidenbach.shtml |
| Rev. Francis X. Grollig, SJ |
16595 |
/anthropology/facultyandstaff/grollig.shtml |
| Students and Alumni |
86064 |
/anthropology/studentsandalumni/ |
| right_column |
86582 |
/anthropology/studentsandalumni/rightcolumn/ |
| Student and Alumni News |
86065 |
/anthropology/studentsandalumni/studentandalumninews/ |
| The Chardin Society |
16640 |
/anthropology/chardin.shtml |
| Alumni Stories |
101584 |
/anthropology/studentsandalumni/alumnistories/ |
| archive |
105873 |
/anthropology/studentsandalumni/alumnistories/archive/ |
| Resources |
16639 |
/anthropology/resouces.shtml |
| May Weber Ethnographic Study Collection |
80268 |
/anthropology/mwesc/ |
| May Weber Ethnographic Collection |
99436 |
/anthropology/mwesc/mayweberethnographiccollection/ |
| Labs and Facilities |
61060 |
/anthropology/labsandfacilities/ |
| Archaeology Lab |
61061 |
/anthropology/labsandfacilities/archaeologylab/ |
| Biological Anthropology Labs |
62166 |
/anthropology/labsandfacilities/biologicalanthropologylabs/ |
| Research Opportunities |
61059 |
/anthropology/researchopportunities/ |
| Student Travel and Research Awards |
116907 |
/anthropology/studenttravelandresearchawards/ |
| Fellowship and Scholarship Opportunities |
119834 |
/anthropology/fellowshipandscholarshipopportunities/ |
| A Letter on Fellowships from Dr. Calcagno |
119835 |
/anthropology/fellowshipandscholarshipopportunities/aletteronfellowshipsfromdrcalcagno/ |
| Anthropology Annual Speaker Series |
127389 |
/anthropology/anthropologyannualspeakerseries/ |
| Careers |
62605 |
/anthropology/careers/ |
| Anthropology Links |
16635 |
/anthropology/anthropology_links.shtml |
| BARFAA |
16636 |
/anthropology/barfaa.html |
| Stories and News |
60579 |
/anthropology/storiesandnews/ |
| archive |
65099 |
/anthropology/storiesandnews/archive/ |
| Bodies of Evidence |
64464 |
/anthropology/storiesandnews/bodiesofevidence/ |
| Congratulations to Our 2024 Anthropology Graduates! |
194238 |
/anthropology/storiesandnews/congratulationstoour2024anthropologygraduates/ |
| Congratulations 2025 Anthropology Graduates! |
202750 |
/anthropology/storiesandnews/congratulations2025anthropologygraduates/ |
| Archives and Special Collections |
28102 |
/archives/ |
| site_logo |
28175 |
/archives/sitelogo/ |
| I Links |
200733 |
/archives/ilinks/ |
| social media |
200526 |
/archives/socialmedia/ |
| About Us |
28019 |
/archives/about.shtml |
| Donating Materials |
28020 |
/archives/Donating_Materials.shtml |
| Hours |
28021 |
/archives/faqs.shtml |
| Policies |
28023 |
/archives/policies.shtml |
| Loyola Archives and Special Collections News |
28090 |
/archives/loyola-archives-news.shtml |
| Reports and Newsletters |
107010 |
/archives/reportsandnewsletters/ |
| Staff |
28025 |
/archives/staff.shtml |
| right_column |
86953 |
/archives/rightcolumn/ |
| Collections |
28026 |
/archives/collections.shtml |
| A to Z List: Special Collections |
100522 |
/archives/atozlistspecialcollections/ |
| A to Z List: University Archives |
53681 |
/archives/atozlistuniversityarchives/ |
| Academic Affairs records |
28027 |
/archives/academics.shtml |
| Athletics |
28031 |
/archives/athletics.shtml |
| Athletics Department Oral History Interviews |
28032 |
/archives/athletics_interviews.shtml |
| Collections by Subject |
54278 |
/archives/collectionsbysubject/ |
| College of Arts and Sciences records |
28036 |
/archives/cas.shtml |
| Congressional Archives |
28037 |
/archives/cpsa.shtml |
| Correspondence Study Division |
28038 |
/archives/cstudy.shtml |
| Institute of Pastoral Studies Oral Histories |
28043 |
/archives/ipsinterviews.shtml |
| John Felice Rome Center |
28045 |
/archives/rome_center.shtml |
| John Felice Rome Center Oral History Interviews |
28046 |
/archives/jfrc.shtml |
| Loyola Long-time Faculty and Staff Oral Histories |
28047 |
/archives/ltfs.shtml |
| Loyola Long-time Faculty and Staff Oral History Project |
28071 |
/archives/oralhist.shtml |
| Loyola News and Loyola Phoenix Oral History Interviews |
28049 |
/archives/lunews.shtml |
| Marcella Niehoff School of Nursing |
28052 |
/archives/nursing.shtml |
| Notable Acquisitions |
28088 |
/archives/recent_acquisitions.shtml |
| Now Open |
28089 |
/archives/opencollections.shtml |
| Office of the General Counsel |
28053 |
/archives/gencoun.shtml |
| Office of the Treasurer |
28074 |
/archives/finance.shtml |
| Oral History Collections |
28054 |
/archives/ohistories.shtml |
| Parmly Hearing Institute |
28055 |
/archives/parmlyinterviews.shtml |
| Photograph Collections |
28056 |
/archives/photocollections.shtml |
| President's Office |
28029 |
/archives/administration.shtml |
| Rare Book Collection |
28059 |
/archives/rare_book_collection.shtml |
| right_column |
86964 |
/archives/rightcolumn/ |
| School of Business Administration |
28061 |
/archives/sba.shtml |
| School of Dentistry Oral History Interviews |
28062 |
/archives/sodinterviews.shtml |
| School of Education Oral History Interviews |
28063 |
/archives/soeinterviews.shtml |
| School of Law |
28064 |
/archives/law.shtml |
| School of Law Oral History Interviews |
28065 |
/archives/lawinterviews.shtml |
| School of Social Work |
28066 |
/archives/socialwork.shtml |
| School of Social Work Oral History Interviews |
28067 |
/archives/ssow.shtml |
| Stritch School of Medicine |
28068 |
/archives/ssom.shtml |
| Student Activism/Student Government Interviews |
28069 |
/archives/sasginterviews.shtml |
| University Publications |
28058 |
/archives/publications.shtml |
| Vice President for Academic Affairs |
28073 |
/archives/vpaca.shtml |
| Digital Collections |
59368 |
/archives/digitalcollections/ |
| Digital Exhibits |
54137 |
/archives/digitalcollections/digitalexhibits/ |
| Loyola Digital Collections |
59951 |
/archives/digitalcollections/loyoladigitalcollections/ |
| Digital Special Collections |
28079 |
/archives/galleries.shtml |
| Virtual Backgrounds |
147625 |
/archives/digitalcollections/virtualbackgrounds/ |
| right_column |
87012 |
/archives/digitalcollections/rightcolumn/ |
| Loyola History |
28076 |
/archives/luhistory.shtml |
| 150th |
117803 |
/archives/150projects.shtml |
| Projects |
117807 |
/archives/150th/projects/ |
| News |
117808 |
/archives/150th/news/ |
| Campuses |
28077 |
/archives/campuses.shtml |
| Lake Shore Campus |
160369 |
/archives/lakeshorecampus/ |
| LSC Academic Buildings |
160445 |
/archives/lakeshorecampus/lscacademicbuildings/ |
| LSC Administrative Buildings |
160446 |
/archives/lakeshorecampus/lscadministrativebuildings/ |
| LSC Student Recreational and Athletics Buildings |
160447 |
/archives/lakeshorecampus/lscstudentrecreationalandathleticsbuildings/ |
| LSC Residence Halls |
160448 |
/archives/lakeshorecampus/lscresidencehalls/ |
| LSC Former Buildings |
160449 |
/archives/lakeshorecampus/lscformerbuildings/ |
| Water Tower Campus |
160370 |
/archives/watertowercampus/ |
| WTC Academic and Administrative Buildings |
160450 |
/archives/watertowercampus/wtcacademicandadministrativebuildings/ |
| WTC Former Buildings |
160452 |
/archives/watertowercampus/wtcformerbuildings/ |
| Health Sciences Campus |
160371 |
/archives/healthsciencescampus/ |
| HSC Buildings |
160456 |
/archives/healthsciencescampus/hscbuildings/ |
| Rome Center Campus |
160372 |
/archives/romecentercampus/ |
| Loyola Retreat and Ecology Campus |
160414 |
/archives/loyolaretreatandecologycampus/ |
| Colleges and Schools |
28078 |
/archives/collegeschools.shtml |
| College of Arts and Sciences |
160373 |
/archives/collegeofartsandsciences/ |
| School of Law |
160374 |
/archives/schooloflaw/ |
| Stritch School of Medicine |
160375 |
/archives/stritchschoolofmedicine/ |
| School of Dentistry |
160376 |
/archives/schoolofdentistry/ |
| School of Social Work |
160377 |
/archives/schoolofsocialwork/ |
| The Graduate School |
160378 |
/archives/thegraduateschool/ |
| Niehoff School of Nursing |
160379 |
/archives/niehoffschoolofnursing/ |
| Quinlan School of Business Administration |
160380 |
/archives/quinlanschoolofbusinessadministration/ |
| School of Continuing and Professional Studies |
160382 |
/archives/schoolofcontinuingandprofessionalstudies/ |
| Elizabeth M. Cudahy Memorial Library |
73262 |
/archives/elizabethmcudahymemoriallibrary/ |
| Elizabeth M. Cudahy Memorial Library History |
73215 |
/archives/elizabethmcudahymemoriallibraryhistory/ |
| John Warner Norton Mural |
73266 |
/archives/johnwarnernortonmural/ |
| Loyola Presidents |
28086 |
/archives/presidents1.shtml |
| Loyola Timeline |
28082 |
/archives/chrono1.shtml |
| Loyola Traditions |
28083 |
/archives/traditions.shtml |
| Projects |
55882 |
/archives/projects/ |
| right_column |
86968 |
/archives/rightcolumn/ |
| Services and Instruction |
28096 |
/archives/services-resources.shtml |
| Archives Store |
109254 |
/archives/archivesstore/ |
| Class Visits and Instruction |
28022 |
/archives/class-instruction.shtml |
| Records Management |
28024 |
/archives/records_management.shtml |
| Using Archives: A Guide to Effective Research |
28098 |
/archives/using_archives.html |
| Archival Resources |
157548 |
/archives/archivalresources/ |
| right_column |
87013 |
/archives/rightcolumn/ |
| Ask the Archivist |
101242 |
/archives/askthearchivist/ |
| Thank You |
101243 |
/archives/askthearchivist/thankyou/ |
| modules-programming |
200422 |
/archives/modules-programming/ |
| Footer |
28174 |
/archives/footer/ |
| Special Projects |
201739 |
/archives/specialprojects/ |
| The Ellacuria Tapes: A Martyr at Loyola |
201740 |
/archives/specialprojects/theellacuriatapesamartyratloyola/ |
| Hoellen Family Foundation |
201741 |
/archives/specialprojects/hoellenfamilyfoundation/ |
| Jesuit Community Audio-Visual Digitization Grant |
201742 |
/archives/specialprojects/jesuitcommunityaudio-visualdigitizationgrant/ |
| Jesuit Libraries Provenance Project |
201743 |
/archives/specialprojects/jesuitlibrariesprovenanceproject/ |
| Loyola's Sesquicentennial |
201744 |
/archives/specialprojects/loyolassesquicentennial/ |
| Visiting Scholar Projects |
201745 |
/archives/specialprojects/visitingscholarprojects/ |
| Arrupe |
185982 |
/arrupe/ |
| site_logo |
185983 |
/arrupe/sitelogo/ |
| Footer |
185984 |
/arrupe/footer/ |
| cta |
185985 |
/arrupe/cta/ |
| social media |
185987 |
/arrupe/socialmedia/ |
| modules-programming |
185988 |
/arrupe/modules-programming/ |
| About |
186781 |
/arrupe/about/ |
| Why Arrupe? |
186782 |
/arrupe/about/whyarrupe/ |
| Mission and Message |
186783 |
/arrupe/about/missionandmessage/ |
| Sustainability |
186784 |
/arrupe/about/sustainability/ |
| Faculty and Staff |
186785 |
/arrupe/about/facultyandstaff/ |
| Profiles |
188073 |
/arrupe/about/facultyandstaff/profiles/ |
| right_column |
201851 |
/arrupe/about/facultyandstaff/profiles/rightcolumn/ |
| Board of Advisors |
186786 |
/arrupe/about/boardofadvisors/ |
| Support Arrupe College |
186787 |
/arrupe/about/supportarrupecollege/ |
| News and Stories |
186788 |
/arrupe/about/newsandstories/ |
| archive |
186789 |
/arrupe/about/newsandstories/archive/ |
| Our Campus |
186790 |
/arrupe/about/ourcampus/ |
| Contact Us |
186791 |
/arrupe/about/contactus/ |
| Admission |
186792 |
/arrupe/admission/ |
| Apply |
186793 |
/arrupe/admission/apply/ |
| right_column |
188278 |
/arrupe/admission/apply/rightcolumn/ |
| Meet and Greet |
204197 |
/arrupe/admission/apply/meetandgreet/ |
| Admission Team and Ambassadors |
186794 |
/arrupe/admission/admissionteamandambassadors/ |
| Karina Perez |
186795 |
/arrupe/admission/admissionteamandambassadors/karinaperez/ |
| Alondra Villanueva Gonzalez |
186797 |
/arrupe/admission/admissionteamandambassadors/alondravillanuevagonzalez/ |
| Maria Zapata |
186798 |
/arrupe/admission/admissionteamandambassadors/mariazapata/ |
| Bienvenida para Padres |
188279 |
/arrupe/admission/admissionteamandambassadors/bienvenidaparapadres/ |
| Aaron Powell |
205598 |
/arrupe/admission/admissionteamandambassadors/aaronpowell/ |
| Lala Gonzalez |
206243 |
/arrupe/admission/admissionteamandambassadors/lalagonzalez/ |
| Jose Rosales |
206315 |
/arrupe/admission/admissionteamandambassadors/joserosales/ |
| Samy Estrella |
206316 |
/arrupe/admission/admissionteamandambassadors/samyestrella/ |
| Amirah Meekins |
206317 |
/arrupe/admission/admissionteamandambassadors/amirahmeekins/ |
| Visit |
186800 |
/arrupe/admission/visit/ |
| Directions and Parking |
186802 |
/arrupe/admission/visit/directionsandparking/ |
| Open House |
186803 |
/arrupe/admission/visit/openhouse/ |
| right_column |
188280 |
/arrupe/admission/visit/rightcolumn/ |
| Virtual Tour |
202959 |
/arrupe/admission/visit/virtualtour/ |
| Tuition, Financial Aid, and Scholarships |
186804 |
/arrupe/admission/tuitionfinancialaidandscholarships/ |
| Admission Requirements |
186993 |
/arrupe/admission/admissionrequirements/ |
| Deadlines |
186994 |
/arrupe/admission/deadlines/ |
| Request Information |
186995 |
/arrupe/admission/requestinformation/ |
| Academics |
186996 |
/arrupe/academics/ |
| Degrees |
186997 |
/arrupe/academics/degrees/ |
| Business Administration (AA) |
187005 |
/arrupe/academics/degrees/businessadministrationaa/ |
| Liberal Arts, Communication (AA) |
186998 |
/arrupe/academics/degrees/liberalartscommunicationaa/ |
| Liberal Arts, English (AA) |
186999 |
/arrupe/academics/degrees/liberalartsenglishaa/ |
| Liberal Arts, History (AA) |
187000 |
/arrupe/academics/degrees/liberalartshistoryaa/ |
| Liberal Arts, Pre-STEM (AA) |
187001 |
/arrupe/academics/degrees/liberalartspre-stemaa/ |
| Social and Behavioral Sciences (AA) + Nursing (BSN) |
187007 |
/arrupe/academics/degrees/socialandbehavioralsciencesaanursingbsn/ |
| Social and Behavioral Sciences, Criminal Justice (AA) |
187002 |
/arrupe/academics/degrees/socialandbehavioralsciencescriminaljusticeaa/ |
| Social and Behavioral Sciences, Political Science (AA) |
187003 |
/arrupe/academics/degrees/socialandbehavioralsciencespoliticalscienceaa/ |
| Social and Behavioral Sciences, Psychology (AA) |
187004 |
/arrupe/academics/degrees/socialandbehavioralsciencespsychologyaa/ |
| Academic Calendar and Policies |
187008 |
/arrupe/academics/academiccalendarandpolicies/ |
| Summer Calendar |
190956 |
/arrupe/academics/academiccalendarandpolicies/summercalendar/ |
| Course Catalog |
187010 |
https://catalog.luc.edu/undergraduate/arrupe/ |
| Academic Supports |
187012 |
/arrupe/academics/academicsupports/ |
| Forms and FAQs |
187014 |
/arrupe/academics/formsandfaqs/ |
| Graduation |
187015 |
/arrupe/academics/graduation/ |
| Resources |
187017 |
/arrupe/resources/ |
| Overview |
187016 |
/arrupe/resources/overview/ |
| Career Services |
187018 |
/arrupe/resources/careerservices/ |
| Campus Resources |
187019 |
/arrupe/resources/campusresources/ |
| Social, Spiritual, and Cultural Programming |
187020 |
/arrupe/resources/campusresources/socialspiritualandculturalprogramming/ |
| Libraries |
187021 |
/arrupe/resources/campusresources/libraries/ |
| Student Organizations |
187022 |
/arrupe/resources/campusresources/studentorganizations/ |
| Parent and Dependent Care Resources |
187023 |
/arrupe/resources/campusresources/parentanddependentcareresources/ |
| Leadership Development |
187024 |
/arrupe/resources/leadershipdevelopment/ |
| Social Work Services |
187025 |
/arrupe/resources/socialworkservices/ |
| FAQs |
187026 |
/arrupe/resources/faqs/ |
| Transfer Advising |
187027 |
/arrupe/resources/transferadvising/ |
| Advising Directory |
187028 |
/arrupe/resources/transferadvising/advisingdirectory/ |
| For Parents and Families |
201584 |
/arrupe/resources/forparentsandfamilies/ |
| Outcomes |
187216 |
/arrupe/outcomes/ |
| Student Pathways |
187217 |
/arrupe/outcomes/studentpathways/ |
| Joshua Adams (AA ’17) |
187218 |
/arrupe/outcomes/studentpathways/joshuaadamsaa17/ |
| Karen Romero (AA ’21) |
187219 |
/arrupe/outcomes/studentpathways/karenromeroaa21/ |
| Josh Morgan (AA ’18, BA ’20, MA ’23) |
187220 |
/arrupe/outcomes/studentpathways/joshmorganaa18ba20ma23/ |
| Stephanie Ramos (AA '18) |
187221 |
/arrupe/outcomes/studentpathways/stephanieramosaa18/ |
| Cameron Anderson (AA '22, BS ’24) |
187222 |
/arrupe/outcomes/studentpathways/cameronandersonaa22bs24/ |
| Ximena Rodriguez (AA '22) |
187223 |
/arrupe/outcomes/studentpathways/ximenarodriguezaa22/ |
| Joaquin Guzman (AA '21, BA '23, MA '24) |
194806 |
/arrupe/outcomes/studentpathways/joaquinguzmanaa21ba23ma24/ |
| John Cooke (AA ’23) |
206128 |
/arrupe/outcomes/studentpathways/johncookeaa23/ |
| Jeo Alva Lemus (AA ’25) |
206130 |
/arrupe/outcomes/studentpathways/jeoalvalemusaa25/ |
| Judy Dominguez (AA ’18) |
206132 |
/arrupe/outcomes/studentpathways/judydominguezaa18/ |
| Our Graduates |
191625 |
/arrupe/outcomes/ourgraduates/ |
| Charles Jeanty (AA ’22) |
187226 |
/arrupe/outcomes/ourgraduates/charlesjeantyaa22/ |
| Aliya Segura (AA ’22) |
187227 |
/arrupe/outcomes/ourgraduates/aliyaseguraaa22/ |
| Damien Sewell (AA ’22) |
187228 |
/arrupe/outcomes/ourgraduates/damiensewellaa22/ |
| Grecia Avila (AA ’22) |
187229 |
/arrupe/outcomes/ourgraduates/greciaavilaaa22/ |
| Jaymillia Booker (AA ’22) |
187230 |
/arrupe/outcomes/ourgraduates/jaymilliabookeraa22/ |
| Jesus Martinez (AA ’22) |
187231 |
/arrupe/outcomes/ourgraduates/jesusmartinezaa22/ |
| Karen Martinez (AA ’22) |
187232 |
/arrupe/outcomes/ourgraduates/karenmartinezaa22/ |
| Kira Ibarra (AA ’22) |
187233 |
/arrupe/outcomes/ourgraduates/kiraibarraaa22/ |
| Dan Sierra (AA ’22) |
187234 |
/arrupe/outcomes/ourgraduates/dansierraaa22/ |
| Asia Singleton (AA ’18, BA ’20, MA’22) |
187235 |
/arrupe/outcomes/ourgraduates/asiasingletonaa18ba20ma22/ |
| Naja Rone (AA ’23) |
190710 |
/arrupe/outcomes/ourgraduates/najaroneaa23/ |
| GM Labar (AA ’23) |
190711 |
/arrupe/outcomes/ourgraduates/gmlabaraa23/ |
| Syeda Aaidah (AA ’23) |
190712 |
/arrupe/outcomes/ourgraduates/syedaaaidahaa23/ |
| Jessica Flores Perez (AA ’23) |
190713 |
/arrupe/outcomes/ourgraduates/jessicafloresperezaa23/ |
| Khalil Webb (AA ’23) |
190714 |
/arrupe/outcomes/ourgraduates/khalilwebbaa23/ |
| Nazia Azizi (AA ’23) |
190716 |
/arrupe/outcomes/ourgraduates/naziaaziziaa23/ |
| Julio Cruz (AA ’23) |
190717 |
/arrupe/outcomes/ourgraduates/juliocruzaa23/ |
| Ruby Hernandez (AA ’23) |
190718 |
/arrupe/outcomes/ourgraduates/rubyhernandezaa23/ |
| Jonathan Larbi (AA ’24) |
195181 |
/arrupe/outcomes/ourgraduates/jonathanlarbiaa24/ |
| Anuoluwa Ogunwusi (she/her) |
195182 |
/arrupe/outcomes/ourgraduates/anuoluwaogunwusisheher/ |
| Elizabeth Onofre (AA ’24) |
195183 |
/arrupe/outcomes/ourgraduates/elizabethonofreaa24/ |
| Melissa Parra-Ramirez (AA ’24) |
195185 |
/arrupe/outcomes/ourgraduates/melissaparra-ramirezaa24/ |
| Estefani Perez (AA ’24) |
195187 |
/arrupe/outcomes/ourgraduates/estefaniperezaa24/ |
| Krishon Pinkins (AA ’24) |
195188 |
/arrupe/outcomes/ourgraduates/krishonpinkinsaa24/ |
| Niko Zvodinsky (AA ’24) |
195189 |
/arrupe/outcomes/ourgraduates/nikozvodinskyaa24/ |
| Faiza Feroz (AA ’24) |
195191 |
/arrupe/outcomes/ourgraduates/faizaferozaa24/ |
| Kevin Sanchez Carrizales, He/They (AA ’24) |
195192 |
/arrupe/outcomes/ourgraduates/kevinsanchezcarrizaleshetheyaa24/ |
| Fébie Atoungbe (AA ’24) |
195193 |
/arrupe/outcomes/ourgraduates/febieatoungbeaa24/ |
| Damilare R. Abdulsalam (AA ’24) |
195194 |
/arrupe/outcomes/ourgraduates/damilarerabdulsalamaa24/ |
| Angel Guillen (AA ’25) |
201600 |
/arrupe/outcomes/ourgraduates/angelguillenaa25/ |
| Esdaini Lopez (AA '25) |
201601 |
/arrupe/outcomes/ourgraduates/esdainilopezaa25/ |
| Maria Dominguez Gonzalez (AA ’24) |
201602 |
/arrupe/outcomes/ourgraduates/mariadominguezgonzalezaa24/ |
| Jacquelyn Luz-Martinez (AA ’25) |
203503 |
/arrupe/outcomes/ourgraduates/jacquelynluz-martinezaa25/ |
| Rossy Plascencia (AA '25) |
203504 |
/arrupe/outcomes/ourgraduates/rossyplascenciaaa25/ |
| Jeleel Soaga (AA ’25) |
203512 |
/arrupe/outcomes/ourgraduates/jeleelsoagaaa25/ |
| Vanessa Avalos (AA ’25) |
203513 |
/arrupe/outcomes/ourgraduates/vanessaavalosaa25/ |
| Leonardo Munoz (AA '25) |
203514 |
/arrupe/outcomes/ourgraduates/leonardomunozaa25/ |
| Jonathan Grisalez (AA ’26) |
203515 |
/arrupe/outcomes/ourgraduates/jonathangrisalezaa26/ |
| Leroy Cassasola (AA ’25) |
203517 |
/arrupe/outcomes/ourgraduates/leroycassasolaaa25/ |
| Julissa Vazquez (AA ’25) |
203518 |
/arrupe/outcomes/ourgraduates/julissavazquezaa25/ |
| Jeferson David Aldana Sanchez (AA ’25) |
203519 |
/arrupe/outcomes/ourgraduates/jefersondavidaldanasanchezaa25/ |
| Arrupe Report |
205292 |
/arrupe/arrupereport/ |
| 2025 |
205293 |
/arrupe/arrupereport/2025/ |
| AACU |
206653 |
/arrupe/aacu/ |
| Asian Studies |
17742 |
/asianstudies/index.shtml |
| About Us |
17779 |
/asianstudies/aboutus/ |
| Contact Us |
17761 |
/asianstudies/contactus.shtml |
| Requirements |
17754 |
/asianstudies/requirements.shtml |
| Volunteer Opportunities |
17750 |
/asianstudies/volunteer_organizati.shtml |
| Affiliated Faculty |
17763 |
/asianstudies/affiliated_faculty.shtml |
| Academics |
17782 |
/asianstudies/academics/ |
| Resources |
17783 |
/asianstudies/resources/ |
| Map Collection of Asia |
17756 |
/asianstudies/map_resources.shtml |
| Study Abroad |
17751 |
/asianstudies/study_abroad.shtml |
| Student Organizations |
17752 |
/asianstudies/student_organization.shtml |
| News Resources |
17755 |
/asianstudies/external_related_lin.shtml |
| site_logo |
17745 |
/asianstudies/sitelogo/ |
| Footer |
17744 |
/asianstudies/footer/ |
| Learning Outcomes |
110466 |
/asianstudies/learningoutcomes/ |
| social media |
200520 |
/asianstudies/socialmedia/ |
| cta |
200521 |
/asianstudies/cta/ |
| Baumhart Center |
155427 |
/baumhartcenter/ |
| site_logo |
156025 |
/baumhartcenter/sitelogo/ |
| Footer |
156027 |
/baumhartcenter/footer/ |
| I Links |
156045 |
/baumhartcenter/ilinks/ |
| cta |
201552 |
/baumhartcenter/cta/ |
| social media |
179347 |
/baumhartcenter/socialmedia/ |
| About |
155428 |
/baumhartcenter/about/ |
| Mission |
156238 |
/baumhartcenter/about/mission/ |
| right_column |
198178 |
/baumhartcenter/about/mission/rightcolumn/ |
| Team |
155429 |
/baumhartcenter/about/team/ |
| Advisors and Founders |
204456 |
/baumhartcenter/about/advisorsandfounders/ |
| Alumni Committee |
201343 |
/baumhartcenter/about/alumnicommittee/ |
| Faculty Council |
155432 |
/baumhartcenter/about/facultycouncil/ |
| archive |
157150 |
/baumhartcenter/about/facultycouncil/archive/ |
| Why I Believe in Baumhart |
155434 |
/baumhartcenter/about/whyibelieveinbaumhart/ |
| Susan Crown |
198200 |
/baumhartcenter/about/whyibelieveinbaumhart/archive/susan-crown.shtml |
| Paul Fisher |
198201 |
/baumhartcenter/about/whyibelieveinbaumhart/archive/paul-fisher.shtml |
| Janet Froetscher |
198202 |
/baumhartcenter/about/whyibelieveinbaumhart/archive/janet-froetscher.shtml |
| Dorri McWhorter |
198204 |
/baumhartcenter/about/whyibelieveinbaumhart/archive/dorri-mcwhorter.shtml |
| Sundaram Nagarajan |
198205 |
/baumhartcenter/about/whyibelieveinbaumhart/archive/sundaram-nagarajan.shtml |
| Matt Summy |
198206 |
/baumhartcenter/about/whyibelieveinbaumhart/archive/matt-summy.shtml |
| William Towns |
198207 |
/baumhartcenter/about/whyibelieveinbaumhart/archive/william-towns.shtml |
| Neli Vasquez |
198208 |
/baumhartcenter/about/whyibelieveinbaumhart/archive/neli-vasquez-rowland.shtml |
| Kevin Willer |
198209 |
/baumhartcenter/about/whyibelieveinbaumhart/archive/kevin-willer.shtml |
| Impact Highlights |
203142 |
/baumhartcenter/about/impacthighlights/ |
| Contact Us |
177414 |
/baumhartcenter/about/contactus/ |
| Education |
155440 |
/baumhartcenter/education/ |
| Baumhart Scholars MBA |
155446 |
/baumhartcenter/education/baumhartscholarsmba/ |
| right_column |
156610 |
/baumhartcenter/education/baumhartscholarsmba/rightcolumn/ |
| Overview |
155447 |
/baumhartcenter/education/baumhartscholarsmba/ |
| Current Scholars |
155483 |
/baumhartcenter/education/baumhartscholarsmba/currentscholars/ |
| archive |
157170 |
/baumhartcenter/education/baumhartscholarsmba/currentscholars/archive/ |
| Benn Perrone |
197136 |
/baumhartcenter/education/baumhartscholarsmba/currentscholars/bennperrone/ |
| Chanel Smith |
197138 |
/baumhartcenter/education/baumhartscholarsmba/currentscholars/chanelsmith/ |
| Genevieve Kristofek |
197139 |
/baumhartcenter/education/baumhartscholarsmba/currentscholars/genevievekristofek/ |
| Jessica Ayala |
197141 |
/baumhartcenter/education/baumhartscholarsmba/currentscholars/jessicaayala/ |
| Kimberly Olson |
197142 |
/baumhartcenter/education/baumhartscholarsmba/currentscholars/kimberlyolson/ |
| Lauren Knight |
197143 |
/baumhartcenter/education/baumhartscholarsmba/currentscholars/laurenknight/ |
| Susan Plattner |
197144 |
/baumhartcenter/education/baumhartscholarsmba/currentscholars/susanplattner/ |
| Noah Baird |
197145 |
/baumhartcenter/education/baumhartscholarsmba/currentscholars/noahbaird/ |
| Jacque Stefanic |
197498 |
/baumhartcenter/education/baumhartscholarsmba/currentscholars/jacquestefanic/ |
| Kalina Chkoumbova |
197499 |
/baumhartcenter/education/baumhartscholarsmba/currentscholars/kalinachkoumbova/ |
| Mikey Dougala |
197500 |
/baumhartcenter/education/baumhartscholarsmba/currentscholars/mikeydougala/ |
| Jasmine Gilstrap Hunter |
206251 |
/baumhartcenter/education/baumhartscholarsmba/currentscholars/jasminegilstraphunter/ |
| LeShonne W. Quiñones Segura |
206253 |
/baumhartcenter/education/baumhartscholarsmba/currentscholars/leshonnewquionessegura/ |
| Mitchell Looman |
206254 |
/baumhartcenter/education/baumhartscholarsmba/currentscholars/mitchelllooman/ |
| Robert Metellus |
206255 |
/baumhartcenter/education/baumhartscholarsmba/currentscholars/robertmetellus/ |
| Sam Rodriguez |
206256 |
/baumhartcenter/education/baumhartscholarsmba/currentscholars/samrodriguez/ |
| Sequoyah Lopez |
206257 |
/baumhartcenter/education/baumhartscholarsmba/currentscholars/sequoyahlopez/ |
| Tom Knapp |
206258 |
/baumhartcenter/education/baumhartscholarsmba/currentscholars/tomknapp/ |
| Trazell Primuse |
206259 |
/baumhartcenter/education/baumhartscholarsmba/currentscholars/trazellprimuse/ |
| Alumni |
163468 |
/baumhartcenter/education/baumhartscholarsmba/alumni/ |
| archive |
163538 |
/baumhartcenter/education/baumhartscholarsmba/alumni/archive/ |
| Network |
155452 |
/baumhartcenter/education/baumhartscholarsmba/network/ |
| FT Recognizes Quinlan for Purpose |
155589 |
/baumhartcenter/education/baumhartscholarsmba/ftrecognizesquinlanforpurpose/ |
| What's Next |
202863 |
/baumhartcenter/education/whatsnext/ |
| 2020 Cohort |
155520 |
/baumhartcenter/education/whatsnext/2020cohort/ |
| Leading for DEI |
157267 |
/baumhartcenter/education/leadingfordei/ |
| Joy Adams |
156010 |
/baumhartcenter/education/leadingfordei/2020cohort/joyadams/ |
| Michael Blackshear |
156000 |
/baumhartcenter/education/leadingfordei/2020cohort/michaelblackshear/ |
| Kevin Boes |
156007 |
/baumhartcenter/education/leadingfordei/2020cohort/kevinboes/ |
| Wendy Dahm |
156013 |
/baumhartcenter/education/leadingfordei/2020cohort/wendydahm/ |
| Leslie Drish |
155994 |
/baumhartcenter/education/leadingfordei/2020cohort/lesliedrish/ |
| Maura Farrell |
156008 |
/baumhartcenter/education/leadingfordei/2020cohort/maurafarrell/ |
| Kim King |
155996 |
/baumhartcenter/education/leadingfordei/2020cohort/kimking/ |
| Tara Leweling |
156012 |
/baumhartcenter/education/leadingfordei/2020cohort/taraleweling/ |
| Bridget Lohrius |
156011 |
/baumhartcenter/education/leadingfordei/2020cohort/bridgetlohrius/ |
| Kamaria Morris |
156009 |
/baumhartcenter/education/leadingfordei/2020cohort/kamariamorris/ |
| Lisa Paschal |
156001 |
/baumhartcenter/education/leadingfordei/2020cohort/lisapaschal/ |
| Mark Rickmeier |
155997 |
/baumhartcenter/education/leadingfordei/2020cohort/markrickmeier/ |
| Victor Scotti |
156004 |
/baumhartcenter/education/leadingfordei/2020cohort/victorscotti/ |
| Yolanda Stephens |
156006 |
/baumhartcenter/education/leadingfordei/2020cohort/yolandastephens/ |
| Tawnya Stewart |
155998 |
/baumhartcenter/education/leadingfordei/2020cohort/tawnyastewart/ |
| Alicia Vega |
156003 |
/baumhartcenter/education/leadingfordei/2020cohort/aliciavega/ |
| Jessica-Rose Wallace |
155999 |
/baumhartcenter/education/leadingfordei/2020cohort/jessica-rosewallace/ |
| Annie Weinheimher |
156002 |
/baumhartcenter/education/leadingfordei/2020cohort/annieweinheimher/ |
| Carole Wood |
156005 |
/baumhartcenter/education/leadingfordei/2020cohort/carolewood/ |
| 2024 Cohort |
199397 |
/baumhartcenter/education/whatsnext/2024cohort/ |
| Leading for DEI |
155519 |
/baumhartcenter/education/leadingfordei/ |
| Abrams Sustainable Business Challenge |
162184 |
/baumhartcenter/education/abramssustainablebusinesschallenge/ |
| News and Stories |
190659 |
/baumhartcenter/education/abramssustainablebusinesschallenge/newsandstories/ |
| archive |
190661 |
/baumhartcenter/education/abramssustainablebusinesschallenge/newsandstories/archive/ |
| right_column |
162185 |
/baumhartcenter/education/abramssustainablebusinesschallenge/rightcolumn/ |
| Quinlan School of Business |
162189 |
https://www.luc.edu/quinlan/ |
| Abrams Challenge Judges |
166646 |
/baumhartcenter/education/abramssustainablebusinesschallenge/abramschallengejudges/ |
| custom_css |
166681 |
/baumhartcenter/education/abramssustainablebusinesschallenge/abramschallengejudges/customcss/ |
| Abrams Challenge Finalists 2021-22 |
168982 |
/baumhartcenter/education/abramssustainablebusinesschallenge/abramschallengefinalists2021-22/ |
| Abrams Challenge Winners 2021-22 |
177363 |
/baumhartcenter/education/abramssustainablebusinesschallenge/abramschallengewinners2021-22/ |
| Abrams Challenge Finalists 2023 |
185244 |
/baumhartcenter/education/abramssustainablebusinesschallenge/abramschallengefinalists2023/ |
| Abrams Challenge Winners 2023 |
185576 |
/baumhartcenter/education/abramssustainablebusinesschallenge/abramschallengewinners2023/ |
| Abrams Challenge Finalists 2024 |
193934 |
/baumhartcenter/education/abramssustainablebusinesschallenge/abramschallengefinalists2024/ |
| Abrams Challenge Winners 2024 |
194242 |
/baumhartcenter/education/abramssustainablebusinesschallenge/abramschallengewinners2024/ |
| Baumhart Certificate in Environmental, Social, and Governance |
185365 |
/baumhartcenter/education/baumhartcertificateinenvironmentalsocialandgovernance/ |
| Baumhart Impact Fund |
206953 |
/baumhartcenter/education/baumhartimpactfund/ |
| Programs |
155527 |
/baumhartcenter/programs/ |
| Leadership Development |
156241 |
/baumhartcenter/programs/leadershipdevelopment/ |
| archive |
156622 |
/baumhartcenter/programs/leadershipdevelopment/archive/ |
| Advancing DEI in our Workplaces |
157356 |
/baumhartcenter/programs/leadershipdevelopment/advancingdeiinourworkplaces/ |
| Fisher Family Conversations |
155530 |
/baumhartcenter/programs/leadershipdevelopment/fisherfamilyconversations/ |
| Impact Leaders Series |
155548 |
/baumhartcenter/programs/leadershipdevelopment/impactleadersseries/ |
| Impact Leaders Series 2019 |
155549 |
/baumhartcenter/programs/leadershipdevelopment/impactleadersseries/impactleadersseries2019/ |
| Young Nonprofit Leaders Series |
155547 |
/baumhartcenter/programs/leadershipdevelopment/youngnonprofitleadersseries/ |
| Leading for Good |
155528 |
/baumhartcenter/programs/leadingforgood/ |
| right_column |
161983 |
/baumhartcenter/programs/leadingforgood/rightcolumn/ |
| Leading for Good 2021 |
160669 |
/baumhartcenter/programs/leadingforgood/leadingforgood2021/ |
| Leading for Good 2024 |
191125 |
/baumhartcenter/programs/leadingforgood/leadingforgood2024/ |
| About Leading for Good |
191131 |
/baumhartcenter/programs/leadingforgood/ |
| Leading for Good 2023 |
191212 |
/baumhartcenter/programs/leadingforgood/leadingforgood2023/ |
| Leading for Good 2022 |
191128 |
/baumhartcenter/programs/leadingforgood/leadingforgood2022/ |
| Innovator Awards |
191130 |
https://www.luc.edu/baumhartcenter/awards/innovatorawards/ |
| Bios |
191136 |
/baumhartcenter/programs/leadingforgood/leadingforgood2024/bios/ |
| Shermann "Dilla" Thomas |
191137 |
/baumhartcenter/programs/leadingforgood/leadingforgood2024/bios/shermanndillathomas/ |
| Abena Boamah-Acheampong |
191138 |
/baumhartcenter/programs/leadingforgood/leadingforgood2024/bios/abenaboamah-acheampong/ |
| Lisa Laws |
191559 |
/baumhartcenter/programs/leadingforgood/leadingforgood2024/bios/lisalaws/ |
| Dale Green |
191560 |
/baumhartcenter/programs/leadingforgood/leadingforgood2024/bios/dalegreen/ |
| Kathleen Caliento |
191561 |
/baumhartcenter/programs/leadingforgood/leadingforgood2024/bios/kathleencaliento/ |
| Sam Glassenberg |
191562 |
/baumhartcenter/programs/leadingforgood/leadingforgood2024/bios/samglassenberg/ |
| Mary Hogue |
191657 |
/baumhartcenter/programs/leadingforgood/leadingforgood2024/bios/maryhogue/ |
| Jimmy Samartzis |
191658 |
/baumhartcenter/programs/leadingforgood/leadingforgood2024/bios/jimmysamartzis/ |
| Mark Ishaug |
191660 |
/baumhartcenter/programs/leadingforgood/leadingforgood2024/bios/markishaug/ |
| Jonathan McGee |
191705 |
/baumhartcenter/programs/leadingforgood/leadingforgood2024/bios/jonathanmcgee/ |
| Nisaini Rexach |
191706 |
/baumhartcenter/programs/leadingforgood/leadingforgood2024/bios/nisainirexach/ |
| Lyneir Richardson |
191707 |
/baumhartcenter/programs/leadingforgood/leadingforgood2024/bios/lyneirrichardson/ |
| April Williams-Luster |
191708 |
/baumhartcenter/programs/leadingforgood/leadingforgood2024/bios/aprilwilliams-luster/ |
| Jazmin Garcia |
191709 |
/baumhartcenter/programs/leadingforgood/leadingforgood2024/bios/jazmingarcia/ |
| Alex Kruzel |
191780 |
/baumhartcenter/programs/leadingforgood/leadingforgood2024/bios/alexkruzel/ |
| Nancy Bonges |
191781 |
/baumhartcenter/programs/leadingforgood/leadingforgood2024/bios/nancybonges/ |
| Paige Graham |
191782 |
/baumhartcenter/programs/leadingforgood/leadingforgood2024/bios/paigegraham/ |
| Corliss Garner |
191829 |
/baumhartcenter/programs/leadingforgood/leadingforgood2024/bios/corlissgarner/ |
| Matt Knott |
191830 |
/baumhartcenter/programs/leadingforgood/leadingforgood2024/bios/mattknott/ |
| Gabrielle Caverl McNeal |
191831 |
/baumhartcenter/programs/leadingforgood/leadingforgood2024/bios/gabriellecaverlmcneal/ |
| Jon Cohen |
191832 |
/baumhartcenter/programs/leadingforgood/leadingforgood2024/bios/joncohen/ |
| Laura Zumdahl |
191833 |
/baumhartcenter/programs/leadingforgood/leadingforgood2024/bios/laurazumdahl/ |
| Dana Emanuel |
191834 |
/baumhartcenter/programs/leadingforgood/leadingforgood2024/bios/danaemanuel/ |
| Haven Leeming |
191919 |
/baumhartcenter/programs/leadingforgood/leadingforgood2024/bios/havenleeming/ |
| Arthur Chow |
191920 |
/baumhartcenter/programs/leadingforgood/leadingforgood2024/bios/arthurchow/ |
| Kimberly Evans |
191922 |
/baumhartcenter/programs/leadingforgood/leadingforgood2024/bios/kimberlyevans/ |
| Stephanie Lerdall |
191923 |
/baumhartcenter/programs/leadingforgood/leadingforgood2024/bios/stephanielerdall/ |
| Charles Cannon |
191924 |
/baumhartcenter/programs/leadingforgood/leadingforgood2024/bios/charlescannon/ |
| Carl Jones Jr. |
191925 |
/baumhartcenter/programs/leadingforgood/leadingforgood2024/bios/carljonesjr/ |
| Leading for Good 2022 |
168728 |
/baumhartcenter/programs/leadingforgood/leadingforgood2022/ |
| Overview |
177368 |
/baumhartcenter/programs/leadingforgood/leadingforgood2022/ |
| Leading for Good 2022 |
177405 |
https://www.luc.edu/baumhartcenter/programs/leadingforgood/leadingforgood2022/ |
| Agenda |
177364 |
/baumhartcenter/programs/leadingforgood/leadingforgood2022/agenda/ |
| Speakers |
177367 |
/baumhartcenter/programs/leadingforgood/leadingforgood2022/speakers/ |
| Attendee Hub Log-in |
177817 |
https://cvent.me/KRYAx2 |
| right_column |
177369 |
/baumhartcenter/programs/leadingforgood/leadingforgood2022/rightcolumn/ |
| Leading for Good 2023 |
184307 |
/baumhartcenter/programs/leadingforgood/leadingforgood2023/ |
| Leading for Good 2025 |
197996 |
/baumhartcenter/programs/leadingforgood/leadingforgood2025/ |
| Leading for Good 2026 |
205324 |
/baumhartcenter/programs/leadingforgood/leadingforgood2026/ |
| Reporting for Impact |
191589 |
/baumhartcenter/programs/reportingforimpact/ |
| Responsible Business Leaders |
184837 |
/baumhartcenter/programs/responsiblebusinessleaders/ |
| Fall 2023 Cohort |
190450 |
/baumhartcenter/programs/responsiblebusinessleaders/fall2023cohort/ |
| Tech for Good Bootcamp |
198866 |
/baumhartcenter/programs/techforgoodbootcamp/ |
| Events |
155564 |
/baumhartcenter/events/ |
| Upcoming Events |
156146 |
/baumhartcenter/events/upcomingevents/ |
| archive |
155568 |
/baumhartcenter/events/upcomingevents/archive/ |
| Reboot Your Network for a Better World: Summer 2026 |
207107 |
/baumhartcenter/events/upcomingevents/rebootyournetworkforabetterworldsummer2026/ |
| Past Events |
155565 |
/baumhartcenter/events/pastevents/ |
| archive |
155566 |
/baumhartcenter/events/pastevents/archive/ |
| 2025 |
201506 |
/baumhartcenter/events/pastevents/2025/ |
| Impact Through Alliance: Englewood |
202431 |
/baumhartcenter/events/upcomingevents/impactthroughallianceenglewood/ |
| Reboot Your Network for a Better World |
200783 |
/baumhartcenter/events/pastevents/2025/rebootyournetworkforabetterworld/ |
| Corporate Leadership in Sustainable Water Management |
202441 |
/baumhartcenter/events/pastevents/2025/corporateleadershipinsustainablewatermanagement/ |
| Reboot Your Network for a Better World |
202998 |
/baumhartcenter/events/upcomingevents/rebootyournetworkforabetterworld/ |
| Reboot Your Network for a Better World - Winter 2025 |
205528 |
/baumhartcenter/events/upcomingevents/rebootyournetworkforabetterworld-winter2025/ |
| Impact Through Alliance: Rogers Park |
203184 |
/baumhartcenter/events/upcomingevents/impactthroughalliancerogerspark/ |
| 2024 |
199996 |
/baumhartcenter/events/pastevents/2024/ |
| AI for Good |
198654 |
/baumhartcenter/events/pastevents/2024/aiforgood/ |
| Growing an Inclusive Clean Economy |
200089 |
/baumhartcenter/events/pastevents/2024/growinganinclusivecleaneconomy/ |
| Everyone to Their Fullest Potential |
200090 |
/baumhartcenter/events/pastevents/2024/everyonetotheirfullestpotential/ |
| ESG at Work |
200091 |
/baumhartcenter/events/pastevents/2024/esgatwork/ |
| Sparking Leadership Through Core Values |
200093 |
/baumhartcenter/events/pastevents/2024/sparkingleadershipthroughcorevalues/ |
| Reboot Your Network for a Better World |
200094 |
/baumhartcenter/events/pastevents/2024/rebootyournetworkforabetterworld/ |
| 2023 |
199995 |
/baumhartcenter/events/pastevents/2023/ |
| Demystifying Social Impact Careers |
200004 |
/baumhartcenter/events/pastevents/2023/demystifyingsocialimpactcareers/ |
| The State of Black Chicago: From Data to Impact |
200005 |
/baumhartcenter/events/pastevents/2023/thestateofblackchicagofromdatatoimpact/ |
| Exploring Sustainability Careers |
200006 |
/baumhartcenter/events/pastevents/2023/exploringsustainabilitycareers/ |
| Making it Matter: Owners and Managers Talk ESG and Impact |
200008 |
/baumhartcenter/events/pastevents/2023/makingitmatterownersandmanagerstalkesgandimpact/ |
| Ownership for All |
200009 |
/baumhartcenter/events/pastevents/2023/ownershipforall/ |
| CSR and ESG: Where are they headed in 2023 |
200011 |
/baumhartcenter/events/pastevents/2023/csrandesgwherearetheyheadedin2023/ |
| The Rise of Social Entrepreneurship |
200012 |
/baumhartcenter/events/pastevents/2023/theriseofsocialentrepreneurship/ |
| 2022 |
199997 |
/baumhartcenter/events/pastevents/2022/ |
| Women in Small Business: Stories of Impact |
200017 |
/baumhartcenter/events/pastevents/2022/womeninsmallbusinessstoriesofimpact/ |
| Pivot to Impact |
200018 |
/baumhartcenter/events/pastevents/2022/pivottoimpact/ |
| Innovating for Climate Change |
200021 |
/baumhartcenter/events/pastevents/2022/innovatingforclimatechange/ |
| Women of Color: Redefining Power in Corporate America |
200022 |
/baumhartcenter/events/pastevents/2022/womenofcolorredefiningpowerincorporateamerica/ |
| The Rise of Community Based Incubators |
200023 |
/baumhartcenter/events/pastevents/2022/theriseofcommunitybasedincubators/ |
| Advancing DEI in Financial Services |
200024 |
/baumhartcenter/events/pastevents/2022/advancingdeiinfinancialservices/ |
| Impact 360 |
200025 |
/baumhartcenter/events/pastevents/2022/impact360/ |
| 2021 |
199998 |
/baumhartcenter/events/pastevents/2021/ |
| Advancing DEI in Corporate Workplaces |
200026 |
/baumhartcenter/events/pastevents/2021/advancingdeiincorporateworkplaces/ |
| Advancing DEI in Higher Education |
200027 |
/baumhartcenter/events/pastevents/2021/advancingdeiinhighereducation/ |
| Advancing DEI in Venture Capital |
200028 |
/baumhartcenter/events/pastevents/2021/advancingdeiinventurecapital/ |
| Banking with Purpose First Womens Bank |
200029 |
/baumhartcenter/events/pastevents/2021/bankingwithpurposefirstwomensbank/ |
| A Conversation with Molly Melin |
200030 |
/baumhartcenter/events/pastevents/2021/aconversationwithmollymelin/ |
| Connecting the Dots: Human Services and Economic Development |
200031 |
/baumhartcenter/events/pastevents/2021/connectingthedotshumanservicesandeconomicdevelopment/ |
| Ideas Worth Teaching: Finance for a Sustainable World |
200032 |
/baumhartcenter/events/pastevents/2021/ideasworthteachingfinanceforasustainableworld/ |
| Baumhart Scholars: Leading with Purpose and Strategy |
200033 |
/baumhartcenter/events/pastevents/2021/baumhartscholarsleadingwithpurposeandstrategy/ |
| The Future of Women at Work |
200034 |
/baumhartcenter/events/pastevents/2021/thefutureofwomenatwork/ |
| Closing the Capital Gap for Black, Latinx, and Women Entrepreneurs |
200035 |
/baumhartcenter/events/pastevents/2021/closingthecapitalgapforblacklatinxandwomenentrepreneurs/ |
| The New Normal in the Workplace |
200036 |
/baumhartcenter/events/pastevents/2021/thenewnormalintheworkplace/ |
| The Financial Case for Purposeful Business |
200037 |
/baumhartcenter/events/pastevents/2021/thefinancialcaseforpurposefulbusiness/ |
| A Conversation with Annie Duflo |
200038 |
/baumhartcenter/events/pastevents/2021/aconversationwithannieduflo/ |
| Enterprise Risk Management (ERM) for Nonprofits: A Primer |
200039 |
/baumhartcenter/events/pastevents/2021/enterpriseriskmanagementermfornonprofitsaprimer/ |
| Building Trust in the Vaccine |
200040 |
/baumhartcenter/events/pastevents/2021/buildingtrustinthevaccine/ |
| A Conversation with Diane Primo |
200041 |
/baumhartcenter/events/pastevents/2021/aconversationwithdianeprimo/ |
| The Vaccine and Your Workplace |
200042 |
/baumhartcenter/events/pastevents/2021/thevaccineandyourworkplace/ |
| Accelerating Impact |
200043 |
/baumhartcenter/events/pastevents/2021/acceleratingimpact/ |
| 2020 |
199999 |
/baumhartcenter/events/pastevents/2020/ |
| Leading Business for Good 2020 |
200044 |
/baumhartcenter/events/pastevents/2020/leadingbusinessforgood2020/ |
| Advancing Equity through Cross-Sectoral Partnership |
200045 |
/baumhartcenter/events/pastevents/2020/advancingequitythroughcross-sectoralpartnership/ |
| A Conversation with Dr. Emily Barman |
200046 |
/baumhartcenter/events/pastevents/2020/aconversationwithdremilybarman/ |
| A Conversation with Mark Hanis |
200047 |
/baumhartcenter/events/pastevents/2020/aconversationwithmarkhanis/ |
| Small Business Leading for Diversity and Inclusion |
200049 |
/baumhartcenter/events/pastevents/2020/smallbusinessleadingfordiversityandinclusion/ |
| Meet the Baumhart Scholars MBA Faculty |
200051 |
/baumhartcenter/events/pastevents/2020/meetthebaumhartscholarsmbafaculty/ |
| Rethinking Data for Social Impact |
200052 |
/baumhartcenter/events/pastevents/2020/rethinkingdataforsocialimpact/ |
| Impact 360 |
200053 |
/baumhartcenter/events/pastevents/2020/impact360/ |
| Leading for Good 2020 |
200054 |
/baumhartcenter/events/pastevents/2020/leadingforgood2020/ |
| Building Your Annual Giving Program |
200055 |
/baumhartcenter/events/pastevents/2020/buildingyourannualgivingprogram/ |
| 2019 |
200000 |
/baumhartcenter/events/pastevents/2019/ |
| Coffee with Guillermo Jaime |
200056 |
/baumhartcenter/events/pastevents/2019/coffeewithguillermojaime/ |
| Good Business Breakfast |
200057 |
/baumhartcenter/events/pastevents/2019/goodbusinessbreakfast/ |
| Business Leaders Share Strategies for Social Responsibility |
200058 |
/baumhartcenter/events/pastevents/2019/businessleaderssharestrategiesforsocialresponsibility/ |
| Kohler visit energizes Loyola students |
200059 |
/baumhartcenter/events/pastevents/2019/kohlervisitenergizesloyolastudents/ |
| The Transformative Power of Second Chance Hiring |
200060 |
/baumhartcenter/events/pastevents/2019/thetransformativepowerofsecondchancehiring/ |
| This Changes Everything Film Premiere |
200061 |
/baumhartcenter/events/pastevents/2019/thischangeseverythingfilmpremiere/ |
| Reimagining Finance: Chicago Women Changing the Game |
200062 |
/baumhartcenter/events/pastevents/2019/reimaginingfinancechicagowomenchangingthegame/ |
| How Business Leaders Build a Better World |
200063 |
/baumhartcenter/events/pastevents/2019/howbusinessleadersbuildabetterworld/ |
| Role of Companies as Corporate Citizens |
200064 |
/baumhartcenter/events/pastevents/2019/roleofcompaniesascorporatecitizens/ |
| Pathways for Extraordinary Lives |
200065 |
/baumhartcenter/events/pastevents/2019/pathwaysforextraordinarylives/ |
| A Conversation with Tony Hunter |
200066 |
/baumhartcenter/events/pastevents/2019/aconversationwithtonyhunter/ |
| Pathways for Marrying Purpose and Profit |
200067 |
/baumhartcenter/events/pastevents/2019/pathwaysformarryingpurposeandprofit/ |
| Leading for Good 2019 |
200068 |
/baumhartcenter/events/pastevents/2019/leadingforgood2019/ |
| A Conversation with Amy Francetic |
200069 |
/baumhartcenter/events/pastevents/2019/aconversationwithamyfrancetic/ |
| A Conversation with Johanna Vetter |
200070 |
/baumhartcenter/events/pastevents/2019/aconversationwithjohannavetter/ |
| Form of the Firm |
200071 |
/baumhartcenter/events/pastevents/2019/formofthefirm/ |
| 2018 |
200001 |
/baumhartcenter/events/pastevents/2018/ |
| Nonprofit Leadership Dinner |
200072 |
/baumhartcenter/events/pastevents/2018/nonprofitleadershipdinner/ |
| A Conversation with 1871 CEO Betsy Ziegler |
200073 |
/baumhartcenter/events/pastevents/2018/aconversationwith1871ceobetsyziegler/ |
| Leaning in Together |
200074 |
/baumhartcenter/events/pastevents/2018/leaningintogether/ |
| Leading Business for Good 2018 |
200076 |
/baumhartcenter/events/pastevents/2018/leadingbusinessforgood2018/ |
| A Conversation with Nicole Johnson-Scales |
200077 |
/baumhartcenter/events/pastevents/2018/aconversationwithnicolejohnson-scales/ |
| A Conversation with Jessica Droste Yagan |
200079 |
/baumhartcenter/events/pastevents/2018/aconversationwithjessicadrosteyagan/ |
| A Conversation with Richard Rodriguez |
200080 |
/baumhartcenter/events/pastevents/2018/aconversationwithrichardrodriguez/ |
| Leading for Good 2018 |
200082 |
/baumhartcenter/events/pastevents/2018/leadingforgood2018/ |
| Conversation with Ric Estrada |
200083 |
/baumhartcenter/events/pastevents/2018/conversationwithricestrada/ |
| A Keynote by Charles Adler, Kickstarter Co-founder |
200084 |
/baumhartcenter/events/pastevents/2018/akeynotebycharlesadlerkickstarterco-founder/ |
| A Conversation with Connie Lindsey |
200085 |
/baumhartcenter/events/pastevents/2018/aconversationwithconnielindsey/ |
| Harnessing the power of social business |
200086 |
/baumhartcenter/events/pastevents/2018/harnessingthepowerofsocialbusiness/ |
| Advancing Climate Solutions Through Global Exchange |
204493 |
/baumhartcenter/events/upcomingevents/advancingclimatesolutionsthroughglobalexchange/ |
| The Future of Philanthropy |
206472 |
/baumhartcenter/events/upcomingevents/thefutureofphilanthropy/ |
| Navigating Corporate Responsibility |
204699 |
/baumhartcenter/events/upcomingevents/navigatingcorporateresponsibility/ |
| Awards |
156323 |
/baumhartcenter/awards/ |
| Innovator Awards |
177952 |
/baumhartcenter/awards/innovatorawards/ |
| 2020 Innovator Awards |
155543 |
/baumhartcenter/awards/innovatorawards/2020innovatorawards/ |
| Innovators Report |
156623 |
/baumhartcenter/awards/innovatorawards/2020innovatorawards/innovatorsreport/ |
| Report PDF |
157576 |
/baumhartcenter/awards/innovatorawards/2020innovatorawards/reportpdf/ |
| 2021 Innovator Awards |
160293 |
/baumhartcenter/awards/innovatorawards/2021innovatorawards/ |
| 2022 Innovator Awards |
178048 |
/baumhartcenter/awards/innovatorawards/2022innovatorawards/ |
| 2023 Innovator Awards |
184856 |
/baumhartcenter/awards/innovatorawards/2023innovatorawards/ |
| 2024 Innovator Awards |
188141 |
/baumhartcenter/awards/innovatorawards/2024innovatorawards/ |
| 2025 Innovator Awards |
201887 |
/baumhartcenter/awards/innovatorawards/2025innovatorawards/ |
| About the Parkinson Award |
156624 |
/baumhartcenter/awards/innovatorawards/abouttheparkinsonaward/ |
| 2026 Innovator Awards winners |
206300 |
/baumhartcenter/awards/innovatorawards/2026innovatorawardswinners/ |
| Media |
155551 |
/baumhartcenter/media/ |
| News |
155574 |
/baumhartcenter/media/news/ |
| Leading for Good 2024: A Day of Content and Community |
193791 |
/baumhartcenter/media/news/leadingforgood2024adayofcontentandcommunity/ |
| archive |
155577 |
/baumhartcenter/media/news/archive/ |
| Chicago leaders make case for inclusivity |
155582 |
/baumhartcenter/media/news/chicagoleadersmakecaseforinclusivity/ |
| Donor accelerates student learning and social impact |
155585 |
/baumhartcenter/media/news/donoracceleratesstudentlearningandsocialimpact/ |
| Loyola community debates responsibilities of corporations |
155586 |
/baumhartcenter/media/news/loyolacommunitydebatesresponsibilitiesofcorporations/ |
| Vetter shares cross-sectoral career journey |
155587 |
/baumhartcenter/media/news/vettersharescross-sectoralcareerjourney/ |
| Leaders explore how to accelerate impact |
155588 |
/baumhartcenter/media/news/leadersexplorehowtoaccelerateimpact/ |
| Global Conversation on Climate Change |
188542 |
/baumhartcenter/media/news/globalconversationonclimatechange/ |
| Growing an Inclusive Clean Economy |
199336 |
/baumhartcenter/media/news/growinganinclusivecleaneconomy/ |
| AI for Good 2024 |
199658 |
/baumhartcenter/media/news/aiforgood2024/ |
| Consulting in the Clean Energy Economy |
199659 |
/baumhartcenter/media/news/consultinginthecleanenergyeconomy/ |
| Tech for Good Bootcamp |
200439 |
/baumhartcenter/media/news/techforgoodbootcamp/ |
| Leading for Good 2025 |
202293 |
/baumhartcenter/media/news/leadingforgood2025/ |
| Empowerment and Connection |
202589 |
/baumhartcenter/media/news/empowermentandconnection/ |
| Collaboration at the center of partnership with Comcast |
202969 |
/baumhartcenter/media/news/collaborationatthecenterofpartnershipwithcomcast/ |
| Chicago Neighborhoods Redefining Inclusive Economic Growth |
204928 |
/baumhartcenter/media/news/chicagoneighborhoodsredefininginclusiveeconomicgrowth/ |
| Leading for Good 2026 Recap |
206968 |
/baumhartcenter/media/news/leadingforgood2026recap/ |
| The Future of Philanthropy 2026 recap |
207184 |
/baumhartcenter/media/news/thefutureofphilanthropy2026recap/ |
| Baumhart in the News |
178475 |
/baumhartcenter/media/baumhartinthenews/ |
| archive |
178476 |
/baumhartcenter/media/baumhartinthenews/archive/ |
| Publications |
155554 |
/baumhartcenter/media/publications/ |
| archive |
155555 |
/baumhartcenter/media/publications/archive/ |
| PDFs |
163499 |
/baumhartcenter/media/publications/pdfs/ |
| Innovator Reports |
203334 |
/baumhartcenter/media/publications/innovatorreports/ |
| Builders Vision |
203335 |
/baumhartcenter/media/publications/innovatorreports/buildersvision/ |
| Climate Vault |
203438 |
/baumhartcenter/media/publications/innovatorreports/climatevault/ |
| New Moms |
203454 |
/baumhartcenter/media/publications/innovatorreports/newmoms/ |
| Nourishing Hope |
203697 |
/baumhartcenter/media/publications/innovatorreports/nourishinghope/ |
| Vistria |
203893 |
/baumhartcenter/media/publications/innovatorreports/vistria/ |
| Evergreen Climate Innovations |
204076 |
/baumhartcenter/media/publications/innovatorreports/evergreenclimateinnovations/ |
| Place Based Investing |
206646 |
/baumhartcenter/media/publications/placebasedinvesting/ |
| News Archive |
156929 |
/baumhartcenter/media/newsarchive/ |
| archive |
156920 |
/baumhartcenter/media/newsarchive/archive/ |
| News |
156933 |
/baumhartcenter/media/news/ |
| Publications |
156940 |
/baumhartcenter/media/publications/ |
| Iva Vurdelja brings CSR toolkit to Nepal |
155584 |
/baumhartcenter/media/newsarchive/ivavurdeljabringscsrtoolkittonepal/ |
| Nonprofit management students enjoy a special visitor: President Rooney |
155581 |
/baumhartcenter/media/newsarchive/nonprofitmanagementstudentsenjoyaspecialvisitorpresidentrooney/ |
| Quinlan professor makes impact through teaching and research |
155579 |
/baumhartcenter/media/newsarchive/quinlanprofessormakesimpactthroughteachingandresearch/ |
| Meet Ric Estrada |
155576 |
/baumhartcenter/media/newsarchive/meetricestrada/ |
| Thought leader discusses responsible business |
155580 |
/baumhartcenter/media/newsarchive/thoughtleaderdiscussesresponsiblebusiness/ |
| VIdeos |
203437 |
https://www.youtube.com/playlist?list=PLv7Wi_Gt3XEm88Wkh7qhFMMHK8r8SSa6T |
| Bios |
155875 |
/baumhartcenter/bios/ |
| Steve Sanger |
180963 |
/baumhartcenter/bios/stevesanger/ |
| Brian Abrams |
155895 |
/baumhartcenter/bios/brianabrams/ |
| Wendy Abrams |
166668 |
/baumhartcenter/bios/wendyabrams/ |
| Dwetri Addy |
160335 |
/baumhartcenter/bios/dwetriaddy/ |
| Shannon Alexander |
155890 |
/baumhartcenter/bios/shannonalexander/ |
| Jennifer Alter Warden |
155993 |
/baumhartcenter/bios/jenniferalterwarden/ |
| Lorraine Anderson King |
160553 |
/baumhartcenter/bios/lorraineandersonking/ |
| Natalie Angarita |
156015 |
/baumhartcenter/bios/natalieangarita/ |
| Teri Argos |
155914 |
/baumhartcenter/bios/teriargos/ |
| Brenda Asare |
155983 |
/baumhartcenter/bios/brendaasare/ |
| John Atkinson |
155909 |
/baumhartcenter/bios/johnatkinson/ |
| Diana Aviv |
158395 |
/baumhartcenter/bios/dianaaviv/ |
| Amir Badr |
160703 |
/baumhartcenter/bios/amirbadr/ |
| Meghan Baer |
169036 |
/baumhartcenter/bios/meghanbaer/ |
| Townsend Bailey |
162177 |
/baumhartcenter/bios/townsendbailey/ |
| Katie Baltensperger |
169038 |
/baumhartcenter/bios/katiebaltensperger/ |
| Jeffrey Beckham Jr. |
161367 |
/baumhartcenter/bios/jeffreybeckhamjr/ |
| Sarah Berghorst |
160827 |
/baumhartcenter/bios/sarahberghorst/ |
| Michelle Y. Bess |
160836 |
/baumhartcenter/bios/michelleybess/ |
| Erik G. Birkerts |
155897 |
/baumhartcenter/bios/erikgbirkerts/ |
| Jane Blain Gilbertson |
157591 |
/baumhartcenter/bios/janeblaingilbertson/ |
| Bram Bluestein |
155888 |
/baumhartcenter/bios/brambluestein/ |
| Ola Bolton |
155965 |
/baumhartcenter/bios/olabolton/ |
| Larry Brand |
155995 |
/baumhartcenter/bios/larrybrand/ |
| Julie Brautigam |
155959 |
/baumhartcenter/bios/juliebrautigam/ |
| Erin Brooks |
155915 |
/baumhartcenter/bios/erinbrooks/ |
| Patricia Broughton |
155932 |
/baumhartcenter/bios/patriciabroughton/ |
| Omar Brown |
159707 |
/baumhartcenter/bios/omarbrown/ |
| Freya Burton |
166669 |
/baumhartcenter/bios/freyaburton/ |
| Pat Canning |
155892 |
/baumhartcenter/bios/patcanning/ |
| Abbie Castiglione |
155988 |
/baumhartcenter/bios/abbiecastiglione/ |
| Gloria Castillo |
155980 |
/baumhartcenter/bios/gloriacastillo/ |
| Shane Caterino |
155916 |
/baumhartcenter/bios/shanecaterino/ |
| Daniel Cervantes |
161900 |
/baumhartcenter/bios/danielcervantes/ |
| Lincoln J. Chandler |
155966 |
/baumhartcenter/bios/lincolnjchandler/ |
| Jonathan Chaparro |
161482 |
/baumhartcenter/bios/jonathanchaparro/ |
| Joanna Cohen |
155971 |
/baumhartcenter/bios/joannacohen/ |
| Elizabeth Cole |
155945 |
/baumhartcenter/bios/elizabethcole/ |
| Tanjia Coleman |
155944 |
/baumhartcenter/bios/tanjiacoleman/ |
| Steve Collens |
155882 |
/baumhartcenter/bios/stevecollens/ |
| Megan Conway |
180293 |
/baumhartcenter/bios/meganconway/ |
| Molly Cook |
160551 |
/baumhartcenter/bios/mollycook/ |
| Tarrah Cooper |
155910 |
/baumhartcenter/bios/tarrahcooper/ |
| Holly Copeland |
155990 |
/baumhartcenter/bios/hollycopeland/ |
| Laura Coy |
155898 |
/baumhartcenter/bios/lauracoy/ |
| Susan Crown |
155949 |
/baumhartcenter/bios/susancrown/ |
| Gretchen Cusick |
155984 |
/baumhartcenter/bios/gretchencusick/ |
| Maire Daly |
155917 |
/baumhartcenter/bios/mairedaly/ |
| Jenna Daugherty |
155912 |
/baumhartcenter/bios/jennadaugherty/ |
| Kent Dauten |
155950 |
/baumhartcenter/bios/kentdauten/ |
| Felicia Davis |
160734 |
/baumhartcenter/bios/feliciadavis/ |
| Shelley A. Davis |
155961 |
/baumhartcenter/bios/shelleyadavis/ |
| Wendy DuBoe |
155948 |
/baumhartcenter/bios/wendyduboe/ |
| Aaron Durnbaugh |
166670 |
/baumhartcenter/bios/aarondurnbaugh/ |
| John Edelman |
163698 |
/baumhartcenter/bios/johnedelman/ |
| Laura Eilts |
155899 |
/baumhartcenter/bios/lauraeilts/ |
| Daniela Enea |
169034 |
/baumhartcenter/bios/danielaenea/ |
| Aimée Eubanks Davis |
158397 |
/baumhartcenter/bios/aimeeeubanksdavis/ |
| Mike Evans |
155880 |
/baumhartcenter/bios/mikeevans/ |
| Paul Fisher |
155877 |
/baumhartcenter/bios/paulfisher/ |
| Corey Flournoy |
155975 |
/baumhartcenter/bios/coreyflournoy/ |
| Kendra Foley |
155918 |
/baumhartcenter/bios/kendrafoley/ |
| Ellie Forman |
158985 |
/baumhartcenter/bios/ellieforman/ |
| Angela Foster-Rice |
161523 |
/baumhartcenter/bios/angelafoster-rice/ |
| Karen Freeman-Wilson |
155978 |
/baumhartcenter/bios/karenfreeman-wilson/ |
| Alison Fyhrie |
155913 |
/baumhartcenter/bios/alisonfyhrie/ |
| Helene Gayle |
158402 |
/baumhartcenter/bios/helenegayle/ |
| Stacey Gillett |
155958 |
/baumhartcenter/bios/staceygillett/ |
| Eban Goodstein |
166671 |
/baumhartcenter/bios/ebangoodstein/ |
| Ilene Gordon |
155887 |
/baumhartcenter/bios/ilenegordon/ |
| Deepa Gupta |
155974 |
/baumhartcenter/bios/deepagupta/ |
| Monica Gupta |
160831 |
/baumhartcenter/bios/monicagupta/ |
| Angel Gutierrez |
169039 |
/baumhartcenter/bios/angelgutierrez/ |
| Jenna Hammond |
169040 |
/baumhartcenter/bios/jennahammond/ |
| Francia E. Harrington |
161518 |
/baumhartcenter/bios/franciaeharrington/ |
| Nancy Harris |
160835 |
/baumhartcenter/bios/nancyharris/ |
| Jaylinn Herrera |
156014 |
/baumhartcenter/bios/jaylinnherrera/ |
| Christian Herrmann |
155986 |
/baumhartcenter/bios/christianherrmann/ |
| Calvin Holmes |
160053 |
/baumhartcenter/bios/calvinholmes/ |
| Mark Hoppe |
159408 |
/baumhartcenter/bios/markhoppe/ |
| Peter Hoskow |
160241 |
/baumhartcenter/bios/peterhoskow/ |
| Shannon Howes |
155962 |
/baumhartcenter/bios/shannonhowes/ |
| Tony Hunter |
158849 |
/baumhartcenter/bios/tonyhunter/ |
| Ryan Jeffery |
166672 |
/baumhartcenter/bios/ryanjeffery/ |
| Mercedes Jenkins |
163091 |
/baumhartcenter/bios/mercedesjenkins/ |
| Matt Johanson |
163092 |
/baumhartcenter/bios/mattjohanson/ |
| Rich Johnson |
161413 |
/baumhartcenter/bios/richjohnson/ |
| Kelly Jones |
155920 |
/baumhartcenter/bios/kellyjones/ |
| Jamie Jones Ezefili |
161497 |
/baumhartcenter/bios/jamiejonesezefili/ |
| Lesley Kennedy |
162179 |
/baumhartcenter/bios/lesleykennedy/ |
| Madalyn Kenney |
155921 |
/baumhartcenter/bios/madalynkenney/ |
| Rachel Kohler |
155935 |
/baumhartcenter/bios/rachelkohler/ |
| Dr. Richard Kolsky |
159674 |
/baumhartcenter/bios/drrichardkolsky/ |
| Karin Kraai |
161524 |
/baumhartcenter/bios/karinkraai/ |
| Matt Kruse |
155902 |
/baumhartcenter/bios/mattkruse/ |
| Abin Kuriakose |
166673 |
/baumhartcenter/bios/abinkuriakose/ |
| Paige LaCour |
158986 |
/baumhartcenter/bios/paigelacour/ |
| Alexis Langlois |
155903 |
/baumhartcenter/bios/alexislanglois/ |
| Jeannette LeZaks |
166674 |
/baumhartcenter/bios/jeannettelezaks/ |
| James Lindley Wilson |
155896 |
/baumhartcenter/bios/jameslindleywilson/ |
| Robert Livingston |
158424 |
/baumhartcenter/bios/robertlivingston/ |
| Erika Lueker-Tarango |
155922 |
/baumhartcenter/bios/erikalueker-tarango/ |
| Eric Lugo |
161462 |
/baumhartcenter/bios/ericlugo/ |
| Anthony Maietta |
155982 |
/baumhartcenter/bios/anthonymaietta/ |
| Jessica Malkin |
155933 |
/baumhartcenter/bios/jessicamalkin/ |
| Santrice R. Martin |
169035 |
/baumhartcenter/bios/santricermartin/ |
| Sara Mayeda |
160552 |
/baumhartcenter/bios/saramayeda/ |
| Kenya Merritt |
160743 |
/baumhartcenter/bios/kenyamerritt/ |
| Kate McAdams |
155883 |
/baumhartcenter/bios/katemcadams/ |
| Michael McAfee |
158403 |
/baumhartcenter/bios/michaelmcafee/ |
| Renetta McCann |
155934 |
/baumhartcenter/bios/renettamccann/ |
| Shannon McGhee |
166675 |
/baumhartcenter/bios/shannonmcghee/ |
| Bill McKibben |
166676 |
/baumhartcenter/bios/billmckibben/ |
| Dorri McWhorter |
155881 |
/baumhartcenter/bios/dorrimcwhorter/ |
| Kim Michelson |
160730 |
/baumhartcenter/bios/kimmichelson/ |
| Eileen Mitchell |
155969 |
/baumhartcenter/bios/eileenmitchell/ |
| Samir Mirza |
155973 |
/baumhartcenter/bios/samirmirza/ |
| Poorvi Modi |
155991 |
/baumhartcenter/bios/poorvimodi/ |
| Mary Morten |
155963 |
/baumhartcenter/bios/marymorten/ |
| Jim Nordmeyer |
155889 |
/baumhartcenter/bios/jimnordmeyer/ |
| Jacqueline Novogratz |
158404 |
/baumhartcenter/bios/jacquelinenovogratz/ |
| Katie O’Brien-Jensen |
158405 |
/baumhartcenter/bios/katieobrien-jensen/ |
| Mary Frances O'Connor |
155919 |
/baumhartcenter/bios/maryfrancesoconnor/ |
| Jill O'Donovan |
159159 |
/baumhartcenter/bios/jillodonovan/ |
| John O'Shaughnessy |
155884 |
/baumhartcenter/bios/johnoshaughnessy/ |
| Elizabeth Okey |
159161 |
/baumhartcenter/bios/elizabethokey/ |
| Raeann Olsen-Jackson |
155923 |
/baumhartcenter/bios/raeannolsen-jackson/ |
| John Palfrey |
158406 |
/baumhartcenter/bios/johnpalfrey/ |
| Priya Parrish |
155957 |
/baumhartcenter/bios/priyaparrish/ |
| Tonise Paul |
158442 |
/baumhartcenter/bios/tonisepaul/ |
| Anna Paulson |
155968 |
/baumhartcenter/bios/annapaulson/ |
| Terry Peterson |
157581 |
/baumhartcenter/bios/terrypeterson/ |
| Kelly Powers |
155924 |
/baumhartcenter/bios/kellypowers/ |
| Deepa Purushothaman |
168349 |
/baumhartcenter/bios/deepapurushothaman/ |
| Pinky Raina |
160807 |
/baumhartcenter/bios/pinkyraina/ |
| Diana Rauner |
155936 |
/baumhartcenter/bios/dianarauner/ |
| Francie Schnipke Richards |
155926 |
/baumhartcenter/bios/francieschnipkerichards/ |
| Lyneir Richardson |
159709 |
/baumhartcenter/bios/lyneirrichardson/ |
| Jennifer Riskind |
155925 |
/baumhartcenter/bios/jenniferriskind/ |
| Joanne Rodriguez |
180294 |
/baumhartcenter/bios/joannerodriguez/ |
| Leeatt Rothschild |
155905 |
/baumhartcenter/bios/leeattrothschild/ |
| Andrea Sáenz |
160482 |
/baumhartcenter/bios/andreasaenz/ |
| Jon Samuels |
155906 |
/baumhartcenter/bios/jonsamuels/ |
| Nicholas Santos |
180295 |
/baumhartcenter/bios/nicholassantos/ |
| Heather Sattler |
155976 |
/baumhartcenter/bios/heathersattler/ |
| Megan Scarsella |
166677 |
/baumhartcenter/bios/meganscarsella/ |
| Alvin Schexnider |
155946 |
/baumhartcenter/bios/alvinschexnider/ |
| Bill Schleizer |
160733 |
/baumhartcenter/bios/billschleizer/ |
| Anastasia Schriber |
169033 |
/baumhartcenter/bios/anastasiaschriber/ |
| Samuel Scott |
155952 |
/baumhartcenter/bios/samuelscott/ |
| Molly Silverman |
155927 |
/baumhartcenter/bios/mollysilverman/ |
| Myla Skinner |
155992 |
/baumhartcenter/bios/mylaskinner/ |
| Ashish Shah |
155907 |
/baumhartcenter/bios/ashishshah/ |
| Smita Shah |
155911 |
/baumhartcenter/bios/smitashah/ |
| Steven Shaw |
158407 |
/baumhartcenter/bios/stevenshaw/ |
| Amita Shetty |
155977 |
/baumhartcenter/bios/amitashetty/ |
| Carolyn Smith |
155928 |
/baumhartcenter/bios/carolynsmith/ |
| Dane Smith |
160266 |
/baumhartcenter/bios/danesmith/ |
| Eric Smith |
158408 |
/baumhartcenter/bios/ericsmith/ |
| Judai Smith |
159823 |
/baumhartcenter/bios/judaismith/ |
| Stephanie A. Smith |
155989 |
/baumhartcenter/bios/stephanieasmith/ |
| Beth Spurgeon |
155964 |
/baumhartcenter/bios/bethspurgeon/ |
| Julia Stasch |
155876 |
/baumhartcenter/bios/juliastasch/ |
| Yolanda Stephens |
161365 |
/baumhartcenter/bios/yolandastephens/ |
| Cheryl Stevens |
155985 |
/baumhartcenter/bios/cherylstevens/ |
| Kevin Stevens |
180296 |
/baumhartcenter/bios/kevinstevens/ |
| Lauren Stone |
161410 |
/baumhartcenter/bios/laurenstone/ |
| Matthew Summy |
155937 |
/baumhartcenter/bios/matthewsummy/ |
| Pam Swenk |
155929 |
/baumhartcenter/bios/pamswenk/ |
| Sheila Talton |
155893 |
/baumhartcenter/bios/sheilatalton/ |
| Nia Tavoularis |
155930 |
/baumhartcenter/bios/niatavoularis/ |
| Emmanuel Thompson |
159824 |
/baumhartcenter/bios/emmanuelthompson/ |
| Rishad Tobaccowala |
158409 |
/baumhartcenter/bios/rishadtobaccowala/ |
| Angela Tovar |
166678 |
/baumhartcenter/bios/angelatovar/ |
| William Towns |
155908 |
/baumhartcenter/bios/williamtowns/ |
| Carlos A. Trejo |
169032 |
/baumhartcenter/bios/carlosatrejo/ |
| Stephanie Truax |
169037 |
/baumhartcenter/bios/stephanietruax/ |
| Gen Tullman |
159030 |
/baumhartcenter/bios/gentullman/ |
| Pallavi Verma |
155960 |
/baumhartcenter/bios/pallaviverma/ |
| Johanna Vetter |
155891 |
/baumhartcenter/bios/johannavetter/ |
| David Vitale |
155938 |
/baumhartcenter/bios/davidvitale/ |
| Maryann Waryjas |
155970 |
/baumhartcenter/bios/maryannwaryjas/ |
| John Weakliam |
155886 |
/baumhartcenter/bios/johnweakliam/ |
| Jaycie Weathers |
155940 |
/baumhartcenter/bios/jaycieweathers/ |
| Eric Weinheimer |
155967 |
/baumhartcenter/bios/ericweinheimer/ |
| LaTonya Wilkins |
166722 |
/baumhartcenter/bios/latonyawilkins/ |
| Kevin Willer |
166679 |
/baumhartcenter/bios/kevinwiller/ |
| Vincent Williams |
160701 |
/baumhartcenter/bios/vincentwilliams/ |
| Victoria Woo |
180297 |
/baumhartcenter/bios/victoriawoo/ |
| Carole Wood |
155931 |
/baumhartcenter/bios/carolewood/ |
| Mandy Yoh |
168348 |
/baumhartcenter/bios/mandyyoh/ |
| Jessica Young |
169041 |
/baumhartcenter/bios/jessicayoung/ |
| Michael Pirson |
180394 |
/baumhartcenter/bios/michaelpirson/ |
| Donna Rapaccioli |
180395 |
/baumhartcenter/bios/donnarapaccioli/ |
| Madeline Stanton |
181524 |
/baumhartcenter/bios/madelinestanton/ |
| Marcus Wedner |
188105 |
/baumhartcenter/bios/marcuswedner/ |
| Griselda Garibay |
189738 |
/baumhartcenter/bios/griseldagaribay/ |
| Victoria Rudd |
191472 |
/baumhartcenter/bios/victoriarudd/ |
| Brandolon Barnett |
191473 |
/baumhartcenter/bios/brandolonbarnett/ |
| Amanda Lamb |
191474 |
/baumhartcenter/bios/amandalamb/ |
| Fred Tan |
204047 |
/baumhartcenter/bios/fredtan/ |
| Karen Kerschke |
204048 |
/baumhartcenter/bios/karenkerschke/ |
| Videos |
156016 |
/baumhartcenter/videos/ |
| Innovators in Social Business |
156017 |
/baumhartcenter/videos/innovatorsinsocialbusiness/ |
| Leading for Good 2020 |
156018 |
/baumhartcenter/videos/leadingforgood2020/ |
| Bike to Loyola |
95210 |
/biketoloyola/ |
| About |
99539 |
/biketoloyola/about/ |
| Bike Friendly University |
99540 |
/biketoloyola/about/bikefriendlyuniversity/ |
| Bike Commuter Challenge |
99541 |
/biketoloyola/about/bikecommuterchallenge/ |
| Bike2Campus Week |
99542 |
/biketoloyola/about/bike2campusweek/ |
| Safety |
95229 |
/biketoloyola/safety/ |
| Accidents |
95235 |
/biketoloyola/safety/accidents/ |
| Weather |
95236 |
/biketoloyola/safety/weather/ |
| CTA/Pace/Metra |
95237 |
/biketoloyola/safety/ctapacemetra/ |
| right_column |
95265 |
/biketoloyola/safety/rightcolumn/ |
| Storage and Parking |
95230 |
/biketoloyola/storageandparking/ |
| Registration |
95238 |
/biketoloyola/storageandparking/registration/ |
| Abandoned Bike Policy |
95239 |
/biketoloyola/storageandparking/abandonedbikepolicy/ |
| Routes |
95231 |
/biketoloyola/routes/ |
| Lake Shore Campus |
95240 |
/biketoloyola/routes/lakeshorecampus/ |
| right_column |
95267 |
/biketoloyola/routes/lakeshorecampus/rightcolumn/ |
| Water Tower Campus |
95241 |
/biketoloyola/routes/watertowercampus/ |
| right_column |
95268 |
/biketoloyola/routes/watertowercampus/rightcolumn/ |
| Health Sciences Campus |
95242 |
/biketoloyola/routes/healthsciencescampus/ |
| right_column |
95269 |
/biketoloyola/routes/healthsciencescampus/rightcolumn/ |
| Special Events |
95243 |
/biketoloyola/routes/specialevents/ |
| Bike to Work and Campus |
95251 |
/biketoloyola/routes/specialevents/biketoworkandcampus/ |
| right_column |
95266 |
/biketoloyola/routes/specialevents/rightcolumn/ |
| Get a Bike |
95232 |
/biketoloyola/getabike/ |
| Divvy |
95467 |
/biketoloyola/getabike/divvy/ |
| Local Bike Shops |
95468 |
/biketoloyola/getabike/localbikeshops/ |
| Showers |
95252 |
/biketoloyola/showers/ |
| Documents |
95311 |
/biketoloyola/documents/ |
| right_column |
95247 |
/biketoloyola/rightcolumn/ |
| site_logo |
95216 |
/biketoloyola/sitelogo/ |
| footer |
95218 |
/biketoloyola/footer/ |
| Bioethics Minor |
17432 |
/bioethics/ |
| site_logo |
17439 |
/bioethics/site_logo/ |
| About Us |
77960 |
/bioethics/aboutus/ |
| Director's Welcome |
179719 |
/bioethics/aboutus/directorswelcome/ |
| Contact Us |
17433 |
/bioethics/contact.shtml |
| Faculty |
17434 |
/bioethics/faculty.shtml |
| Requirements |
17436 |
/bioethics/requirements.shtml |
| Bio, Neuro & Biochem Majors |
77853 |
/bioethics/bioneurobiochemmajors/ |
| Extracurricular Opportunities |
17437 |
/bioethics/special_events.shtml |
| Stories |
89207 |
/bioethics/stories/ |
| archive |
89208 |
/bioethics/stories/archive/ |
| IPAB Lab |
155267 |
/bioethics/stories/archive/ipablab/ |
| News |
199682 |
/bioethics/stories/news/ |
| John F. Grant MD Endowment |
199679 |
/bioethics/stories/news/johnfgrantmdendowment/ |
| Congratulations to our 2024 Award Winners! |
199683 |
/bioethics/stories/news/congratulationstoour2024awardwinners/ |
| John F. Grant, M.D., Endowment - Overview |
17435 |
/bioethics/stories/news/johnfgrantmdendowment-overview/ |
| Footer |
17440 |
/bioethics/footer/ |
| Bioinformatics |
17622 |
/bioinformatics/index.shtml |
| About Us |
17623 |
/bioinformatics/about.shtml |
| What is Bioinformatics? |
99606 |
/bioinformatics/whatisbioinformatics/ |
| Stories and News |
198844 |
/bioinformatics/storiesandnews/ |
| archive |
94451 |
/bioinformatics/storiesandnews/archive/ |
| Faculty & Staff |
206310 |
/bioinformatics/facultystaff/ |
| profiles |
206311 |
/bioinformatics/faculty-new/profiles/ |
| right_column |
206312 |
/bioinformatics/faculty-new/profiles/rightcolumn/ |
| Academics |
17629 |
/bioinformatics/academics.shtml |
| Accelerated Degrees |
99608 |
/bioinformatics/accelerateddegrees/ |
| Bioinformatics Five Year Program |
185726 |
https://gpem.luc.edu/portal/abm?name=bioinformaticsms |
| BS Biology / MS Bioinformatics |
185727 |
https://gpem.luc.edu/portal/abm?name=bioinformaticsms |
| Graduate Classes |
147368 |
/bioinformatics/graduateclasses/ |
| BS in Bioinformatics |
147725 |
/bioinformatics/bsinbioinformatics/ |
| Minor in Bioinformatics |
167508 |
/bioinformatics/minorinbioinformatics/ |
| MS in Bioinformatics |
185725 |
https://gpem.luc.edu/portal/program?name=bioinformaticsms |
| Research |
62676 |
/bioinformatics/research/ |
| Research @ LUC |
99726 |
/bioinformatics/research/researchluc/ |
| Internships |
99727 |
/bioinformatics/research/internships/ |
| Student Researchers |
99728 |
/bioinformatics/research/studentresearchers/ |
| Admission |
17632 |
/bioinformatics/admission.shtml |
| Financial Aid |
17633 |
/bioinformatics/finaid.html |
| Graduate Admission |
99747 |
/bioinformatics/graduateadmission/ |
| Careers in Bioinformatics |
99748 |
/bioinformatics/careersinbioinformatics/ |
| Internship Opportunities |
99749 |
/bioinformatics/internshipopportunities/ |
| Academic Calendars |
17628 |
/bioinformatics/calendars.html |
| Bioinformatics Links |
99751 |
/bioinformatics/bioinformaticslinks/ |
| Footer |
17649 |
/bioinformatics/footer/ |
| modules-programming |
198839 |
/bioinformatics/modules-programming/ |
| cta |
198840 |
/bioinformatics/cta/ |
| site_logo |
198842 |
/bioinformatics/sitelogo/ |
| social media |
198843 |
/bioinformatics/socialmedia/ |
| Biology, Department of |
34706 |
/biology/index.shtml |
| site_logo |
36196 |
/biology/sitelogo/ |
| social media |
48165 |
/biology/socialmedia/ |
| Footer |
198525 |
/biology/footer/ |
| cta |
198549 |
/biology/cta/ |
| About Us |
34707 |
/biology/aboutus/ |
| News and Events |
34810 |
/biology/news/ |
| archive |
67979 |
/biology/news/archive/ |
| Biology Department Newsletter |
34715 |
/biology/news/biologydepartmentnewsletter/ |
| Biology Seminar |
34718 |
/biology/news/biologyseminar/ |
| Biology Symposia |
34719 |
/biology/news/biologysymposia/ |
| Biology Update Newsletters |
99869 |
/biology/news/biologyupdatenewsletters/ |
| Dean Barbara Schaal |
101383 |
/biology/deanbarbaraschaal/ |
| Thesis Defenses |
200633 |
/biology/news/thesisdefenses/ |
| Faculty Research |
34726 |
/biology/aboutus/facultyresearch/ |
| Michael Burns |
99619 |
/biology/aboutus/facultyresearch/michaelburns/ |
| Daniel Cavanaugh |
87481 |
/biology/aboutus/facultyresearch/danielcavanaugh/ |
| James M. Cheverud |
58317 |
/biology/aboutus/facultyresearch/jamesmcheverud/ |
| Rodney M. Dale |
56536 |
/biology/aboutus/facultyresearch/rodneymdale/ |
| Timothy Hoellein |
34760 |
/biology/hoellein.shtml |
| John J. Kelly |
34735 |
/biology/kelly.shtml |
| Jennifer Mierisch |
56561 |
/biology/aboutus/facultyresearch/jennifermierisch/ |
| Joseph Milanovich |
58320 |
/biology/aboutus/facultyresearch/josephmilanovich/ |
| Catherine Putonti |
34792 |
/biology/putonti.shtml |
| Sema3A+/+ versus Sema3A-/- Tongue Innervation in Stereo |
34749 |
/biology/sema3aversussema3a--tongueinnervationinstereo/ |
| Thomas Sanger |
99620 |
/biology/aboutus/facultyresearch/thomassanger/ |
| Heather Wheeler |
85183 |
/biology/aboutus/facultyresearch/heatherwheeler/ |
| Hui Ye |
56560 |
/biology/aboutus/facultyresearch/huiye/ |
| Wei-Ming Yu |
93392 |
/biology/aboutus/facultyresearch/wei-mingyu/ |
| Michael Grillo |
115891 |
/biology/aboutus/facultyresearch/michaelgrillo/ |
| Yoel E. Stuart |
126498 |
/biology/aboutus/facultyresearch/yoelestuart/ |
| Caroline Turner |
146816 |
/biology/aboutus/facultyresearch/turner.shtml |
| Delgado, Jary |
163063 |
/biology/aboutus/facultyresearch/jarydelgado/ |
| Yanan Chen |
179519 |
/biology/aboutus/facultyresearch/yananchen/ |
| Megan Whitney |
180076 |
/biology/aboutus/facultyresearch/meganwhitney/ |
| Tauana Cunha |
200920 |
/biology/Cunha.shtml |
| Hector Mendoza |
204052 |
/biology/aboutus/facultyresearch/hectormendoza/ |
| Faculty/Staff Directory |
34727 |
/biology/aboutus/facultystaffdirectory/ |
| Faculty Bios |
178252 |
/biology/aboutus/facultystaffdirectory/faculty/ |
| Omar Abdul-Rahim |
180285 |
/biology/aboutus/facultystaffdirectory/faculty/omarabdul-rahim/ |
| Christine Beatty |
178253 |
/biology/aboutus/facultystaffdirectory/faculty/christinebeatty/ |
| Fr. Peter Breslin |
178254 |
/biology/aboutus/facultystaffdirectory/faculty/frpeterbreslin/ |
| Gerald Buldak |
178255 |
/biology/aboutus/facultystaffdirectory/faculty/geraldbuldak/ |
| Kristin de Nesnera |
178256 |
/biology/aboutus/facultystaffdirectory/faculty/kristindenesnera/ |
| Alfred Diggs |
178257 |
/biology/aboutus/facultystaffdirectory/faculty/alfreddiggs/ |
| Holly Dimitropoulos |
178258 |
/biology/aboutus/facultystaffdirectory/faculty/hollydimitropoulos/ |
| Emma Feeney |
178261 |
/biology/aboutus/facultystaffdirectory/faculty/emmafeeney/ |
| Dawn Franks |
178262 |
/biology/aboutus/facultystaffdirectory/faculty/dawnfranks/ |
| Erin Hayes |
178264 |
/biology/aboutus/facultystaffdirectory/faculty/erinhayes/ |
| D. Megan Helfgott |
178265 |
/biology/aboutus/facultystaffdirectory/faculty/dmeganhelfgott/ |
| Dallas Krentzel |
178268 |
/biology/aboutus/facultystaffdirectory/faculty/dallaskrentzel/ |
| James Lodolce |
178269 |
/biology/aboutus/facultystaffdirectory/faculty/jameslodolce/ |
| Angenee Milton |
178271 |
/biology/aboutus/facultystaffdirectory/faculty/angeneemilton/ |
| Pamela Osenkowski |
178272 |
/biology/aboutus/facultystaffdirectory/faculty/pamelaosenkowski/ |
| Helena Palka-Hamblin |
178276 |
/biology/aboutus/facultystaffdirectory/faculty/helenapalka-hamblin/ |
| Shauna Price |
178280 |
/biology/aboutus/facultystaffdirectory/faculty/shaunaprice/ |
| Jeremy Ritzert |
178283 |
/biology/aboutus/facultystaffdirectory/faculty/jeremyritzert/ |
| Bree Sines |
178284 |
/biology/aboutus/facultystaffdirectory/faculty/breesines/ |
| Molly Staley |
178285 |
/biology/aboutus/facultystaffdirectory/faculty/mollystaley/ |
| Jennifer Zitzner |
178286 |
/biology/aboutus/facultystaffdirectory/faculty/jenniferzitzner/ |
| Test |
206416 |
/biology/aboutus/facultystaffdirectory/faculty/test/ |
| Giving to the Biology Department |
66079 |
https://securelb.imodules.com/s/1548/alumni/giving.aspx?sid=1548&gid=2&pgid=716&cid=1619 |
| Contact Us |
34723 |
/biology/aboutus/contactus/ |
| Biology Research Articles |
34717 |
/biology/aboutus/biologyresearcharticles/ |
| BIOL: Student Comments |
34721 |
/biology/aboutus/biolstudentcomments/ |
| Thesis Defense |
34758 |
/biology/aboutus/thesis/ |
| Cheryl Theile Thesis Title |
163034 |
/biology/aboutus/thesis/cheryltheilethesistitle/ |
| Cheryl Theile Project Description |
162250 |
/biology/aboutus/thesis/cheryltheilethesistitle/cheryltheileprojectdescription/ |
| Lilian Epperlein Thesis Title |
160170 |
/biology/aboutus/thesis/lilianepperlein/ |
| Lilian Epperlein Project Description |
160171 |
/biology/aboutus/thesis/lilianepperlein/lilianepperleinprojectdescription/ |
| Elizabeth Berg Thesis Defense |
160949 |
/biology/aboutus/thesis/elizabethbergthesisdefense/ |
| Elizabeth Berg Project Description |
160950 |
/biology/aboutus/thesis/elizabethbergthesisdefense/elizabethbergprojectdescription/ |
| Thesis Defense Sophie B. LaBelle |
107698 |
/biology/aboutus/thesis/thesisdefensesophieblabelle/ |
| Sophie LaBelle Project Description |
160365 |
/biology/aboutus/thesis/thesisdefensesophieblabelle/sophielabelleprojectdescription/ |
| Lisa H. Kim Thesis Title |
147304 |
/biology/aboutus/thesis/lisahkimthesistitle/ |
| Lisa Kim Project Description |
147434 |
/biology/aboutus/thesis/lisahkimthesistitle/lisakimprojectdescription/ |
| Lindsay Scarpitta Thesis Title |
162049 |
/biology/aboutus/thesis/lindsayscarpittathesistitle/ |
| Lindsay Scarpitta Project Description |
162064 |
/biology/aboutus/thesis/lindsayscarpittathesistitle/lindsayscarpittaprojectdescription/ |
| Lauren Wisbrock Thesis Title |
162241 |
/biology/aboutus/thesis/lindsayscarpittathesistitle/lindsayscarpittaprojectdescription/laurenwisbrockthesistitle/ |
| Lauren Wisbrock Project Description |
162242 |
/biology/aboutus/thesis/lindsayscarpittathesistitle/lindsayscarpittaprojectdescription/laurenwisbrockthesistitle/laurenwisbrockprojectdescription/ |
| Adrianna Soriano Thesis Title |
162245 |
/biology/aboutus/thesis/adriannasorianothesistitle/ |
| Adrianna Soriano Project Description |
162999 |
/biology/aboutus/thesis/adriannasorianothesistitle/adriannasorianoprojectdescription/ |
| Lilyan Mather Thesis Defense |
177114 |
/biology/aboutus/thesis/lilyanmather/ |
| JJ Colgan Thesis |
178202 |
/biology/aboutus/thesis/jjcolgan/ |
| Jeffrey Peters Thesis |
179626 |
/biology/aboutus/thesis/jeffpeters/ |
| Raul Lazcano Gonzalez |
179663 |
/biology/aboutus/thesis/raullazcano/ |
| Joshua Hittie |
179785 |
/biology/aboutus/thesis/joshuahittie/ |
| Demi Jetters |
179786 |
/biology/aboutus/thesis/demijetters/ |
| Gail Hillary Enriquez |
187240 |
/biology/aboutus/thesis/gailenriquez/ |
| Liz Kazmierczak Thesis Defense |
188145 |
/biology/aboutus/thesis/kazmierczak/ |
| Bailey Schwenk |
191755 |
/biology/aboutus/thesis/baileyschwenk/ |
| Katie Van Dame |
194225 |
/biology/aboutus/thesis/katievandame/ |
| Katherine Starr |
194811 |
/biology/aboutus/thesis/katherinestarr/ |
| Jessica Lindberg |
194812 |
/biology/aboutus/thesis/jessicalindberg/ |
| Mike Vosburgh |
194813 |
/biology/aboutus/thesis/mikevosburgh/ |
| Manny Widuch |
198239 |
/biology/aboutus/thesis/mannywiduch/ |
| Academics |
34764 |
/biology/academics.shtml |
| BS in Biology |
200756 |
https://catalog.luc.edu/undergraduate/arts-sciences/biology/biology-bs/ |
| MS in Biology |
185730 |
https://catalog.luc.edu/graduate-professional/graduate-school/arts-sciences/biology/biology-ms/ |
| Minors |
200757 |
https://catalog.luc.edu/undergraduate/arts-sciences/biology/biology-minor/ |
| MA in Medical Sciences |
198777 |
https://catalog.luc.edu/graduate-professional/graduate-school/arts-sciences/biology/medical-sciences-ma/ |
| Admission |
34786 |
/biology/admission/ |
| Resources |
35851 |
/biology/resources/ |
| Current Students |
198755 |
/biology/resources/currentstudents/ |
| Graduate Housing |
36122 |
/biology/resources/graduatehousing/ |
| Alumni Resources |
36121 |
/biology/resources/alumniresources/ |
| Imaging Lab Reservations |
47097 |
/biology/resources/lab-reservations.shtml |
| Departmental Calendars |
47889 |
/biology/resources/departmentalcalendars/ |
| Internship & Volunteer Opportunities |
93607 |
/biology/internshipvolunteeropportunities/ |
| Health Related |
99774 |
/biology/internshipvolunteeropportunities/healthrelated/ |
| Pre-Health Volunteer Opportunities |
89922 |
https://www.luc.edu/prehealth/summergapyearopportunities/clinicalexperience/ |
| LUC Medical Mentoring Program |
99492 |
https://www.luc.edu/stritch/faculty/mentorship/ |
| Opportunities Abroad |
99776 |
/biology/internshipvolunteeropportunities/opportunitiesabroad/ |
| Job Opportunities |
99779 |
/biology/internshipvolunteeropportunities/jobopportunities/ |
| Career Development Center |
89918 |
/career/ |
| Center for Experiential Learning |
89919 |
/celts/ |
| Post-Graduation Positions |
117415 |
/biology/internshipvolunteeropportunities/post-graduationpositions/ |
| Internships |
198686 |
/biology/internshipvolunteeropportunities/internships/ |
| Medical Schools Attended by MAMS Alumni |
34803 |
/biology/ma_medschools.shtml |
| Research |
177049 |
/biology/research/ |
| Pursuing Research |
177050 |
/biology/research/pursuingresearch/ |
| Fellowship Research Program |
177051 |
/biology/research/fellowshipresearchprogram/ |
| Brand - Color Exploration |
192090 |
/brand-colorexploration/ |
| Ads |
192101 |
/brand-colorexploration/ads/ |
| Email |
192246 |
/brand-colorexploration/email/ |
| Plasma |
192306 |
/brand-colorexploration/plasma/ |
| PPT |
192250 |
/brand-colorexploration/ppt/ |
| Social |
192293 |
/brand-colorexploration/social/ |
| ZOOM |
192255 |
/brand-colorexploration/zoom/ |
| LUC Home |
192258 |
/brand-colorexploration/luchome/ |
| SES Home |
192094 |
/brand-colorexploration/seshome/ |
| modules-programming |
192482 |
/brand-colorexploration/seshome/modules-programming/ |
| Landing Page |
192096 |
/brand-colorexploration/landingpage/ |
| site_logo |
192109 |
/brand-colorexploration/sitelogo/ |
| Building Resilience Against Violence Engagement (BRAVE) |
121319 |
/brave/ |
| About Us |
121320 |
/brave/aboutus/ |
| Mission Statement |
121586 |
/brave/aboutus/missionstatement/ |
| Our Team |
121582 |
/brave/aboutus/ourteam/ |
| Caleb Kim, PhD |
121604 |
/brave/aboutus/calebkimphd/ |
| Terri Kilbane, PhD |
121605 |
/brave/aboutus/terrikilbanephd/ |
| Philip Hong, PhD |
121608 |
/brave/aboutus/philiphongphd/ |
| Patiya Freely |
121609 |
/brave/aboutus/patiyafreely/ |
| Rana Hong |
121729 |
/brave/aboutus/ranahong/ |
| Jessica Rosenthal |
122112 |
/brave/aboutus/jessicarosenthal/ |
| Sr. Hien Nguyen, Ph.D. |
160068 |
/brave/aboutus/srhiennguyenphd/ |
| BRAVE Team’s Publications |
166950 |
/brave/aboutus/braveteamspublications/ |
| Newsletters |
167004 |
/brave/aboutus/newsletters/ |
| Partners |
121321 |
/brave/partners/ |
| Centro Romero |
147733 |
/brave/partners/centroromero/ |
| By The Hand Club for Kids |
147734 |
/brave/partners/bythehandclubforkids/ |
| Lincoln Park High School |
159310 |
/brave/partners/lincolnparkhighschool/ |
| Vietnamese Association of Illinois ( FORMER PARTNER ) |
147732 |
/brave/partners/vietnameseassociationofillinoisformerpartner/ |
| Be a part of the team |
121323 |
/brave/beapartoftheteam/ |
| Events |
121322 |
/brave/events/ |
| Centro Romero |
161233 |
/brave/events/centroromero/ |
| By The Hand |
167358 |
/brave/events/bythehand/ |
| Summer Camp 2019 |
166952 |
/brave/events/summercamp2019/ |
| Contact Us |
121324 |
/brave/contactus/ |
| site_logo |
203290 |
/brave/sitelogo/ |
| Footer |
203291 |
/brave/footer/ |
| Bursar Dev |
125258 |
/bursardev/ |
| site_logo |
125259 |
/bursardev/sitelogo/ |
| Footer |
125260 |
/bursardev/footer/ |
| modules-programming |
197166 |
/bursardev/modules-programming/ |
| Sample Interior Page |
125273 |
/bursardev/sampleinteriorpage/ |
| C-FIRST |
152235 |
/cfirst/ |
| About Us |
152267 |
/cfirst/aboutus/ |
| Overview |
152268 |
/cfirst/aboutus/overview/ |
| Our Team |
152269 |
/cfirst/aboutus/ourteam/ |
| History |
152270 |
/cfirst/aboutus/history/ |
| Programs |
152264 |
/cfirst/programs/ |
| Current Student Programs |
152273 |
/cfirst/programs/currentstudentprograms/ |
| Clinician Opportunities |
152274 |
/cfirst/programs/clinicianopportunities/ |
| C-FIRST Annual Conference & Capstone Experiences |
159079 |
/cfirst/programs/c-firstannualconferencecapstoneexperiences/ |
| Dr. Gabor Maté in Conversation with the C-FIRST |
163385 |
/cfirst/programs/drgabormateinconversationwiththec-first/ |
| Contact Us |
152283 |
/cfirst/contactus/ |
| News |
152262 |
/cfirst/news/ |
| cta |
203212 |
/cfirst/cta/ |
| site_logo |
203215 |
/cfirst/sitelogo/ |
| Calendar |
177291 |
/calendar/ |
| site_logo |
177292 |
/calendar/sitelogo/ |
| Guidelines |
182192 |
/calendar/guidelines/ |
| Campus Card |
29749 |
/campuscard/ |
| Welcome |
29760 |
/campuscard/welcome/ |
| Contact Us |
29787 |
/campuscard/welcome/contactus/ |
| Our Commitment |
123306 |
/campuscard/welcome/ourcommitment/ |
| Card Basics |
123307 |
/campuscard/welcome/cardbasics/ |
| Frequently Asked Questions |
29809 |
/campuscard/welcome/frequentlyaskedquestions/ |
| Campus Card Office News |
30067 |
/campuscard/welcome/news.shtml |
| Report Campus Card Problems |
29883 |
/campuscard/welcome/reportcampuscardproblems/ |
| Submitted |
65815 |
/campuscard/welcome/reportcampuscardproblems/submitted/ |
| Meal Plans |
29782 |
/campuscard/mealplans/ |
| Resident Meal Plans |
29811 |
/campuscard/mealplans/residentmealplans/ |
| Non-Resident Meal Plans |
29812 |
/campuscard/mealplans/non-residentmealplans/ |
| 2020-2021 Meal Plans |
127398 |
/campuscard/mealplans/non-residentmealplans/2020-2021mealplans/ |
| Spring 2021 Meal Plans |
156607 |
/campuscard/mealplans/non-residentmealplans/spring2021mealplans/ |
| 2026-2027 Meal Plans |
206777 |
/campuscard/mealplans/non-residentmealplans/2026-2027mealplans/ |
| Meal Plan Changes |
29810 |
/campuscard/mealplans/mealplanchanges/ |
| Staff and Faculty Meal Plans |
124007 |
/campuscard/mealplans/staffandfacultymealplans/ |
| Meal Plan Locations |
124009 |
/campuscard/mealplans/mealplanlocations/ |
| Rambler Bucks |
29783 |
/campuscard/ramblerbucks/ |
| Adding Rambler Bucks |
29813 |
/campuscard/ramblerbucks/addingramblerbucks/ |
| Charge Authorizations |
29852 |
/campuscard/ramblerbucks/addingramblerbucks/chargeauthorizations/ |
| Online Card Office |
29856 |
/campuscard/ramblerbucks/addingramblerbucks/onlinecardoffice/ |
| ValuePort Locations |
29860 |
/campuscard/ramblerbucks/addingramblerbucks/valueportlocations/ |
| Courtesy Cards |
30015 |
/campuscard/ramblerbucks/courtesycards/ |
| Rambler Bucks Locations |
30012 |
/campuscard/ramblerbucks/ramblerbuckslocations/ |
| Policies |
68463 |
/campuscard/ramblerbucks/policies/ |
| Dining Dollars vs. Rambler Bucks |
182026 |
/campuscard/ramblerbucks/diningdollarsvsramblerbucks/ |
| Services |
29786 |
/campuscard/services/ |
| Alumni Cards |
85807 |
/campuscard/services/alumnicards/ |
| Campus Safety |
29882 |
/campuscard/services/campussafety/ |
| Halas Recreation Center |
29878 |
/campuscard/services/halasrecreationcenter/ |
| Libraries |
29879 |
/campuscard/services/libraries/ |
| Parking Services |
29880 |
/campuscard/services/parkingservices/ |
| Passport Photos |
84083 |
/campuscard/services/passportphotos/ |
| Photo Submission |
147974 |
/campuscard/services/photosubmission/ |
| Printing Services |
29881 |
/campuscard/services/printingservices/ |
| Residence Life |
30202 |
/campuscard/services/residencelife/ |
| Forms |
29808 |
/campuscard/forms/ |
| Rambler Bucks Refund Form |
68660 |
/campuscard/forms/ramblerbucksrefundform/ |
| Rambler Bucks Refund Request Received |
68661 |
/campuscard/thanks_refundreq.shtml |
| home_center |
55177 |
/campuscard/homecenter/ |
| home_left |
55183 |
/campuscard/homeleft/ |
| home_right |
55182 |
/campuscard/homeright/ |
| home_content |
55176 |
/campuscard/homecontent/ |
| Footer |
30034 |
/campuscard/footer/ |
| site_logo |
30035 |
/campuscard/sitelogo/ |
| social media |
202913 |
/campuscard/socialmedia/ |
| cta |
202914 |
/campuscard/cta/ |
| modules-programming |
202915 |
/campuscard/modules-programming/ |
| Campus Ministry |
25996 |
/campusministry/index.shtml |
| site_logo |
26334 |
/campusministry/sitelogo/ |
| Footer |
26335 |
/campusministry/footer/ |
| modules-programming |
198678 |
/campusministry/modules-programming/ |
| About Us |
26036 |
/campusministry/about/index.shtml |
| right_column |
58251 |
/campusministry/about/rightcolumn/ |
| Meet Our Team |
200734 |
/campusministry/about/meetourteam/ |
| Profiles |
200735 |
/campusministry/about/meetourteam/profiles/ |
| Donate |
91374 |
/campusministry/about/donate/ |
| Contact Us |
87378 |
/campusministry/about/contactus/ |
| Faith Traditions |
200653 |
/campusministry/faithtraditions/ |
| Catholic Students |
200654 |
/campusministry/faithtraditions/catholicstudents/ |
| Hindu Students |
200655 |
/campusministry/faithtraditions/hindustudents/ |
| Jewish Students |
200656 |
/campusministry/faithtraditions/jewishstudents/ |
| Muslim Students |
200657 |
/campusministry/faithtraditions/muslimstudents/ |
| Protestant Students |
200658 |
/campusministry/faithtraditions/protestantstudents/ |
| Additional Faith Orgs |
200679 |
/campusministry/faithtraditions/additionalfaithorgs/ |
| Programs |
26051 |
/campusministry/faithprograms/index.shtml |
| Christian Life Community |
26598 |
/campusministry/faithprograms/clc/index.shtml |
| CLC Leadership and Contact Info |
152141 |
/campusministry/faithprograms/clc/clcleadershipandcontactinfo/ |
| Join a CLC |
28152 |
/campusministry/faithprograms/clc/joinaclc/ |
| Pilgrimages |
61513 |
/campusministry/faithprograms/pilgrimages/ |
| Lourdes Service Immersion |
80658 |
/campusministry/faithprograms/pilgrimages/lourdesserviceimmersion/ |
| Taize Pilgrimage |
80659 |
/campusministry/faithprograms/pilgrimages/taizepilgrimage/ |
| 2017 Taize Pilgrimage |
101517 |
/campusministry/faithprograms/pilgrimages/taizepilgrimage/2017taizepilgrimage/ |
| World Youth Day 2016 |
80345 |
/campusministry/faithprograms/pilgrimages/worldyouthday2016/ |
| World Youth Day |
185002 |
/campusministry/faithprograms/pilgrimages/worldyouthday/ |
| Ignatian Family Teach-In for Justice |
103762 |
/campusministry/faithprograms/ignatianfamilyteach-inforjustice/ |
| Interfaith Programs |
26588 |
/campusministry/faithprograms/interfaith/index.shtml |
| Religious Observances |
64108 |
/campusministry/faithprograms/interfaith/religiousobservances/ |
| Labre Homeless Outreach (WTC) |
116868 |
/campusministry/faithprograms/labrehomelessoutreachwtc/ |
| Justice & Advocacy |
60533 |
/campusministry/faithprograms/justiceadvocacy/ |
| Immigration Reform |
60513 |
/campusministry/faithprograms/justiceadvocacy/immigrationreform/ |
| Prayer for the Care of Creation |
86480 |
/campusministry/faithprograms/justiceadvocacy/prayerforthecareofcreation/ |
| Spiritual Direction |
155145 |
/campusministry/faithprograms/spiritualdirection/ |
| Staying Best Friends |
116866 |
/campusministry/faithprograms/stayingbestfriends/ |
| The Spiritual Exercises |
120929 |
/campusministry/faithprograms/thespiritualexercises/ |
| Grief Support |
191038 |
/campusministry/faithprograms/griefsupport/ |
| THEA Institute |
202721 |
/thea/ |
| Retreats |
26056 |
/campusministry/retreats/ |
| Retreat Offerings |
88279 |
/campusministry/retreats/retreatofferings/ |
| Loyola 360 Retreat |
198862 |
/campusministry/retreats/retreatofferings/loyola360retreat/ |
| Leaf Retreat |
199305 |
/campusministry/retreats/retreatofferings/leafretreat/ |
| Ignite Retreat |
199401 |
/campusministry/retreats/retreatofferings/igniteretreat/ |
| Search Retreat |
199295 |
/campusministry/retreats/retreatofferings/searchretreat/ |
| Review on Retreat |
199301 |
/campusministry/retreats/retreatofferings/reviewonretreat/ |
| Ignatian Silent Retreat |
199302 |
/campusministry/retreats/retreatofferings/ignatiansilentretreat/ |
| Senior Retreat |
199304 |
/campusministry/retreats/retreatofferings/seniorretreat/ |
| Transfer Retreat |
199306 |
/campusministry/retreats/retreatofferings/transferretreat/ |
| Fe, Comunidad y Cultura Retreat |
199294 |
/campusministry/retreats/retreatofferings/fecomunidadyculturaretreat/ |
| HSO Retreat |
199303 |
/campusministry/retreats/retreatofferings/hsoretreat/ |
| MSA Retreats |
198892 |
/campusministry/retreats/retreatofferings/msaretreats/ |
| Encounter! Catholic Retreat |
198863 |
/campusministry/retreats/retreatofferings/encountercatholicretreat/ |
| CCC Retreat |
198865 |
/campusministry/retreats/retreatofferings/cccretreat/ |
| Preached Silent Retreat |
203899 |
/campusministry/retreats/retreatofferings/preachedsilentretreat/ |
| Grief Retreat |
203900 |
/campusministry/retreats/retreatofferings/griefretreat/ |
| Student Testimonies |
147301 |
/campusministry/retreats/studenttestimonies/ |
| Frequently Asked Questions |
15153 |
/campusministry/retreats/faq/ |
| Retreat Financial Aid Application |
88648 |
/campusministry/forms/financialaid/index.shtml |
| Thank You |
88649 |
/campusministry/forms/financialaid/thankyou.shtml |
| Retreats Advent Calendar 2018 |
118173 |
/campusministry/retreats/retreatsadventcalendar2018/ |
| Retreat Leaders |
168766 |
/campusministry/retreats/retreatleaders/ |
| MDS Chapel |
202422 |
/campusministry/mdschapel/ |
| Liturgy Schedule |
202423 |
/campusministry/mdschapel/liturgyschedule/ |
| Holiday Liturgy Schedule |
205514 |
/campusministry/mdschapel/liturgyschedule/holidayliturgyschedule/ |
| Sacraments |
202424 |
/campusministry/mdschapel/sacraments/ |
| Weekly Bulletin - Madonna Times |
202427 |
/campusministry/mdschapel/weeklybulletin-madonnatimes/ |
| Mass Intentions & Remembrance |
202428 |
/campusministry/mdschapel/massintentionsremembrance/ |
| Service Opportunities |
202429 |
/campusministry/mdschapel/serviceopportunities/ |
| Liturgical Ministry |
202666 |
/campusministry/mdschapel/serviceopportunities/liturgicalministry/ |
| Music Ministry |
202667 |
/campusministry/mdschapel/serviceopportunities/musicministry/ |
| Art and Architecture |
202670 |
/campusministry/mdschapel/artandarchitecture/ |
| Chapel Bells |
202722 |
/campusministry/mdschapel/artandarchitecture/chapelbells/ |
| Loyola's Peal of Bells |
202725 |
/campusministry/mdschapel/artandarchitecture/chapelbells/loyolaspealofbells/ |
| Madonna Quarters |
202726 |
/campusministry/mdschapel/artandarchitecture/chapelbells/madonnaquarters/ |
| Bell Schedule and Prayers |
202727 |
/campusministry/mdschapel/artandarchitecture/chapelbells/bellscheduleandprayers/ |
| How a bell is made |
202728 |
/campusministry/mdschapel/artandarchitecture/chapelbells/howabellismade/ |
| interior_left |
202723 |
/campusministry/mdschapel/artandarchitecture/chapelbells/interiorleft/ |
| right_column |
202724 |
/campusministry/mdschapel/artandarchitecture/chapelbells/rightcolumn/ |
| Chapel Mural |
202730 |
/campusministry/mdschapel/artandarchitecture/chapelmural/ |
| interior_left |
202731 |
/campusministry/mdschapel/artandarchitecture/chapelmural/interiorleft/ |
| Chapel Windows |
202733 |
/campusministry/mdschapel/artandarchitecture/chapelwindows/ |
| Chapel Renovation |
202734 |
/campusministry/mdschapel/artandarchitecture/renovation/index.shtml |
| Restored Image of Madonna della Strada |
202735 |
/campusministry/mdschapel/artandarchitecture/restoredimageofmadonnadellastrada/ |
| Chapel History |
204465 |
/campusministry/mdschapel/artandarchitecture/renovation/index.shtml |
| Requests and Reservations |
202671 |
/campusministry/mdschapel/requestsandreservations/ |
| University Bereavement Notices |
202672 |
/campusministry/mdschapel/universitybereavementnotices/ |
| right_column |
202674 |
/campusministry/mdschapel/universitybereavementnotices/rightcolumn/ |
| Notices |
202675 |
/campusministry/mdschapel/universitybereavementnotices/notices/ |
| 2025 |
205842 |
/campusministry/mdschapel/universitybereavementnotices/2025/ |
| Notices |
205843 |
/campusministry/mdschapel/universitybereavementnotices/2025/notices/ |
| 2024 |
202676 |
/campusministry/mdschapel/universitybereavementnotices/2024/ |
| 2023 |
202677 |
/campusministry/mdschapel/universitybereavementnotices/2023/ |
| Notices |
202688 |
/campusministry/mdschapel/universitybereavementnotices/2023/notices/ |
| 2022 |
202678 |
/campusministry/mdschapel/universitybereavementnotices/2022/ |
| 2021 |
202679 |
/campusministry/mdschapel/universitybereavementnotices/2021/ |
| 2020 |
202680 |
/campusministry/mdschapel/universitybereavementnotices/2020/ |
| 2019 |
202681 |
/campusministry/mdschapel/universitybereavementnotices/2019/ |
| 2018 |
202682 |
/campusministry/mdschapel/universitybereavementnotices/2018/ |
| 2017 |
202683 |
/campusministry/mdschapel/universitybereavementnotices/2017/ |
| 2016 |
202684 |
/campusministry/mdschapel/universitybereavementnotices/2016/ |
| Stamm Memorial Organ |
202740 |
/campusministry/mdschapel/organ/ |
| Past Concerts |
202741 |
/campusministry/mdschapel/organ/past-concerts/ |
| Composer Archive |
202742 |
/campusministry/mdschapel/organ/composers/ |
| Internal |
9003 |
/campusministry/mdschapel/internal/index.shtml |
| Calendar of Events |
25926 |
/campusministry/mdschapel/internal/events.shtml |
| Thank You |
9004 |
/campusministry/mdschapel/internal/thankyou/index.shtml |
| Chapel Reservations - Internal Form |
9005 |
/campusministry/mdschapel/internal/mds-internal-usage/index.shtml |
| Campus Plan |
193987 |
/campusplan/ |
| site_logo |
194031 |
/campusplan/sitelogo/ |
| modules-programming |
194034 |
/campusplan/modules-programming/ |
| About |
194037 |
/campusplan/about/ |
| Purpose |
194041 |
/campusplan/about/purpose/ |
| Planning Team |
194042 |
/campusplan/about/planningteam/ |
| FAQS |
194045 |
/campusplan/about/faqs/ |
| Projects |
207007 |
/campusplan/projects/ |
| Classroom Updates |
207012 |
/campusplan/projects/classroomupdates/ |
| Process |
194038 |
/campusplan/process/ |
| Approach |
194043 |
/campusplan/process/approach/ |
| Analysis |
194044 |
/campusplan/process/analysis/ |
| Schedule |
194040 |
/campusplan/schedule/ |
| Community Engagement |
202810 |
/campusplan/communityengagement/ |
| Survey Themes |
204041 |
/campusplan/communityengagementreport/surveythemes/ |
| Neighborhood Events |
204042 |
/campusplan/communityengagementreport/neighborhoodevents/ |
| Development Opportunities |
204043 |
/campusplan/communityengagementreport/developmentopportunities/ |
| Geographic Feedback |
204044 |
/campusplan/communityengagementreport/geographicfeedback/ |
| Survey Results |
204045 |
/campusplan/communityengagementreport/surveyresults/ |
| Survey Comments |
204046 |
/campusplan/communityengagementreport/surveycomments/ |
| Campus Recreation |
183835 |
/campusrec/ |
| site_logo |
183836 |
/campusrec/sitelogo/ |
| cta |
183838 |
/campusrec/cta/ |
| I Links |
183839 |
/campusrec/ilinks/ |
| social media |
183840 |
/campusrec/socialmedia/ |
| modules-programming |
183841 |
/campusrec/modules-programming/ |
| About Us |
191612 |
/campusrec/aboutus/ |
| Contact Us |
191637 |
/campusrec/aboutus/contactus/ |
| Meet the Professional Staff |
184011 |
/campusrec/aboutus/contactus/meettheprofessionalstaff/ |
| News |
184104 |
/campusrec/aboutus/contactus/news/ |
| Policies |
191640 |
/campusrec/aboutus/policies/ |
| Student Employment |
184021 |
/campusrec/aboutus/studentemployment/ |
| Facilities |
191613 |
/campusrec/facilities/ |
| Halas Recreation Center |
191642 |
/campusrec/facilities/halasrecreationcenter/ |
| Halas Hours |
184016 |
/campusrec/facilities/halasrecreationcenter/halashours/ |
| Pool |
191616 |
/campusrec/facilities/halasrecreationcenter/pool/ |
| Rock Wall |
191617 |
/campusrec/facilities/halasrecreationcenter/rockwall/ |
| Courts |
191643 |
/campusrec/facilities/halasrecreationcenter/courts/ |
| Group Fitness Studios |
191644 |
/campusrec/facilities/halasrecreationcenter/groupfitnessstudios/ |
| Cardio Room |
191646 |
/campusrec/facilities/halasrecreationcenter/cardioroom/ |
| Weight Room |
191647 |
/campusrec/facilities/halasrecreationcenter/weightroom/ |
| WTC Fitness Studio |
184061 |
/campusrec/facilities/wtcfitnessstudio/ |
| Sean Earl Field |
191910 |
/campusrec/facilities/seanearlfield/ |
| Hoyne Field |
191911 |
/campusrec/facilities/hoynefield/ |
| Facility Request |
184013 |
/campusrec/facilities/facilityrequest/ |
| Group Fitness |
184033 |
/campusrec/groupfitness/ |
| Fitness Instructor Request |
184037 |
/campusrec/groupfitness/fitnessinstructorrequest/ |
| Sports Programs |
184044 |
/campusrec/sportsprograms/ |
| Intramural Sports Schedule |
184045 |
/campusrec/sportsprograms/intramuralsportsschedule/ |
| Register for Intramural Sports |
184046 |
/campusrec/sportsprograms/registerforintramuralsports/ |
| Club Sport Teams |
184047 |
/campusrec/sportsprograms/clubsportteams/ |
| Club Sports Forms |
184048 |
/campusrec/sportsprograms/clubsportsforms/ |
| Membership |
191614 |
/campusrec/membership/ |
| 1-Day Memberships & Guest Passes |
191621 |
/campusrec/membership/1-daymembershipsguestpasses/ |
| Payroll Deduction |
191622 |
/campusrec/membership/payrolldeduction/ |
| Locker & Towel Service |
191623 |
/campusrec/membership/lockertowelservice/ |
| WTC Fitness Studio Membership |
191683 |
/campusrec/membership/wtcfitnessstudiomembership/ |
| Programs |
191615 |
/campusrec/programs/ |
| Aquatics |
191648 |
/campusrec/programs/aquatics/ |
| Rock Wall |
191649 |
/campusrec/programs/rockwall/ |
| Game Nights & Special Events |
191650 |
/campusrec/programs/gamenightsspecialevents/ |
| Campus Reservations |
29173 |
/campus_reservations/ |
| Important Links |
29215 |
/campus_reservations/importantlinks/ |
| 25Live Pro |
200369 |
/campus_reservations/25livepro/ |
| Room Inventory |
29217 |
/campus_reservations/importantlinks/roominventory/ |
| Lake Shore Campus |
56986 |
/campus_reservations/importantlinks/roominventory/lakeshorecampus/ |
| BVM Hall |
63971 |
/campus_reservations/importantlinks/roominventory/lakeshorecampus/bvmhall/ |
| Coffey Hall |
29401 |
/campus_reservations/coffey.shtml |
| Crown Center |
29399 |
/campus_reservations/crowncenter.shtml |
| Cudahy Science Building |
29402 |
/campus_reservations/cudahyscience.shtml |
| Cuneo Hall |
32664 |
/campus_reservations/importantlinks/roominventory/lakeshorecampus/cuneohall/ |
| Damen Student Center |
56203 |
/campus_reservations/importantlinks/roominventory/lakeshorecampus/damenstudentcenter/ |
| Dumbach Hall |
29412 |
/campus_reservations/dumbach.shtml |
| Flanner Hall |
29403 |
/campus_reservations/flanner.shtml |
| Granada Center |
29414 |
/campus_reservations/granadacenter.shtml |
| Institute of Environmental Sustainability |
62088 |
/campus_reservations/importantlinks/roominventory/lakeshorecampus/instituteofenvironmentalsustainability/ |
| The Information Commons |
29404 |
/campus_reservations/ic.shtml |
| Life Science Building |
29416 |
/campus_reservations/lsb.shtml |
| Mundelein Center |
29405 |
/campus_reservations/mundelein.shtml |
| Regis Hall |
29406 |
/campus_reservations/regis.shtml |
| The Simpson Living and Learning Center |
29419 |
/campus_reservations/simpson.shtml |
| Sullivan Center |
29408 |
/campus_reservations/sullivan.shtml |
| Water Tower Campus |
56987 |
/campus_reservations/importantlinks/roominventory/watertowercampus/ |
| Corboy Law Center |
29420 |
/campus_reservations/corboylawcenter.shtml |
| Lewis Towers |
29421 |
/campus_reservations/lewistowers.shtml |
| Maguire Hall |
29422 |
/campus_reservations/maguire.shtml |
| School of Communication Building |
29423 |
/campus_reservations/soc.shtml |
| Schreiber Center |
95183 |
/campus_reservations/importantlinks/roominventory/watertowercampus/schreibercenter/ |
| Terry Student Center |
29424 |
/campus_reservations/tsc.shtml |
| Browse Rooms by Type |
56988 |
/campus_reservations/importantlinks/roominventory/browseroomsbytype/ |
| Non-Academic Spaces |
29434 |
/campus_reservations/roomrecnonacademic.shtml |
| Large Venues and Halls |
29435 |
/campus_reservations/roomreclarge.shtml |
| Teleconference Rooms |
29436 |
/campus_reservations/roomrecteleconference.shtml |
| Tables |
29437 |
/campus_reservations/roomrectables.shtml |
| Computer Labs |
29439 |
/campus_reservations/roomreccomputerlab.shtml |
| Auditoriums |
29440 |
/campus_reservations/roomrecauditorium.shtml |
| Outdoor Locations |
70345 |
/campus_reservations/importantlinks/roominventory/browseroomsbytype/outdoorlocations/ |
| right_column |
56992 |
/campus_reservations/importantlinks/roominventory/rightcolumn/ |
| Important Dates |
29228 |
/campus_reservations/importantlinks/importantdates/ |
| Contact Us |
29226 |
/campus_reservations/importantlinks/contactus/ |
| Policies and Procedures |
56859 |
/campus_reservations/policiesandprocedures/ |
| Internal Reservation Policies |
94927 |
/campus_reservations/policiesandprocedures/internalreservationpolicies/ |
| Frequently Asked Questions |
94929 |
/campus_reservations/policiesandprocedures/frequentlyaskedquestions/ |
| Alcohol Policy |
61050 |
/campus_reservations/policiesandprocedures/alcoholpolicy/ |
| Alcohol Application |
61051 |
/campus_reservations/policiesandprocedures/alcoholpolicy/alcoholapplication/ |
| Alcohol Use Application Form |
61065 |
/campus_reservations/policiesandprocedures/alcoholpolicy/alcoholapplication/alcoholuseapplicationform/ |
| Thank You |
61079 |
/campus_reservations/policiesandprocedures/alcoholpolicy/alcoholapplication/thankyou/index.shtml |
| Alcohol Permit Process and Sample |
61052 |
/campus_reservations/policiesandprocedures/alcoholpolicy/alcoholpermitprocessandsample/ |
| Space Reservation Alcohol Policy |
62255 |
/campus_reservations/policiesandprocedures/alcoholpolicy/spacereservationalcoholpolicy/ |
| 25Live Pro |
56860 |
/campus_reservations/25livepro/ |
| 25Live Pro Help |
29256 |
/campus_reservations/25livepro/25liveprohelp/ |
| 25Live Pro Training Manuals |
29724 |
/campus_reservations/25livepro/25liveprotrainingmanuals/ |
| 25Live Training Videos |
31214 |
/campus_reservations/25livepro/25livetrainingvideos/ |
| Requesting a Space |
104939 |
/campus_reservations/25livepro/25livetrainingvideos/requestingaspace/ |
| Finding an Available Location |
104940 |
/campus_reservations/25livepro/25livetrainingvideos/findinganavailablelocation/ |
| Viewing Upcoming Events |
104941 |
/campus_reservations/25livepro/25livetrainingvideos/viewingupcomingevents/ |
| Site Maintenance |
94674 |
/campus_reservations/25live/sitemaintenance/index.shtml |
| Reservation Steps |
29178 |
/campus_reservations/reservationsteps/ |
| 1. Make a Request |
200392 |
https://campusres.luc.edu/25live |
| 2. Room SetUp |
29184 |
/campus_reservations/reservationsteps/2roomsetup/ |
| 3. Request AV Equipment |
29182 |
/campus_reservations/reservationsteps/3requestavequipment/ |
| 4. Request Catering |
29180 |
/catering/index.shtml |
| 4. Catering |
29575 |
/campus_reservations/reservationsteps/4catering/ |
| Thank You |
30208 |
/campus_reservations/thankyou.shtml |
| Troubleshooting |
29220 |
/campus_reservations/troubleshooting/ |
| cta |
186038 |
/campus_reservations/cta/ |
| Resources |
29225 |
/campus_reservations/resources/ |
| External Groups |
29227 |
/campus_reservations/resources/externalgroups/ |
| Room Set-up Form |
29544 |
/campus_reservations/roomset-upform/ |
| Footer |
29236 |
/campus_reservations/footer/ |
| DSD Areas |
186448 |
/campus_reservations/dsdareas/ |
| Campus Recreation |
186449 |
/campusrec/ |
| Campus Reservations |
186450 |
/campus_reservations/ |
| Community Coalition on Gender-Based Violence |
186464 |
/coalition/ |
| Conference Services |
186465 |
/conference/index.shtml |
| CTA U-Pass |
186467 |
/upass/ |
| Damen Student Center |
186469 |
/damenstudentcenter/index.shtml |
| Family Weekend |
186472 |
/familyweekend/ |
| Graduate, Professional, and Adult Student Life |
186473 |
/gpasl/ |
| Loyola University Museum of Art |
186475 |
/luma/ |
| Office of Student Conduct and Conflict Resolution |
186476 |
/osccr/ |
| Student Government |
186478 |
/sglc/ |
| Terry Student Center |
186479 |
/tsc/ |
| Wellness Center |
186502 |
/wellness/ |
| Assets |
199283 |
/campus_reservations/assets/ |
| site_logo |
200126 |
/campus_reservations/sitelogo/ |
| modules-programming |
200129 |
/campus_reservations/modules-programming/ |
| News |
200130 |
/campus_reservations/news/ |
| archive |
200131 |
/campus_reservations/news/archive/ |
| Campus Safety |
24261 |
/safety/ |
| site_logo |
24294 |
/safety/sitelogo/ |
| Footer |
24293 |
/safety/footer/ |
| social media |
200107 |
/safety/socialmedia/ |
| modules-programming |
200105 |
/safety/modules-programming/ |
| right_column |
58201 |
/safety/rightcolumn/ |
| About |
24301 |
/safety/about.shtml |
| A Message from the Director |
25119 |
/safety/messagefromthedirector.shtml |
| Message from the President |
25120 |
/safety/message_from_president.html |
| Department's Mission |
25121 |
/safety/dept_mission.shtml |
| Staff Directory |
25124 |
/safety/StaffDir.shtml |
| Tour of Facilities |
25134 |
/safety/tour_of_facilities.html |
| Identifying Campus Safety |
25135 |
/safety/officer_descriptions.html |
| Frequently Asked Questions |
25144 |
/safety/faqs.html |
| About Campus Safety FAQ |
58219 |
/safety/aboutcampussafetyfaq/ |
| Emergencies FAQ |
58220 |
/safety/emergenciesfaq/ |
| Crime Awareness FAQ |
58221 |
/safety/crimeawarenessfaq/ |
| Your Role in Staying Safe FAQ |
58222 |
/safety/yourroleinstayingsafefaq/ |
| Information and Services FAQ |
58223 |
/safety/informationandservicesfaq/ |
| Lost Property FAQ |
58224 |
/safety/lostpropertyfaq/ |
| Employment FAQ |
58225 |
/safety/employmentfaq/ |
| Integrity Cards |
154732 |
/safety/integritycards/ |
| Campus Police Training |
157541 |
/safety/campuspolicetraining/ |
| Contacting Help |
24297 |
/safety/contacting_help.html |
| Blue Light and Emergency Phones |
24307 |
/safety/blue_light_emergency_phones.html |
| Reporting a Crime |
25117 |
/safety/reporting_a_crime.html |
| Signing Complaints/Pressing Charges |
25118 |
/safety/signing_complaints_pressing_charges.html |
| Emergencies |
24298 |
/safety/emergencies-group.html |
| Active Shooter |
25105 |
/safety/active_shooter.html |
| Bomb Threats |
25112 |
/safety/bomb_threats.html |
| Medical Emergencies |
25113 |
/safety/medical_emergencies.html |
| Severe Weather |
25114 |
/safety/weather.html |
| Suspicious Mail and Packages |
25115 |
/safety/suspicious_mail_and_packages.html |
| Emergency Numbers |
58204 |
/safety/emergencies/emergencynumbers/ |
| Classroom Alarm |
85889 |
/safety/emergencies/classroomalarm/ |
| Lockdown Hardware |
104885 |
/safety/emergencies/lockdownhardware/ |
| Loyola Alert: Emergency Notifications |
102413 |
/safety/emergencies/alert/ |
| Sensitive Crimes |
24299 |
/safety/sensitivecrimes.html |
| Sexual Assault |
24929 |
/safety/sexual_assault.html |
| Domestic Violence |
25067 |
/safety/domestic_violence.html |
| Hate Crimes |
25101 |
/safety/hate_crimes.html |
| Stalking |
25102 |
/safety/stalking.html |
| Orders of Protection |
25104 |
/safety/orders_of_protection.html |
| Programs & Resources |
24300 |
/safety/programs_resources.html |
| Access to Facilities |
24894 |
/safety/access_to_facilities.html |
| AED/CPR |
24877 |
/safety/aed_cpr.html |
| Registered Sex Offender Information |
25670 |
/safety/sex_offenders.html |
| BCT |
24873 |
http://www.luc.edu/bct/ |
| Bias Reporting |
24850 |
https://secure.ethicspoint.com/domain/media/en/gui/34712/index.html |
| Bicycle Policy |
24851 |
/safety/BikePolicy.html |
| Bike Registration |
68281 |
/safety/bike-registration.shtml |
| Emergency Response Plan |
24925 |
http://www.luc.edu/erp/ |
| Fake IDs |
24923 |
/safety/fake_ids.html |
| Finger Printing |
24924 |
/safety/finger_printing.html |
| Lost and Found |
24912 |
/safety/lost_and_found.html |
| Off-campus Housing Safety |
25676 |
/safety/off-campus_housing_safety.html |
| Parking and Ticketing |
24922 |
/safety/parking_and_ticketing.html |
| Register Your Bike Today |
25207 |
/safety/registeryourbiketoday/ |
| Staffing Request |
90123 |
/safety/security-officer-request.shtml |
| ULock Program |
24921 |
/safety/ulock_program.html |
| Body Worn Camera |
116872 |
/safety/bodyworncamera/ |
| Crime Awareness |
24302 |
/safety/crime_prevention.html |
| Crime Definitions |
25668 |
/safety/crime_definitions.html |
| Safety Programs |
24809 |
/safety/safety_programs.html |
| Police Log |
24845 |
/safety/police_log.html |
| Clery Act Safety Bulletin |
24854 |
/safety/clery.html |
| Previous Years |
101758 |
/safety/previousyears/ |
| Crime Alerts |
25188 |
/safety/alerts/ |
| 2024 |
190992 |
/safety/alerts/2024/ |
| Crime Alert - January 13, 2024 |
190993 |
/safety/alerts/2024/crimealert-january132024/ |
| Crime Alert - February 2, 2024 |
191408 |
/safety/alerts/2024/crimealert-february22024/ |
| Crime Alert - February 10, 2024 |
191514 |
/safety/alerts/2024/crimealert-february102024/ |
| Crime Alert - February 29, 2024 |
191763 |
/safety/alerts/2024/crimealert-february292024/ |
| Crime Alert - March 21, 2024 |
192234 |
/safety/alerts/2024/crimealert-march212024/ |
| Crime Alert - April 28, 2024 |
194148 |
/safety/alerts/2024/crimealert-april282024/ |
| Crime Alert - June 12, 2024 |
195920 |
/safety/alerts/2024/crimealert-june122024/ |
| Crime Alert - July 18, 2024 |
197038 |
/safety/alerts/2024/crimealert-july182024/ |
| Crime Alert — August 2, 2024 |
198443 |
/safety/alerts/2024/crimealertaugust22024/ |
| 2023 |
184375 |
/safety/alerts/2023/ |
| Crime Alert - January 14, 2023 |
182374 |
/safety/alerts/2023/crimealert-january142023/ |
| Crime Alert - February 26, 2023 |
184376 |
/safety/alerts/2023/crimealert-february262023/ |
| Crime Alert - March 10, 2023 |
184690 |
/safety/alerts/2023/crimealert-march102023/ |
| Crime Alert - March 18, 2023 |
184802 |
/safety/alerts/2023/crimealert-march182023/ |
| Crime Alert - March 29, 2023 |
184985 |
/safety/alerts/2023/crimealert-march292023/ |
| Crime Alert - September 21, 2023 |
188638 |
/safety/alerts/2023/crimealert-september212023/ |
| Crime Alert - September 23, 2023 |
188660 |
/safety/alerts/2023/crimealert-september232023/ |
| Crime Alert - September 25, 2023 |
188777 |
/safety/alerts/2023/crimealert-september252023/ |
| Crime Alert - October 20, 2023 |
189482 |
/safety/alerts/2023/crimealert-october202023/ |
| Crime Alert - October 27, 2023 |
189663 |
/safety/alerts/2023/crimealert-october272023/ |
| Crime Alert - November 4, 2023 |
189805 |
/safety/alerts/2023/crimealert-november42023/ |
| 2022 |
168417 |
/safety/alerts/2022/ |
| Crime Alert - February 18, 2022 |
168418 |
/safety/alerts/2022/crimealert-february182022/ |
| Crime Alert - February 23, 2022 |
168419 |
/safety/alerts/2022/crimealert-february232022/ |
| Crime Alert - May 20, 2022 |
177951 |
/safety/alerts/2022/crimealert-may202022/ |
| Crime Alert - May 25, 2022 |
178052 |
/safety/alerts/2022/crimealert-may252022/ |
| Crime Alert - May 29, 2022 |
178105 |
/safety/alerts/2022/crimealert-may292022/ |
| Crime Alert - November 19, 2022 |
181890 |
/safety/alerts/2022/crimealert-november192022/ |
| Crime Alert - November 28, 2022 |
182019 |
/safety/alerts/2022/crimealert-november282022/ |
| Crime Alert - December 5, 2022 |
182114 |
/safety/alerts/2022/crimealert-december52022/ |
| 2021 |
157770 |
/safety/alerts/2021/ |
| Crime Alert - January 15, 2021 |
157771 |
/safety/alerts/2021/crimealert-january152021/ |
| Crime Alert - January 16, 2021 |
157780 |
/safety/alerts/2021/crimealert-january162021/ |
| Crime Alert - May 6, 2021 |
160363 |
/safety/alerts/2021/crimealert-may62021/ |
| Crime Alert - August 16, 2021 |
162940 |
/safety/alerts/2021/crimealert-august162021/ |
| Crime Alert - August 20, 2021 |
163094 |
/safety/alerts/2021/crimealert-august202021/ |
| Crime Alert - December 6, 2021 |
167200 |
/safety/alerts/2021/crimealert-december62021/ |
| Crime Alert - December 13, 2021 |
167462 |
/safety/alerts/2021/crimealert-december132021/ |
| Statement Regarding the Chicago Police Department |
154227 |
/safety/alerts/statementregardingthechicagopolicedepartment/ |
| 2019 |
119827 |
/safety/alerts/2019/ |
| Anticipating This Week's Subzero Temperatures |
119828 |
/safety/alerts/2019/anticipatingthisweekssubzerotemperatures/ |
| Class Cancellation Information |
119832 |
/safety/alerts/2019/classcancellationinformation/ |
| Class Cancellation Extended |
119868 |
/safety/alerts/2019/classcancellationextended/ |
| Severe Weather Update |
119869 |
/safety/alerts/2019/severeweatherupdate/ |
| Crime Alert - Attempted Strong-Armed Robbery at the Water Tower Campus |
120497 |
/safety/alerts/2019/crimealert-attemptedstrong-armedrobberyatthewatertowercampus/ |
| Crime Alert - Battery in Damen Student Center |
120529 |
/safety/alerts/2019/crimealert-batteryindamenstudentcenter/ |
| Crime Alert - Robbery at the Lake Shore Campus |
120920 |
/safety/alerts/2019/crimealert-robberyatthelakeshorecampus/ |
| Crime Alert - Threatening Harassment Messages |
121545 |
/safety/alerts/2019/crimealert-threateningharassmentmessages/ |
| Community Alert Issued by Chicago Police Department |
123457 |
/safety/alerts/2019/communityalertissuedbychicagopolicedepartment/ |
| Crime Alert - Attempted Robbery at 6255 North Kenmore Avenue |
125764 |
/safety/alerts/2019/crimealert-attemptedrobberyat6255northkenmoreavenue/ |
| 2018 |
107602 |
/safety/alerts/2018/ |
| The University Will Remain Open Today |
107603 |
/safety/alerts/2018/theuniversitywillremainopentoday/ |
| Crime Alert - Shots Fired at 835 N. Michigan Ave. |
108076 |
/safety/alerts/2018/crimealert-shotsfiredat835nmichiganave/ |
| Crime Alert - Strong-Arm Robbery near Rosemont and Winthrop |
108884 |
/safety/alerts/2018/crimealert-strong-armrobberynearrosemontandwinthrop/ |
| Crime Alert - Police Activity at 6815 N. Sheridan Road |
108913 |
/safety/alerts/2018/crimealert-policeactivityat6815nsheridanroad/ |
| Crime Alert - Armed Robbery near Lakewood and Arthur |
109634 |
/safety/alerts/2018/crimealert-armedrobberynearlakewoodandarthur/ |
| Crime Alert - Aggravated Robbery near 6445 North Lakewood Avenue |
110230 |
/safety/alerts/2018/crimealert-aggravatedrobberynear6445northlakewoodavenue/ |
| Crime Alert - Vehicular Hijacking near Rosemont and Sheridan |
111094 |
/safety/alerts/2018/crimealert-vehicularhijackingnearrosemontandsheridan/ |
| Crime Alert - Aggravated Robbery near Pearson and Wabash |
112499 |
/safety/alerts/2018/crimealert-aggravatedrobberynearpearsonandwabash/ |
| Crime Alert – Aggravated Batteries Near Albion and Winthrop |
113675 |
/safety/alerts/2018/crimealertaggravatedbatteriesnearalbionandwinthrop/ |
| Crime Alert: Armed Robbery Near the 1200 Block of West Albion |
116962 |
/safety/alerts/2018/crimealertarmedrobberynearthe1200blockofwestalbion/ |
| Crime Alert - Attempted Armed Robbery Near Fairfield Hall |
117101 |
/safety/alerts/2018/crimealert-attemptedarmedrobberynearfairfieldhall/ |
| Update on Recent Rogers Park Homicides |
117174 |
/safety/alerts/2018/updateonrecentrogersparkhomicides/ |
| Campus Safety Update |
117196 |
/safety/alerts/2018/campussafetyupdate/ |
| Campus Safety Update 10-11 |
117322 |
/safety/alerts/2018/campussafetyupdate10-11/ |
| Campus Safety Update - Remain Vigilant |
117505 |
/safety/alerts/2018/campussafetyupdate-remainvigilant/ |
| Robbery Near the 1200 Block of West North Shore |
117722 |
/safety/alerts/2018/robberynearthe1200blockofwestnorthshore/ |
| Crime Alert - Burglary in Mertz Hall |
117916 |
/safety/alerts/2018/crimealert-burglaryinmertzhall/ |
| 2017 |
100644 |
/safety/alerts/2017/ |
| Crime Alert - Hate-Speech Graffiti in Spring Hill Hall |
100645 |
/safety/alerts/2017/crimealert-hate-speechgraffitiinspringhillhall/ |
| Crime Alert - Attempted Armed Robbery at the Water Tower Campus |
100978 |
/safety/alerts/2017/crimealert-attemptedarmedrobberyatthewatertowercampus/ |
| Crime Alert - Shots Fired Near 6332 N. Broadway |
101251 |
/safety/alerts/2017/crimealert-shotsfirednear6332nbroadway/ |
| Crime Alert - Strong-Arm Robbery at the Lake Shore Campus |
102267 |
/safety/alerts/2017/crimealert-strong-armrobberyatthelakeshorecampus/ |
| Crime Alert - Strong-Arm Robbery at the Water Tower Campus |
102366 |
/safety/alerts/2017/crimealert-strong-armrobberyatthewatertowercampus/ |
| New Emergency System in Place |
105110 |
/safety/alerts/2017/newemergencysysteminplace/ |
| Community Meeting October 16 |
105847 |
/safety/alerts/2017/communitymeetingoctober16/ |
| Crime Alert - Aggravated Assault near the Lake Shore Campus |
105897 |
/safety/alerts/2017/crimealert-aggravatedassaultnearthelakeshorecampus/ |
| Crime Alert - Armed Robbery near the Lake Shore Campus |
105999 |
/safety/alerts/2017/crimealert-armedrobberynearthelakeshorecampus/ |
| Crime Alert - Aggravated Battery near the Lake Shore Campus |
106079 |
/safety/alerts/2017/crimealert-aggravatedbatterynearthelakeshorecampus/ |
| Crime Alert - Battery near the Quinlan Life Sciences Center |
106198 |
/safety/alerts/2017/crimealert-batterynearthequinlanlifesciencescenter/ |
| Crime Alert - Criminal Sexual Abuse near 6401 N. Sheridan Road |
106230 |
/safety/alerts/2017/crimealert-criminalsexualabusenear6401nsheridanroad/ |
| Loyola Alert Test |
106265 |
/safety/alerts/2017/loyolaalerttest/ |
| Crime Alert - Simple Batteries near Winthrop and Granville |
106602 |
/safety/alerts/2017/crimealert-simplebatteriesnearwinthropandgranville/ |
| 2016 |
89984 |
/safety/alerts/2016/ |
| Crime Alert - Shots Fired Near 6701 N. Clark |
89985 |
/safety/alerts/2016/crimealert-shotsfirednear6701nclark/ |
| Crime Alert - Two Incidents Reported in Rogers Park |
91890 |
/safety/alerts/2016/crimealert-twoincidentsreportedinrogerspark/ |
| Crime Alert - Attempted Armed Robbery at 1331 W. Loyola Avenue |
92150 |
/safety/alerts/2016/crimealert-attemptedarmedrobberyat1331wloyolaavenue/ |
| Update - Police Activity at Sheridan Road and Loyola Avenue |
93424 |
/safety/alerts/2016/update-policeactivityatsheridanroadandloyolaavenue/ |
| Crime Alert - Armed Robbery in 1300 Block of W. North Shore Ave. |
93485 |
/safety/alerts/2016/crimealert-armedrobberyin1300blockofwnorthshoreave/ |
| Community Alert Issued by Chicago Police Department |
93875 |
/safety/alerts/2016/communityalertissuedbychicagopolicedepartment/ |
| Crime Alert - Attempted Armed Robbery at 6944 N. Wayne Avenue |
94066 |
/safety/alerts/2016/crimealert-attemptedarmedrobberyat6944nwayneavenue/ |
| Lockdown at the Health Sciences Campus |
94633 |
/safety/alerts/2016/lockdownatthehealthsciencescampus/ |
| Lockdown Lifted at the Health Sciences Campus |
94636 |
/safety/alerts/2016/lockdownliftedatthehealthsciencescampus/ |
| Crime Alert - Recent Criminal Sexual Abuse Reported |
95168 |
/safety/alerts/2016/crimealert-recentcriminalsexualabusereported/ |
| Crime Alert - Armed Robbery Near Magnolia and Arthur |
95343 |
/safety/alerts/2016/crimealert-armedrobberynearmagnoliaandarthur/ |
| Crime Alert - Homicide Near Devon and Hoyne |
95914 |
/safety/alerts/2016/crimealert-homicideneardevonandhoyne/ |
| Crime Alert - Burglary Reported in Lewis Towers |
97589 |
/safety/alerts/2016/crimealert-burglaryreportedinlewistowers/ |
| Crime Alert - Criminal Sexual Abuse Reported Near 6333 N. Winthrop Ave. |
97593 |
/safety/alerts/2016/crimealert-criminalsexualabusereportednear6333nwinthropave/ |
| Crime Alert - Strong-Armed Robbery in 1300 Block of West Hood Street |
97704 |
/safety/alerts/2016/crimealert-strong-armedrobberyin1300blockofwesthoodstreet/ |
| Crime Alert - Criminal Sexual Abuse Reported Near 6313 N. Winthrop Avenue |
97728 |
/safety/alerts/2016/crimealert-criminalsexualabusereportednear6313nwinthropavenue/ |
| Update on Recent Sexual Abuse Reports |
97823 |
/safety/alerts/2016/updateonrecentsexualabusereports/ |
| Arrest of Individuals Harassing Students |
98358 |
/safety/alerts/2016/arrestofindividualsharassingstudents/ |
| Crime Alert - Battery Reported in 1100 Block of West Albion Avenue |
98897 |
/safety/alerts/2016/crimealert-batteryreportedin1100blockofwestalbionavenue/ |
| Crime Alert - Strong-Armed Robbery at the Water Tower Campus |
99000 |
/safety/alerts/2016/crimealert-strong-armedrobberyatthewatertowercampus/ |
| Update on Friday's Strong-Armed Robbery Report at the Water Tower Campus |
99065 |
/safety/alerts/2016/updateonfridaysstrong-armedrobberyreportatthewatertowercampus/ |
| Community Care Notices |
161376 |
/safety/communitycarenotices/ |
| Chicago CLEARMap |
161381 |
/safety/chicagoclearmap/ |
| Safety Tips |
24303 |
/safety/safety_tips.html |
| Fire Safety |
24308 |
/safety/firesafety.html |
| Apartment/Home Security |
24309 |
/safety/apartment_home_security.html |
| Residence Hall Tips |
24321 |
/safety/residence_halls.html |
| Street Tips |
24322 |
/safety/street_tips.html |
| Theft Prevention |
24323 |
/safety/theft_prevention.html |
| Internet Tips |
24744 |
/safety/internet_tips.html |
| Obscene Phone Calls |
24745 |
/safety/obscene_phone_calls.html |
| Date Rape Drugs |
24746 |
/safety/date_rape_drugs.html |
| Bicycle Safety Tips |
24747 |
/safety/bicycle_safety_tips.html |
| Parking Safety Tips |
24749 |
/safety/parking_safety_tips.html |
| Public Transportation Tips |
24750 |
/safety/public_transportation_tips.html |
| Warm Weather Tips |
24751 |
/safety/warm_weather_tips.html |
| Forms |
24304 |
/safety/forms.html |
| Feedback Form |
25665 |
/safety/feedback_form.html |
| Maps |
25136 |
/safety/maps.html |
| Campus Maps |
25138 |
http://www.luc.edu/visit.shtml |
| Jurisdiction Maps |
25141 |
/safety/jurisdiction_maps.html |
| Loyola Bike Registration and Usage of the Bike Corral |
65315 |
/safety/bikeregistration/index.shtml |
| Loyola Bike Registration and Usage of the Bike Corral |
66726 |
/safety/bikeregistration/form.shtml |
| News |
24289 |
/safety/news/ |
| Campus Transportation |
48862 |
/campustransportation/ |
| General Information |
48883 |
/campustransportation/generalinformation/ |
| Lake Shore Campus |
49040 |
/campustransportation/generalinformation/lakeshorecampus/ |
| right_column |
51917 |
/campustransportation/generalinformation/lakeshorecampus/rightcolumn/ |
| Water Tower Campus |
49041 |
/campustransportation/generalinformation/watertowercampus/ |
| One West Superior |
49160 |
/campustransportation/generalinformation/watertowercampus/onewestsuperior/ |
| Standard Parking Fordham Garage |
49174 |
/campustransportation/generalinformation/watertowercampus/standardparkingfordhamgarage/ |
| 900 N. Michigan Self-Park |
49177 |
/campustransportation/generalinformation/watertowercampus/900nmichiganself-park/ |
| 100 W. Chestnut Garage |
49178 |
/campustransportation/generalinformation/watertowercampus/100wchestnutgarage/ |
| right_column |
49159 |
/campustransportation/generalinformation/watertowercampus/rightcolumn/ |
| Health Sciences Campus |
60003 |
/campustransportation/generalinformation/healthsciencescampus/ |
| right_column |
60004 |
/campustransportation/generalinformation/healthsciencescampus/rightcolumn/ |
| Visitors and Guests |
49042 |
/campustransportation/generalinformation/visitorsandguests/ |
| Alternative Transportation |
49043 |
/campustransportation/generalinformation/alternativetransportation/ |
| Walk |
51832 |
/campustransportation/generalinformation/alternativetransportation/walk/ |
| Public Transit |
51833 |
/campustransportation/generalinformation/alternativetransportation/publictransit/ |
| Shuttle Bus Service |
51834 |
/campustransportation/generalinformation/alternativetransportation/shuttlebusservice/ |
| 8-Ride |
51835 |
/campustransportation/generalinformation/alternativetransportation/8-ride/ |
| Bike |
63146 |
/campustransportation/generalinformation/alternativetransportation/bike/ |
| right_column |
51918 |
/campustransportation/generalinformation/rightcolumn/ |
| Loyola Lots and Garages |
51923 |
/campustransportation/generalinformation/loyolalotsandgarages/ |
| Appeals Board |
118651 |
/campustransportation/generalinformation/appealsboard/ |
| Permits |
48884 |
/campustransportation/permits/ |
| Commuter Students |
49044 |
/campustransportation/permits/commuterstudents/ |
| Resident Students |
49045 |
/campustransportation/permits/residentstudents/ |
| LSC Employees |
49046 |
/campustransportation/permits/lscemployees/ |
| WTC Employees |
49047 |
/campustransportation/permits/wtcemployees/ |
| Faculty-Staff Permits |
122854 |
/campustransportation/permits/faculty-staffpermits/ |
| Services |
48885 |
/campustransportation/services/ |
| 8-RIDE Program |
49048 |
/campustransportation/services/8-rideprogram/ |
| Mobile-Test |
59663 |
/campustransportation/services/8-rideprogram/mobile-test/ |
| Intercampus Shuttle |
49049 |
/campustransportation/services/intercampusshuttle/ |
| Tracking and Alerts |
69797 |
/campustransportation/services/intercampusshuttle/trackingandalerts/ |
| Intercampus Shuttle Ads |
89805 |
/campustransportation/services/intercampusshuttle/intercampusshuttleads/ |
| Vehicle Rental |
49050 |
/campustransportation/services/vehiclerental/ |
| Van Rental |
51864 |
/campustransportation/services/vehiclerental/vanrental/ |
| Charter Bus Rental |
51865 |
/campustransportation/services/vehiclerental/charterbusrental/ |
| Pick Up/Drop Off |
51913 |
/campustransportation/services/vehiclerental/pickupdropoff/ |
| Defensive Driving Course Sign-Up |
49051 |
/campustransportation/services/defensivedrivingcoursesign-up/ |
| Motor Vehicle Record Check |
122663 |
/campustransportation/services/motorvehiclerecordcheck/ |
| Request Validations |
85439 |
/campustransportation/services/requestvalidations/ |
| Resources |
48886 |
/campustransportation/resources/ |
| Contact Us |
49052 |
/campustransportation/resources/contactus/ |
| Maps |
49053 |
/campustransportation/resources/maps/ |
| Safety Tips |
49055 |
/campustransportation/resources/safetytips/ |
| Helpful Links |
49056 |
/campustransportation/resources/helpfullinks/ |
| Forms |
49059 |
/campustransportation/forms/index.shtml |
| Feedback Form |
31894 |
/campustransportation/forms/feedback.shtml |
| Thank You |
52479 |
/campustransportation/forms/thankyou.shtml |
| Validation Request Form |
31907 |
/campustransportation/forms/validationreq-lsc.shtml |
| Vehicle Rental Request |
28744 |
/campustransportation/forms/vehiclerentalrequest.shtml |
| Policies |
48887 |
/campustransportation/policies/ |
| Vehicle and Traffic Regulations |
51922 |
/campustransportation/policies/vehicleandtrafficregulations/ |
| Accidents and Breakdowns |
49058 |
/campustransportation/policies/accidentsandbreakdowns/ |
| Refund Policy |
57354 |
/campustransportation/policies/refundpolicy/ |
| Tickets |
59909 |
/campustransportation/tickets/ |
| Violations and Fees |
120305 |
/campustransportation/tickets/violationsandfees/ |
| Ticket Payments |
120306 |
/campustransportation/tickets/ticketpayments/ |
| Ticket Appeals |
120310 |
/campustransportation/tickets/ticketappeals/ |
| site_logo |
48868 |
/campustransportation/sitelogo/ |
| Footer |
48867 |
/campustransportation/footer/ |
| ANNOUNCEMENT |
116102 |
/campustransportation/announcement/ |
| social media |
202980 |
/campustransportation/socialmedia/ |
| cta |
202981 |
/campustransportation/cta/ |
| modules-programming |
202982 |
/campustransportation/modules-programming/ |
| Career Services |
189324 |
/career/ |
| site_logo |
189334 |
/career/sitelogo/ |
| Footer |
189335 |
/career/footer/ |
| cta |
189336 |
/career/cta/ |
| I Links |
189337 |
/career/ilinks/ |
| social media |
189338 |
/career/socialmedia/ |
| modules-programming |
189340 |
/career/modules-programming/ |
| About |
189374 |
/career/about/ |
| Contact Us |
189380 |
/career/about/contactus/ |
| Staff Directory |
189381 |
/career/about/staffdirectory/ |
| Profiles |
191653 |
/career/about/staffdirectory/profiles/ |
| right_column |
202698 |
/career/about/staffdirectory/profiles/rightcolumn/ |
| Handshake |
189375 |
/career/about/handshake/ |
| Login to Handshake |
189440 |
https://luc.joinhandshake.com/edu |
| Career Outcomes |
189378 |
/career/about/careeroutcomes/ |
| Pre-Professional |
202641 |
/career/pre-professional/ |
| Pre-Law Programs |
202643 |
/career/pre-professional/pre-lawprograms/ |
| About |
202655 |
/career/pre-professional/pre-lawprograms/ |
| Pre-Law FAQs |
160746 |
/career/pre-professional/pre-lawprograms/pre-lawfaqs/ |
| Accelerated Admission Program |
70420 |
/career/pre-professional/pre-lawprograms/acceleratedadmissionprogram/ |
| Admission to the Program |
70421 |
/career/pre-professional/pre-lawprograms/acceleratedadmissionprogram/admissiontotheprogram/ |
| Eligibility Requirements |
70422 |
/career/pre-professional/pre-lawprograms/acceleratedadmissionprogram/eligibilityrequirements/ |
| When to Apply |
70423 |
/career/pre-professional/pre-lawprograms/acceleratedadmissionprogram/whentoapply/ |
| Preparation for Accelerated Admission |
70424 |
/career/pre-professional/pre-lawprograms/acceleratedadmissionprogram/preparationforacceleratedadmission/ |
| Pre-Health Programs |
202644 |
/career/pre-professional/pre-healthprograms/ |
| About |
202645 |
/career/pre-professional/pre-healthprograms/ |
| Contact/Visit Us |
66395 |
/career/pre-professional/pre-healthprograms/contactvisitus/ |
| Meet with an Advisor |
150052 |
/career/pre-professional/pre-healthprograms/meetwithanadvisor/ |
| Frequently Asked Questions |
66502 |
/career/pre-professional/pre-healthprograms/frequentlyaskedquestions/ |
| Programming |
202646 |
/career/pre-professional/pre-healthprograms/programming/ |
| Dual Acceptance Program (DAP) |
149983 |
/career/pre-professional/pre-healthprograms/programming/dualacceptanceprogramdap/ |
| Early Assurance Program (EAP) |
149982 |
/career/pre-professional/pre-healthprograms/programming/earlyassuranceprogrameap/ |
| Pre-Health Professions Advisory Committee (PHPAC) |
149985 |
/career/pre-professional/pre-healthprograms/programming/pre-healthprofessionsadvisorycommitteephpac/ |
| Frequently Asked Questions |
150012 |
/career/pre-professional/pre-healthprograms/programming/pre-healthprofessionsadvisorycommitteephpac/frequentlyaskedquestions/ |
| PHPAC Acceptance Rates |
204489 |
/career/pre-professional/pre-healthprograms/programming/pre-healthprofessionsadvisorycommitteephpac/phpacacceptancerates/ |
| Post-Baccalaureate Program |
150001 |
/career/pre-professional/pre-healthprograms/programming/post-baccalaureateprogram/ |
| Admissions Process |
150003 |
/career/pre-professional/pre-healthprograms/programming/post-baccalaureateprogram/admissionsprocess/ |
| Typical Minimum Course Requirements |
150006 |
/career/pre-professional/pre-healthprograms/programming/post-baccalaureateprogram/typicalminimumcourserequirements/ |
| Financial Aid |
150004 |
/career/pre-professional/pre-healthprograms/programming/post-baccalaureateprogram/financialaid/ |
| Note for International Students |
150002 |
/career/pre-professional/pre-healthprograms/programming/post-baccalaureateprogram/noteforinternationalstudents/ |
| Frequently Asked Questions |
203906 |
/career/pre-professional/pre-healthprograms/programming/post-baccalaureateprogram/frequentlyaskedquestions/ |
| First-Year Pre-Medicine Orientations |
204318 |
/career/pre-professional/pre-healthprograms/programming/first-yearpre-medicineorientations/ |
| Health Professions |
202647 |
/career/pre-professional/pre-healthprograms/healthprofessions/ |
| MD/DO |
202648 |
/career/pre-professional/pre-healthprograms/healthprofessions/mddo/ |
| MCAT |
42581 |
/career/pre-professional/pre-healthprograms/healthprofessions/mddo/mcat/ |
| Timelines |
179751 |
/career/pre-professional/pre-healthprograms/healthprofessions/mddo/timelines/ |
| Commonly Required Courses |
179756 |
/career/pre-professional/pre-healthprograms/healthprofessions/mddo/commonlyrequiredcourses/ |
| International Applicants |
181754 |
/career/pre-professional/pre-healthprograms/healthprofessions/mddo/internationalapplicants/ |
| Dentistry |
202649 |
/career/pre-professional/pre-healthprograms/healthprofessions/dentistry/ |
| Commonly Required Courses |
66505 |
/career/pre-professional/pre-healthprograms/healthprofessions/dental/commonlyrequiredcourses/ |
| Timelines |
179770 |
/career/pre-professional/pre-healthprograms/healthprofessions/dental/timelines/ |
| Pharmacy |
66445 |
/career/pre-professional/pre-healthprograms/healthprofessions/pharmacy/ |
| right_column |
66507 |
/career/pre-professional/pre-healthprograms/healthprofessions/pharmacy/rightcolumn/ |
| Dual Acceptance Program (DAP) |
66458 |
/career/pre-professional/pre-healthprograms/healthprofessions/pharmacy/dualacceptanceprogramdap/ |
| Commonly Required Courses |
66504 |
/career/pre-professional/pre-healthprograms/healthprofessions/pharmacy/commonlyrequiredcourses/ |
| Timeline |
179772 |
/career/pre-professional/pre-healthprograms/healthprofessions/pharmacy/timeline/ |
| PCAT |
179773 |
/career/pre-professional/pre-healthprograms/healthprofessions/pharmacy/pcat/ |
| Physician Assistant (PA) |
202650 |
/career/pre-professional/pre-healthprograms/healthprofessions/physicianassistantpa/ |
| Commonly Required Courses |
66508 |
/career/pre-professional/pre-healthprograms/healthprofessions/physicianassistantpa/commonlyrequiredcourses/ |
| Timelines |
66655 |
/career/pre-professional/pre-healthprograms/healthprofessions/physicianassistantpa/timelines/ |
| Admissions Tests |
179805 |
/career/pre-professional/pre-healthprograms/healthprofessions/physicianassistantpa/admissionstests/ |
| Physical Therapy (PT) |
66447 |
/career/pre-professional/pre-healthprograms/healthprofessions/physicaltherapypt/ |
| right_column |
66510 |
/career/pre-professional/pre-healthprograms/healthprofessions/physicaltherapypt/rightcolumn/ |
| Commonly Required Courses |
66511 |
/career/pre-professional/pre-healthprograms/healthprofessions/physicaltherapypt/commonlyrequiredcourses/ |
| Timeline |
179787 |
/career/pre-professional/pre-healthprograms/healthprofessions/physicaltherapypt/timeline/ |
| GRE |
179788 |
/career/pre-professional/pre-healthprograms/healthprofessions/physicaltherapypt/gre/ |
| Occupational Therapy (OT) |
66448 |
/career/pre-professional/pre-healthprograms/healthprofessions/occupationaltherapyot/ |
| right_column |
66512 |
/career/pre-professional/pre-healthprograms/healthprofessions/occupationaltherapyot/rightcolumn/ |
| Commonly Required Courses |
66513 |
/career/pre-professional/pre-healthprograms/healthprofessions/occupationaltherapyot/commonlyrequiredcourses/ |
| Timeline |
179792 |
/career/pre-professional/pre-healthprograms/healthprofessions/occupationaltherapyot/timeline/ |
| GRE |
179794 |
/career/pre-professional/pre-healthprograms/healthprofessions/occupationaltherapyot/gre/ |
| Optometry |
66449 |
/career/pre-professional/pre-healthprograms/healthprofessions/optometry/ |
| right_column |
66514 |
/career/pre-professional/pre-healthprograms/healthprofessions/optometry/rightcolumn/ |
| Commonly Required Courses |
66515 |
/career/pre-professional/pre-healthprograms/healthprofessions/optometry/commonlyrequiredcourses/ |
| Timeline |
179796 |
/career/pre-professional/pre-healthprograms/healthprofessions/optometry/timeline/ |
| OAT |
179797 |
/career/pre-professional/pre-healthprograms/healthprofessions/optometry/oat/ |
| Podiatry |
202653 |
/career/pre-professional/pre-healthprograms/healthprofessions/podiatry/ |
| Commonly Required Courses |
66517 |
/career/pre-professional/pre-healthprograms/healthprofessions/podiatry/commonlyrequiredcourses/ |
| Timeline |
179798 |
/career/pre-professional/pre-healthprograms/healthprofessions/podiatry/timeline/ |
| MCAT |
179799 |
/career/pre-professional/pre-healthprograms/healthprofessions/podiatry/mcat/ |
| Veterinary |
66451 |
/career/pre-professional/pre-healthprograms/healthprofessions/veterinary/ |
| right_column |
66518 |
/career/pre-professional/pre-healthprograms/healthprofessions/veterinary/rightcolumn/ |
| Commonly Required Courses |
66519 |
/career/pre-professional/pre-healthprograms/healthprofessions/veterinary/commonlyrequiredcourses/ |
| Timeline |
179803 |
/career/pre-professional/pre-healthprograms/healthprofessions/veterinary/timeline/ |
| Admissions Tests |
179804 |
/career/pre-professional/pre-healthprograms/healthprofessions/veterinary/admissionstests/ |
| Gaining Gap Year & Summer Experience |
202654 |
/career/pre-professional/pre-healthprograms/gaininggapyearsummerexperience/ |
| Clinical Experience |
89566 |
/career/pre-professional/pre-healthprograms/gaininggapyearsummeropportunities/clinicalexperience/ |
| Research Experience |
66407 |
/career/pre-professional/pre-healthprograms/gaininggapyearsummeropportunities/researchexperience/ |
| Non-Clinical Service Experience |
66411 |
/career/pre-professional/pre-healthprograms/gaininggapyearsummeropportunities/non-clinicalserviceexperience/ |
| Services |
189376 |
/career/services/ |
| Career Advising |
189388 |
/career/services/careeradvising/ |
| Pre-professional Program Services |
202661 |
/career/pre-professional/ |
| Fairs and Events |
189391 |
/career/services/fairsandevents/ |
| Upcoming Career Fairs |
192225 |
/career/services/fairsandevents/upcomingcareerfairs/ |
| Student Employment and Work-Study |
189425 |
/career/services/studentemploymentandwork-study/ |
| Veterans |
191627 |
/career/services/veterans/ |
| Exploration |
191286 |
/career/exploration/ |
| Career Exploration |
189390 |
/career/exploration/careerexploration/ |
| Career Communities |
194235 |
/career/exploration/careercommunities/ |
| Allied Health Career Community Profile |
197962 |
/career/exploration/careercommunities/alliedhealthcareercommunityprofile/ |
| Arts, Culture & Media Career Community Profile |
198001 |
/career/exploration/careercommunities/artsculturemediacareercommunityprofile/ |
| Consulting, HR and Supply Chain Career Community Profile |
198056 |
/career/exploration/careercommunities/consultinghrandsupplychaincareercommunityprofile/ |
| Finance & Accounting Career Community Profile |
198131 |
/career/exploration/careercommunities/financeaccountingcareercommunityprofile/ |
| Marketing, Advertising & Public Relations Career Community Profile |
198136 |
/career/exploration/careercommunities/marketingadvertisingpublicrelationscareercommunityprofile/ |
| Law, Policy & Government Career Community Profile |
198137 |
/career/exploration/careercommunities/lawpolicygovernmentcareercommunityprofile/ |
| Natural Science, Research, and Sustainability Career Community Profile |
198138 |
/career/exploration/careercommunities/naturalscienceresearchandsustainabilitycareercommunityprofile/ |
| Nursing Career Community Profile |
198139 |
/career/exploration/careercommunities/nursingcareercommunityprofile/ |
| Social Services, Education, and Nonprofit Career Community |
198140 |
/career/exploration/careercommunities/socialserviceseducationandnonprofitcareercommunity/ |
| Technology, Information Systems & Data Science Career Community |
198141 |
/career/exploration/careercommunities/technologyinformationsystemsdatasciencecareercommunity/ |
| Pre-Medicine Career Community |
198153 |
/career/exploration/careercommunities/pre-medicinecareercommunity/ |
| Graduate (Master's) Career Community |
198154 |
/career/exploration/careercommunities/graduatemasterscareercommunity/ |
| Quinlan MBA and MS Career Community |
198157 |
/career/exploration/careercommunities/quinlanmbaandmscareercommunity/ |
| Doctoral Career Community |
198904 |
/career/exploration/careercommunities/doctoralcareercommunity/ |
| Career and Identity |
190412 |
/career/exploration/careerandidentity/ |
| Programs and Classes |
189420 |
/career/exploration/programsandclasses/ |
| Exploring and Planning Intentionally for Career + Life (Univ 102 Epic Life) |
189422 |
/career/exploration/programsandclasses/exploringandplanningintentionallyforcareerlifeuniv102epiclife/ |
| Career & Life Planning Seminar (UNIV 224) |
191406 |
/career/exploration/programsandclasses/careerlifeplanningseminaruniv224/ |
| Gap Year |
191309 |
/career/exploration/consideringgraduateeducation/gapyear/ |
| Considering Graduate Education |
189397 |
/career/exploration/consideringgraduateeducation/ |
| Making the Graduate School Decision |
189398 |
/career/exploration/consideringgraduateeducation/makingthegraduateschooldecision/ |
| Researching Graduate Programs |
190419 |
https://www.luc.edu/media/lucedu/career/pdfs/guideshandouts/RsrchgGrdPrgms.pdf |
| Graduate Education Application Process |
190418 |
https://app.joinhandshake.com/edu/articles/31339 |
| Credential Files |
189401 |
/career/exploration/consideringgraduateeducation/credentialfiles/ |
| Writing Personal Statements |
190417 |
https://www.luc.edu/media/lucedu/thewritingcenter/writingresources/How%20to%20Write%20a%20Personal%20Statement.pdf |
| Gap Year |
189403 |
/career/exploration/consideringgraduateeducation/gapyear/ |
| Employers |
189377 |
/career/employers/ |
| Recruit With Us |
189429 |
/career/employers/recruitwithus/ |
| Hire Our Students |
189430 |
/career/employers/hireourstudents/ |
| Career Fairs and Events |
189431 |
/career/employers/careerfairsandevents/ |
| Fall Fairs |
191628 |
/career/employers/careerfairsandevents/fallfairs/ |
| Outcomes and Policies |
189432 |
/career/employers/outcomesandpolicies/ |
| Employer FAQs |
189433 |
/career/employers/employerfaqs/ |
| Resources |
189379 |
/career/resources/ |
| Internship, Research Experience, and Job Search |
189404 |
/career/resources/internshipresearchexperienceandjobsearch/ |
| Finding an Internship |
189405 |
/career/resources/internshipresearchexperienceandjobsearch/findinganinternship/ |
| Mock Interviews |
189414 |
/career/resources/internshipresearchexperienceandjobsearch/mockinterviews/ |
| On-campus Recruiting |
189415 |
/career/resources/internshipresearchexperienceandjobsearch/on-campusrecruiting/ |
| Obtaining Research Experience |
189418 |
/career/resources/internshipresearchexperienceandjobsearch/obtainingresearchexperience/ |
| Career Support from Jesuit Universities |
189419 |
/career/resources/internshipresearchexperienceandjobsearch/careersupportfromjesuituniversities/ |
| Safety Tips for Your Job Search |
191624 |
/career/jobsearch_safety.shtml |
| Going Global |
68188 |
/career/resources/internshipresearchexperienceandjobsearch/goingglobal/ |
| Internship Alternatives |
207571 |
/career/resources/internshipresearchexperienceandjobsearch/internshipalternatives/ |
| Job Search Prep |
207202 |
/career/resources/jobsearchprep/ |
| Mentorship with Loyolalinked |
189423 |
/career/resources/mentorshipwithloyolalinked/ |
| Families and Parents |
203339 |
/career/resources/familiesandparents/ |
| Video Library |
202534 |
/career/resources/videolibrary/ |
| Graduate Student Resources |
191607 |
/career/resources/graduatestudentresources/ |
| Funding for Graduate School |
189439 |
/career/resources/fundingforgraduateschool/ |
| The Non-academic Graduate Student Job Search |
189438 |
/career/resources/thenon-academicgraduatestudentjobsearch/ |
| Gain Experience and Get Paid with a Parker Dewey Micro-Internship |
190415 |
/career/gainexperienceandgetpaidwithaparkerdeweymicro-internship/ |
| Resume/Job Search Guides |
189485 |
/career/resumejobsearchguides/ |
| Assets (DO NOT DELETE) |
201636 |
/career/assetsdonotdelete/ |
| CAS - CRIA |
186480 |
/cria/ |
| site_logo |
186481 |
/cria/sitelogo/ |
| Footer |
186482 |
/cria/footer/ |
| About |
186487 |
/cria/about/ |
| People |
186488 |
/cria/people/ |
| Contacts |
187289 |
/cria/people/contacts/ |
| Affiliate Faculty |
187290 |
/cria/people/affiliatefaculty/ |
| Friends of CRIA |
198576 |
/cria/people/friendsofcria/ |
| Events |
186498 |
/cria/events/ |
| Upcoming Events |
187293 |
/cria/events/upcomingevents/ |
| Past Events |
187294 |
/cria/events/pastevents/ |
| Partners and Projects |
186499 |
/cria/partnersandprojects/ |
| Partners |
187291 |
/cria/partnersandprojects/partners/ |
| Projects |
187292 |
/cria/partnersandprojects/projects/ |
| Groups |
196421 |
/cria/groups/ |
| Global Migrations Group |
196423 |
/cria/groups/globalmigrationsgroup/ |
| International Ethics and Human Rights Group |
196424 |
/cria/groups/internationalethicsandhumanrightsgroup/ |
| Latin American and Caribbean Studies Group |
196425 |
/cria/groups/latinamericanandcaribbeanstudiesgroup/ |
| Premodern Group |
196426 |
/cria/groups/premoderngroup/ |
| Religion and Society in International Context Group |
196427 |
/cria/groups/religionandsocietyininternationalcontextgroup/ |
| Women and Gender in International Context Group |
196429 |
/cria/groups/womenandgenderininternationalcontextgroup/ |
| For students |
197907 |
/cria/forstudents/ |
| Workshop for Research on International Affairs |
201719 |
/cria/forstudents/workshopforresearchoninternationalaffairs/ |
| Labs |
202919 |
/cria/labs/ |
| PEP Lab |
196422 |
/cria/labs/peplab/ |
| People |
196450 |
/cria/labs/peplab/people/ |
| Partners |
196453 |
/cria/labs/peplab/partners/ |
| Research |
196454 |
/cria/labs/peplab/research/ |
| Application for students interested in conducting research in the PEP Lab |
198617 |
/cria/labs/peplab/research/applicationforstudentsinterestedinconductingresearchinthepeplab/ |
| Events |
196455 |
/cria/labs/peplab/events/ |
| CIDI Lab |
202917 |
/cria/labs/cidilab/ |
| Projects |
203915 |
/cria/labs/cidilab/projects/ |
| Who we are and how to join us |
203917 |
/cria/labs/cidilab/whoweareandhowtojoinus/ |
| Global Chicago Lab |
202920 |
/cria/labs/globalchicagolab/ |
| AHA Lab |
202921 |
/cria/labs/ahalab/ |
| Director - Dr. Paula Tallman |
203972 |
/cria/labs/baharlab/director-drpaulatallman/ |
| Research |
203973 |
/cria/labs/baharlab/research/ |
| People and Partners |
203974 |
/cria/labs/baharlab/peopleandpartners/ |
| Transnational Korea Lab |
203465 |
/cria/labs/transnationalkorealab/ |
| CLIPPS Lab |
203543 |
/cria/labs/clippslab/ |
| CAS - Italian Studies |
200778 |
/italianstudies/ |
| site_logo |
200921 |
/italianstudies/sitelogo/ |
| About |
200779 |
/italianstudies/about/ |
| About our Program |
200953 |
/italianstudies/about/aboutourprogram/ |
| Faculty |
200781 |
/italianstudies/about/faculty/ |
| Academics |
200854 |
/italianstudies/academics/ |
| Major (BA) |
200855 |
/italianstudies/academics/majorba/ |
| Minor in Italian |
200856 |
/italianstudies/academics/minorinitalian/ |
| Study Abroad |
200857 |
/italianstudies/academics/studyabroad/ |
| Resources |
200858 |
/italianstudies/resources/ |
| Newsletter |
200896 |
/italianstudies/resources/newsletter/ |
| Language |
200859 |
/italianstudies/resources/language/ |
| Internship |
200860 |
/italianstudies/resources/internship/ |
| Events and Activities |
200999 |
/italianstudies/resources/eventsandactivities/ |
| CAS - Japanese Language & Culture |
191783 |
/japanesestudies/ |
| site_logo |
191784 |
/japanesestudies/sitelogo/ |
| About |
198501 |
/japanesestudies/about/ |
| About our Program |
198502 |
/japanesestudies/about/aboutourprogram/ |
| Faculty |
198503 |
/japanesestudies/about/faculty/ |
| Academics |
191792 |
/japanesestudies/academics/ |
| Minor Requirements |
198504 |
https://catalog.luc.edu/undergraduate/arts-sciences/modern-languages-literatures/japanese-language-culture-minor/#curriculumtext |
| Study in Japan |
191793 |
/japanesestudies/academics/studyinjapan/ |
| Resources |
198546 |
/japanesestudies/resources/ |
| CAS - Jesuit Heritage Research Center |
190394 |
/cas/jesuitheritage/ |
| site_logo |
190395 |
/cas/jesuitheritage/sitelogo/ |
| Footer |
190396 |
/cas/jesuitheritage/footer/ |
| cta |
190397 |
/cas/jesuitheritage/cta/ |
| About |
190401 |
/cas/jesuitheritage/about/ |
| Events |
190403 |
/cas/jesuitheritage/events/ |
| Resources |
190405 |
/cas/jesuitheritage/resources/ |
| Jesuit Heritage Tour |
204334 |
/jesuitheritage/ |
| CAS - Race and Ethnicity |
185884 |
/raceandethnicity/ |
| site_logo |
185885 |
/raceandethnicity/sitelogo/ |
| Footer |
185886 |
/raceandethnicity/footer/ |
| cta |
185887 |
/raceandethnicity/cta/ |
| social media |
185889 |
/raceandethnicity/socialmedia/ |
| About |
185891 |
/raceandethnicity/about/ |
| About the Minor |
187740 |
/raceandethnicity/about/ |
| Meet Our Faculty |
187739 |
/raceandethnicity/about/meetourfaculty/ |
| Jacqueline Scott |
187741 |
/raceandethnicity/about/jacqueline-scott/ |
| Noah Butler |
188321 |
/raceandethnicity/about/noah-butler/ |
| Cristian Paredes |
188322 |
/raceandethnicity/about/cristian-paredes/ |
| Academics |
188320 |
https://catalog.luc.edu/undergraduate/arts-sciences/interdisciplinary-studies-minors/race-ethnicity-minor/#curriculumtext |
| Resources |
185893 |
/raceandethnicity/resources/ |
| Journals |
188433 |
/raceandethnicity/resources/journals/ |
| CAS - Urban Studies Minor |
27549 |
/urban-studies/ |
| Urban Studies: Course Offerings |
27550 |
/curl/Urban_Studies_Courses.shtml |
| custom_js |
158284 |
/curl/customjs/ |
| General Track Requirements |
27552 |
/curl/urban_studies_minor.shtml |
| Sustainability Track Requirements |
27553 |
/curl/Urban_Studies_Minor_.shtml |
| Catalog |
33299 |
/academics/catalog/index.shtml |
| Footer |
33681 |
/academics/catalog/footer/ |
| site_logo |
33682 |
/academics/catalog/sitelogo/ |
| site_background |
58777 |
/academics/catalog/sitebackground/ |
| Center for Student Engagement |
189143 |
/studentengagement/ |
| site_logo |
189145 |
/studentengagement/sitelogo/ |
| Footer |
189146 |
/studentengagement/footer/ |
| social media |
189148 |
/studentengagement/socialmedia/ |
| modules-programming |
189149 |
/studentengagement/modules-programming/ |
| cta |
189150 |
/studentengagement/cta/ |
| I Links |
189151 |
/studentengagement/ilinks/ |
| About |
189152 |
/studentengagement/about/ |
| Mission |
189158 |
/studentengagement/about/mission/ |
| Meet Our Team |
189159 |
/studentengagement/about/meetourteam/ |
| Gabrielle Young |
190361 |
/studentengagement/about/meetourteam/gabrielleyoung/ |
| Emmalee Osborne |
190362 |
/studentengagement/about/meetourteam/emmaleeosborne/ |
| Ryan SC Wong |
190352 |
/studentengagement/about/meetourteam/ryanscwong/ |
| Victoria Prom |
190363 |
/studentengagement/about/meetourteam/victoriaprom/ |
| Minela Muminovic |
190353 |
/studentengagement/about/meetourteam/minelamuminovic/ |
| Lina Flores Wolf |
190354 |
/studentengagement/about/meetourteam/linafloreswolf/ |
| Profiles |
191671 |
/studentengagement/about/meetourteam/profiles/ |
| Contact Us |
189160 |
/studentengagement/about/contactus/ |
| Join Our Team |
189161 |
/studentengagement/about/joinourteam/ |
| Recognized Student Organizations |
189153 |
/studentengagement/recognizedstudentorganizations/ |
| About Student Organizations |
189162 |
/studentengagement/recognizedstudentorganizations/aboutstudentorganizations/ |
| Campus Activities Network |
189208 |
/studentengagement/recognizedstudentorganizations/registeredstudentorganizations/campusactivitiesnetwork/ |
| Engagement Fair |
189216 |
/studentengagement/recognizedstudentorganizations/aboutstudentorganizations/campusactivitiesnetwork/engagementfair/ |
| Student Organization Awards |
189217 |
/studentengagement/recognizedstudentorganizations/registeredstudentorganizations/campusactivitiesnetwork/studentorganizationawards/ |
| Pranati Sukh |
190341 |
/studentengagement/recognizedstudentorganizations/registeredstudentorganizations/campusactivitiesnetwork/pranatisukh/ |
| Sarah Savani |
190344 |
/studentengagement/recognizedstudentorganizations/registeredstudentorganizations/campusactivitiesnetwork/sarahsavani/ |
| Bridget Reynolds |
190346 |
/studentengagement/recognizedstudentorganizations/registeredstudentorganizations/campusactivitiesnetwork/bridgetreynolds/ |
| Victoria Prom |
190345 |
/studentengagement/recognizedstudentorganizations/registeredstudentorganizations/campusactivitiesnetwork/victoriaprom/ |
| Min Kha |
190347 |
/studentengagement/recognizedstudentorganizations/registeredstudentorganizations/campusactivitiesnetwork/minkha/ |
| Student Organization Re-Registration |
189210 |
/studentengagement/recognizedstudentorganizations/aboutstudentorganizations/studentorganizationre-registration/ |
| Mandatory Orientation |
189220 |
/studentengagement/recognizedstudentorganizations/aboutstudentorganizations/studentorganizationre-registration/mandatoryorientation/ |
| Hazing Prevention Week |
189221 |
/studentengagement/recognizedstudentorganizations/registeredstudentorganizations/annualorganizationrequirements/hazingpreventionweek/ |
| Constitution |
189219 |
/studentengagement/recognizedstudentorganizations/registeredstudentorganizations/annualorganizationrequirements/constitution/ |
| Organization Transition |
189222 |
/studentengagement/recognizedstudentorganizations/registeredstudentorganizations/annualorganizationrequirements/organizationtransition/ |
| Activity Request |
189211 |
/studentengagement/recognizedstudentorganizations/registeredstudentorganizations/activityrequest/ |
| Film Screening |
189225 |
/studentengagement/recognizedstudentorganizations/registeredstudentorganizations/activityrequest/filmscreening/ |
| Additional Forms |
189226 |
/studentengagement/recognizedstudentorganizations/registeredstudentorganizations/activityrequest/additionalforms/ |
| Budget |
189212 |
/studentengagement/recognizedstudentorganizations/registeredstudentorganizations/budget/ |
| Budget Request Processes |
189228 |
/studentengagement/recognizedstudentorganizations/registeredstudentorganizations/budget/budgetrequestprocesses/ |
| Budget Deadlines and Resources |
189229 |
/studentengagement/recognizedstudentorganizations/registeredstudentorganizations/budget/budgetdeadlinesandresources/ |
| Funding Sources |
189230 |
/studentengagement/recognizedstudentorganizations/registeredstudentorganizations/budget/fundingsources/ |
| Purchasing Process |
189213 |
/studentengagement/recognizedstudentorganizations/registeredstudentorganizations/purchasingprocess/ |
| Contracts |
189231 |
/studentengagement/recognizedstudentorganizations/registeredstudentorganizations/purchasingprocess/contracts/ |
| Submitting Contracts |
189248 |
/studentengagement/recognizedstudentorganizations/registeredstudentorganizations/purchasingprocess/contracts/submittingcontracts/ |
| Purchase Request Processes |
189232 |
/studentengagement/recognizedstudentorganizations/registeredstudentorganizations/purchasingprocess/purchaserequestprocesses/ |
| Preferred Vendors |
189247 |
https://luc.campuslabs.com/engage/actioncenter/organization/student-activities-greek-affairs/documents |
| Item Reservation Process |
197028 |
/studentengagement/recognizedstudentorganizations/registeredstudentorganizations/purchasingprocess/itemreservationprocess/ |
| Student Organization Resource Library |
189214 |
/studentengagement/recognizedstudentorganizations/aboutstudentorganizations/studentorganizationresourcelibrary/ |
| Start an Organization |
189215 |
/studentengagement/recognizedstudentorganizations/registeredstudentorganizations/startanorganization/ |
| Process of Registration |
189249 |
/studentengagement/recognizedstudentorganizations/aboutstudentorganizations/startanorganization/processofregistration/ |
| New Organization Application Timeline |
203686 |
/studentengagement/recognizedstudentorganizations/aboutstudentorganizations/startanorganization/neworganizationapplicationtimeline/ |
| Sponsored Student Organizations |
189163 |
/studentengagement/recognizedstudentorganizations/sponsoredstudentorganizations/ |
| Handbook and Policies |
189218 |
/studentengagement/recognizedstudentorganizations/handbookandpolicies/ |
| Alcohol Policy and Guidelines |
189241 |
/studentengagement/recognizedstudentorganizations/handbookandpolicies/alcoholpolicyandguidelines/ |
| Food Safety Policy |
189242 |
/studentengagement/recognizedstudentorganizations/handbookandpolicies/foodsafetypolicy/ |
| Transportation |
189243 |
/studentengagement/recognizedstudentorganizations/handbookandpolicies/transportation/ |
| Student Demonstration/fixed Exhibit |
189244 |
/studentengagement/recognizedstudentorganizations/handbookandpolicies/studentdemonstrationfixedexhibit/ |
| Online Fundraising |
189245 |
/studentengagement/recognizedstudentorganizations/handbookandpolicies/onlinefundraising/ |
| LUCommunity |
189209 |
/studentengagement/recognizedstudentorganizations/lucommunity/ |
| Advisors |
189164 |
/studentengagement/recognizedstudentorganizations/advisors/ |
| Resources |
189236 |
/studentengagement/recognizedstudentorganizations/advisors/resources/ |
| Become an Advisor |
189237 |
/studentengagement/recognizedstudentorganizations/advisors/becomeanadvisor/ |
| Risk Assessment |
189238 |
/studentengagement/recognizedstudentorganizations/advisors/riskassessment/ |
| Sorority and Fraternity Life |
189154 |
/studentengagement/sororityandfraternitylife/ |
| About Us |
189165 |
/studentengagement/sororityandfraternitylife/aboutus/ |
| Meet the Team |
189239 |
/studentengagement/sororityandfraternitylife/aboutus/meettheteam/ |
| Governing Councils |
189240 |
/studentengagement/sororityandfraternitylife/aboutus/governingcouncils/ |
| How To Join |
189166 |
/studentengagement/sororityandfraternitylife/howtojoin/ |
| Recognized Sororities and Fraternities |
189167 |
/studentengagement/sororityandfraternitylife/recognizedsororitiesandfraternities/ |
| Alumni Engagement |
189168 |
/studentengagement/sororityandfraternitylife/alumniengagement/ |
| Information for Parents |
189169 |
/studentengagement/sororityandfraternitylife/informationforparents/ |
| Policies and Forms |
189171 |
/studentengagement/sororityandfraternitylife/policiesandforms/ |
| Programs and Opportunities |
189172 |
/studentengagement/sororityandfraternitylife/programsandopportunities/ |
| Commuter Student Life |
189155 |
/studentengagement/commuterstudentlife/ |
| CommuterCon |
189173 |
/studentengagement/commuterstudentlife/commutercon/ |
| Programs and Services |
189174 |
/studentengagement/commuterstudentlife/programsandservices/ |
| Parking and Transportation |
189175 |
/studentengagement/commuterstudentlife/parkingandtransportation/ |
| Dining Services |
189176 |
/studentengagement/commuterstudentlife/diningservices/ |
| Commuter Resource Room |
189177 |
/studentengagement/commuterstudentlife/commuterresourceroom/ |
| Meet Our Commuter Ambassadors |
189178 |
/studentengagement/commuterstudentlife/meetourcommuterambassadors/ |
| DOP |
189251 |
https://luc.campuslabs.com/engage/organization/department-of-programming |
| Special Events |
189157 |
/studentengagement/specialevents/ |
| Welcome Week |
189252 |
http://luc.edu/welcomeweek |
| Finals Breakfast |
189180 |
/studentengagement/specialevents/finalsbreakfast/ |
| Senior Send-Off |
189181 |
/studentengagement/specialevents/seniorsend-off/ |
| Student Organization Awards |
193976 |
/studentengagement/studentorganizationawards/ |
| Leadership Development |
199606 |
/studentengagement/leadershipdevelopment/ |
| Emerging Leaders Program (ELP) |
199618 |
/studentengagement/leadershipdevelopment/emergingleadersprogramelp/ |
| Catering |
18213 |
/catering/index.shtml |
| About Us |
18214 |
/catering/aboutus.shtml |
| Mission Statement |
204367 |
/catering/missionstatement/ |
| Catering Request Form |
163131 |
/catering/cateringrequestform/ |
| Contact Us |
18215 |
/catering/contactus/ |
| right_column |
89448 |
/catering/rightcolumn/ |
| General Policies |
18221 |
/catering/menu/index.shtml |
| right_column |
58807 |
/catering/menu/rightcolumn/ |
| Loyola Weddings |
18235 |
/catering/weddings.shtml |
| right_column |
58812 |
/catering/rightcolumn/ |
| Meetings and Events |
89341 |
/catering/meetingsandevents/ |
| right_column |
89446 |
/catering/meetingsandevents/rightcolumn/ |
| Our Menus |
89342 |
/catering/ourmenus/ |
| right_column |
89447 |
/catering/vendorrecommendations/rightcolumn/ |
| site_logo |
203458 |
/catering/sitelogo/ |
| social media |
203461 |
/catering/socialmedia/ |
| Footer |
18243 |
/catering/footer/ |
| documents |
203469 |
/catering/documents/ |
| Catholic Studies |
13507 |
/catholicstudies/index.shtml |
| About Us |
94770 |
/catholicstudies/aboutus/ |
| Catholic Studies Minor |
13508 |
/catholicstudies/aboutus/catholicstudiesminor/ |
| Transformative Education |
166621 |
/catholicstudies/aboutus/transformativeeducation/ |
| Hank Center Website |
51798 |
/ccih/ |
| Contact Us |
13509 |
/catholicstudies/contact.shtml |
| Courses and Requirements |
94773 |
/catholicstudies/coursesandrequirements/ |
| Requirements |
13510 |
/catholicstudies/requirements.shtml |
| Capstone |
94775 |
/catholicstudies/coursesandrequirements/capstone/ |
| Courses |
121754 |
/catholicstudies/coursesandrequirements/courses/ |
| Affiliate faculty |
94772 |
/catholicstudies/affiliatefaculty/ |
| Profiles |
202844 |
/catholicstudies/affiliatedfaculty/profiles/ |
| Community News and Events |
94777 |
/catholicstudies/communitynewsandevents/ |
| Retreats |
94778 |
/catholicstudies/communitynewsandevents/retreats/ |
| Banquet |
94779 |
/catholicstudies/communitynewsandevents/banquet/ |
| Featured Intellectual |
64545 |
/catholicstudies/communitynewsandevents/featuredintellectual/ |
| Profiles |
64546 |
/catholicstudies/communitynewsandevents/featuredintellectual/profiles/ |
| Blog |
94781 |
https://luccatholicstudies.wordpress.com/ |
| Alumni |
106269 |
/catholicstudies/communitynewsandevents/alumni/ |
| archive |
13563 |
/catholicstudies/archive/ |
| Documents |
61275 |
/catholicstudies/documents/ |
| site_logo |
202830 |
/catholicstudies/sitelogo/ |
| cta |
202831 |
/catholicstudies/cta/ |
| I Links |
202832 |
/catholicstudies/ilinks/ |
| social media |
202833 |
/catholicstudies/socialmedia/ |
| modules-programming |
202834 |
/catholicstudies/modules-programming/ |
| Footer |
13564 |
/catholicstudies/footer/ |
| Kingfisher Living Learning Community |
206914 |
/catholicstudies/kingfisherlivinglearningcommunity/ |
| Celebration of Students |
158268 |
/celebrationofstudents/ |
| site_logo |
158270 |
/celebrationofstudents/sitelogo/ |
| Footer |
158278 |
/celebrationofstudents/footer/ |
| CTA |
158279 |
/celebrationofstudents/cta/ |
| social media |
158280 |
/celebrationofstudents/socialmedia/ |
| Center for Digital Ethics & Policy |
126980 |
/digitalethics/ |
| About |
127008 |
/digitalethics/about/ |
| Our People |
154768 |
/digitalethics/about/ourpeople/ |
| Leadership Profiles |
207441 |
/digitalethics/about/ourpeople/leadershipprofiles/ |
| Affiliated Faculty Profiles |
202182 |
/digitalethics/about/ourpeople/affiliatedfacultyprofiles/ |
| Contact |
129679 |
/digitalethics/about/contact/ |
| Privacy Policy |
142421 |
/digitalethics/about/contact/privacypolicy/ |
| Sponsors |
200940 |
/digitalethics/about/sponsors/ |
| Current Research |
129464 |
/digitalethics/currentresearch/ |
| Events |
154817 |
/digitalethics/events/ |
| Annual Symposium |
154819 |
/digitalethics/events/annualsymposium/ |
| Symposia Archive |
156171 |
/digitalethics/events/symposiaarchive/ |
| 2025 |
206419 |
/digitalethics/events/symposiaarchive/2025/ |
| 2024 |
199510 |
/digitalethics/events/symposiaarchive/2024/ |
| 2023 |
191000 |
/digitalethics/events/symposiaarchive/2023/ |
| 2022 |
183681 |
/digitalethics/events/symposiaarchive/2022/ |
| 2021 |
159931 |
/digitalethics/events/symposiaarchive/2021/ |
| 2019 |
156176 |
/digitalethics/events/symposiaarchive/2019/ |
| 2017 |
156232 |
/digitalethics/events/symposiaarchive/2017/ |
| 2015 |
156234 |
/digitalethics/events/symposiaarchive/2015/ |
| 2014 |
156235 |
/digitalethics/events/symposiaarchive/2014/ |
| 2013 |
156236 |
/digitalethics/events/symposiaarchive/2013/ |
| 2011 |
158087 |
/digitalethics/events/symposiaarchive/2011/ |
| Upcoming Events |
154818 |
/digitalethics/events/upcomingevents/ |
| Event Archive |
156412 |
/digitalethics/events/eventarchive/ |
| archive |
156472 |
/digitalethics/events/pastevents/archive/ |
| Salon '26: AI From Insight to Impact That Matters |
207440 |
/digitalethics/events/eventarchive/archive/salon26aifrominsighttoimpactthatmatters/ |
| Ethics Dialogues |
159768 |
/digitalethics/events/pastevents/archive/ethicsdialogues/ |
| Data Justice: Imagining the Next Decade |
156473 |
/digitalethics/events/pastevents/archive/datajusticeimaginingthenextdecade/ |
| Inaugural Digital Ethics Award Winner: Taylor Dumpson |
156413 |
/digitalethics/events/pastevents/archive/inauguraldigitalethicsawardwinnertaylordumpson/ |
| Extreme Speech Online - Moral Panic 2.0? |
156414 |
/digitalethics/events/pastevents/archive/extremespeechonline-moralpanic20/ |
| Research Colloquium |
156410 |
/digitalethics/events/pastevents/archive/researchcolloquium/ |
| Digital Ethics Student Award |
156408 |
/digitalethics/events/pastevents/archive/digitalethicsstudentaward/ |
| 14th Annual International Symposium on Digital Ethics |
201461 |
/digitalethics/events/samplesite/ |
| Meet Our Speakers |
201471 |
/digitalethics/events/samplesite/meetourspeakers/ |
| Become a Symposium Sponsor |
201467 |
/digitalethics/events/samplesite/becomeasymposiumsponsor/ |
| Digital Ethics Symposium Program Schedule |
201722 |
/digitalethics/events/digitalethicssymposiumprogramschedule/ |
| Research & Initiatives |
129463 |
/digitalethics/researchinitiatives/ |
| Publications |
146786 |
/digitalethics/researchinitiatives/publications/ |
| Interviews |
142569 |
/digitalethics/researchinitiatives/interviews/ |
| archive |
142570 |
/digitalethics/researchinitiatives/interviews/archive/ |
| Reviews |
129537 |
/digitalethics/researchinitiatives/reviews/ |
| archive |
146792 |
/digitalethics/researchinitiatives/reviews/archive/ |
| Personal Connections in the Digital Age by Nancy Baymson |
202158 |
/digitalethics/researchinitiatives/reviews/personalconnectionsinthedigitalagebynancybaymson/ |
| The Circle by Dave Eggers |
202159 |
/digitalethics/researchinitiatives/reviews/thecirclebydaveeggers/ |
| The Breakup 2.0 by Ilana Gershon |
202161 |
/digitalethics/researchinitiatives/reviews/thebreakup20byilanagershon/ |
| Essays |
126990 |
/digitalethics/researchinitiatives/essays/ |
| Archive |
126999 |
/digitalethics/researchinitiatives/essays/archive/ |
| Contributors |
147595 |
/digitalethics/researchinitiatives/essays/archive/contributors/ |
| 2020 |
128765 |
/digitalethics/researchinitiatives/essays/archive/2020/ |
| Villains and Heroes in Times of Crisis |
147141 |
/digitalethics/researchinitiatives/essays/archive/2020/villainsandheroesintimesofcrisis/ |
| Surveilling the Sick: Technology and the COVID-19 Pandemic |
147139 |
/digitalethics/researchinitiatives/essays/archive/2020/surveillingthesicktechnologyandthecovid-19pandemic/ |
| #jesuisMila opens debate about the right to blaspheme in France. |
147143 |
/digitalethics/researchinitiatives/essays/archive/2020/jesuismilaopensdebateabouttherighttoblasphemeinfrance/ |
| Amazon’s Ring Doorbell Rings In New Privacy Violations |
147136 |
/digitalethics/researchinitiatives/essays/archive/2020/amazonsringdoorbellringsinnewprivacyviolations/ |
| Is OOH advertising contributing to digital fraud? |
147137 |
/digitalethics/researchinitiatives/essays/archive/2020/isoohadvertisingcontributingtodigitalfraud/ |
| 2019 |
128764 |
/digitalethics/researchinitiatives/essays/archive/2019/ |
| Is Big Data Corrupting the U.S. Election Process? |
156461 |
/digitalethics/researchinitiatives/essays/archive/2019/isbigdatacorruptingtheuselectionprocess/ |
| The Assange Indictment: Threat to a Free Press? |
147160 |
/digitalethics/researchinitiatives/essays/archive/2019/theassangeindictmentthreattoafreepress/ |
| The Ethics of Digital Face-Swapping |
147166 |
/digitalethics/researchinitiatives/essays/archive/2019/theethicsofdigitalface-swapping/ |
| A Q & A with Dr. David Kamerer, Advisory Board Member |
147167 |
/digitalethics/researchinitiatives/essays/archive/2019/aqawithdrdavidkamereradvisoryboardmember/ |
| A Q & A with Dr. Florence M. Chee, Advisory Board Member |
147170 |
/digitalethics/researchinitiatives/essays/archive/2019/aqawithdrflorencemcheeadvisoryboardmember/ |
| Year in Review Part IV |
147164 |
/digitalethics/researchinitiatives/essays/archive/2019/yearinreviewpartiv/ |
| Year in Review Part III |
147165 |
/digitalethics/researchinitiatives/essays/archive/2019/yearinreviewpartiii/ |
| Year in Review Part II |
147171 |
/digitalethics/researchinitiatives/essays/archive/2019/yearinreviewpartii/ |
| Year in Review Part I |
147172 |
/digitalethics/researchinitiatives/essays/archive/2019/yearinreviewparti/ |
| Digital Documentarians: What You Need to Know |
147169 |
/digitalethics/researchinitiatives/essays/archive/2019/digitaldocumentarianswhatyouneedtoknow/ |
| CDEP Publication: Digital Ethics: Research and Practice |
147173 |
/digitalethics/researchinitiatives/essays/archive/2019/cdeppublicationdigitalethicsresearchandpractice/ |
| CDEP Publication: Ethics for a Digital Age, Vol. II |
147174 |
/digitalethics/researchinitiatives/essays/archive/2019/cdeppublicationethicsforadigitalagevolii/ |
| CDEP Publication: Ethics for a Digital Age |
147175 |
/digitalethics/researchinitiatives/essays/archive/2019/cdeppublicationethicsforadigitalage/ |
| 2018 |
128763 |
/digitalethics/researchinitiatives/essays/archive/2018/ |
| Who can be trusted with our personal data? |
147185 |
/digitalethics/researchinitiatives/essays/archive/2018/whocanbetrustedwithourpersonaldata/ |
| Self-Driving Car Ethics |
147198 |
/digitalethics/researchinitiatives/essays/archive/2018/self-drivingcarethics/ |
| How Big is Big Tech? |
147186 |
/digitalethics/researchinitiatives/essays/archive/2018/howbigisbigtech/ |
| The Death Algorithm — Will Google Influence Your Lifespan? |
147184 |
/digitalethics/researchinitiatives/essays/archive/2018/thedeathalgorithmwillgoogleinfluenceyourlifespan/ |
| Accuracy and ethics in reporting the Boston bombing |
147191 |
/digitalethics/researchinitiatives/essays/archive/2018/accuracyandethicsinreportingthebostonbombing/ |
| Digital Supermodels-Fake it Till You Make It |
147187 |
/digitalethics/researchinitiatives/essays/archive/2018/digitalsupermodels-fakeittillyoumakeit/ |
| Facebook, Cambridge Analytica and Why Your Data is Still for Sale |
147189 |
/digitalethics/researchinitiatives/essays/archive/2018/facebookcambridgeanalyticaandwhyyourdataisstillforsale/ |
| Uncle Sam Wants Your Phone? Military Funds Smartphone App to Monitor Health |
147190 |
/digitalethics/researchinitiatives/essays/archive/2018/unclesamwantsyourphonemilitaryfundssmartphoneapptomonitorhealth/ |
| Sentence by Numbers: The Scary Truth Behind Risk Assessment Algorithms |
147193 |
/digitalethics/researchinitiatives/essays/archive/2018/sentencebynumbersthescarytruthbehindriskassessmentalgorithms/ |
| Gold! Gold! Gold from the Blockchain River! |
147192 |
/digitalethics/researchinitiatives/essays/archive/2018/goldgoldgoldfromtheblockchainriver/ |
| The Role of Social Media in Adolescent/Teen Depression and Anxiety |
147194 |
/digitalethics/researchinitiatives/essays/archive/2018/theroleofsocialmediainadolescentteendepressionandanxiety/ |
| The Logan Paul Question: Teaching Teens Morality through Epic Fails |
147196 |
/digitalethics/researchinitiatives/essays/archive/2018/theloganpaulquestionteachingteensmoralitythroughepicfails/ |
| Facebook is a media company, but what’s a media company? |
147195 |
/digitalethics/researchinitiatives/essays/archive/2018/facebookisamediacompanybutwhatsamediacompany/ |
| When a Dictator Goes Online |
147197 |
/digitalethics/researchinitiatives/essays/archive/2018/whenadictatorgoesonline/ |
| Google’s New Chokehold on Health Data Privacy |
147200 |
/digitalethics/researchinitiatives/essays/archive/2018/googlesnewchokeholdonhealthdataprivacy/ |
| Is It a Feature? Is it a Bug? No, It’s an Antifeature. |
147199 |
/digitalethics/researchinitiatives/essays/archive/2018/isitafeatureisitabugnoitsanantifeature/ |
| 2017 |
128762 |
/digitalethics/researchinitiatives/essays/archive/2017/ |
| The Negative Lottery: Equifax and the Lost Art of Risk Management |
149791 |
/digitalethics/researchinitiatives/essays/archive/2017/thenegativelotteryequifaxandthelostartofriskmanagement/ |
| The Breakup 2.0 by Ilana Gershon |
149804 |
/digitalethics/researchinitiatives/essays/archive/2017/thenegativelotteryequifaxandthelostartofriskmanagement/thebreakup20byilanagershon/ |
| Who takes ethical responsibility for social media influence? |
149792 |
/digitalethics/researchinitiatives/essays/archive/2017/whotakesethicalresponsibilityforsocialmediainfluence/ |
| Implanting Microchips: Sign of Progress or Mark of the Beast? |
149793 |
/digitalethics/researchinitiatives/essays/archive/2017/implantingmicrochipssignofprogressormarkofthebeast/ |
| NCAA’s Clamp Down on Athletes’ YouTube Use: Out of Touch and Out of Control? |
149794 |
/digitalethics/researchinitiatives/essays/archive/2017/ncaasclampdownonathletesyoutubeuseoutoftouchandoutofcontrol/ |
| Proximity Marketing: Often Creepy, but It Doesn’t Have to Be |
149797 |
/digitalethics/researchinitiatives/essays/archive/2017/proximitymarketingoftencreepybutitdoesnthavetobe/ |
| Social Media in the Wake of Disaster |
149796 |
/digitalethics/researchinitiatives/essays/archive/2017/socialmediainthewakeofdisaster/ |
| The Ethics of Doxing Nazis |
149798 |
/digitalethics/researchinitiatives/essays/archive/2017/theethicsofdoxingnazis/ |
| Corporate Watchdogs or Self-Serving Capitalists? |
149788 |
/digitalethics/researchinitiatives/essays/archive/2017/corporatewatchdogsorself-servingcapitalists/ |
| Will big business compromise the ethics of artificial intelligence |
149799 |
/digitalethics/researchinitiatives/essays/archive/2017/willbigbusinesscompromisetheethicsofartificialintelligence/ |
| Using Facebook to Identify Potential Problem Drinkers, Is It Ever Justified? |
149800 |
/digitalethics/researchinitiatives/essays/archive/2017/usingfacebooktoidentifypotentialproblemdrinkersisiteverjustified/ |
| Protecting Leakers in the Digital Age |
149801 |
/digitalethics/researchinitiatives/essays/archive/2017/protectingleakersinthedigitalage/ |
| Although seemingly trivial, livestreaming on social media poses serious problems |
147607 |
/digitalethics/researchinitiatives/essays/archive/2017/althoughseeminglytriviallivestreamingonsocialmediaposesseriousproblems/ |
| College Entrance Exam – “Nailed It”; Social Media Background Check – “Failed It” |
149785 |
/digitalethics/researchinitiatives/essays/archive/2017/collegeentranceexamnaileditsocialmediabackgroundcheckfailedit/ |
| Toward an ethic of personal technologies |
149810 |
/digitalethics/researchinitiatives/essays/archive/2017/towardanethicofpersonaltechnologies/ |
| Why We Should Hold Ourselves Responsible for Fake News |
149809 |
/digitalethics/researchinitiatives/essays/archive/2017/whyweshouldholdourselvesresponsibleforfakenews/ |
| Ranting on Social Media: Innocent Comment Platform or Bully Pulpit? |
149802 |
/digitalethics/researchinitiatives/essays/archive/2017/rantingonsocialmediainnocentcommentplatformorbullypulpit/ |
| Does CGI cross ethical boundaries when it depicts deceased actors? |
149790 |
/digitalethics/researchinitiatives/essays/archive/2017/doescgicrossethicalboundarieswhenitdepictsdeceasedactors/ |
| Snapchat: A Powerful Tool for Gathering and Distributing News |
149808 |
/digitalethics/researchinitiatives/essays/archive/2017/snapchatapowerfultoolforgatheringanddistributingnews/ |
| Why Digital Ethics Matter |
149803 |
/digitalethics/researchinitiatives/essays/archive/2017/whydigitalethicsmatter/ |
| Follow the Money: The Pros and Cons of Geolocating Currency |
149806 |
/digitalethics/researchinitiatives/essays/archive/2017/followthemoneytheprosandconsofgeolocatingcurrency/ |
| 2016 |
128761 |
/digitalethics/researchinitiatives/essays/archive/2016/ |
| Journalistic Objectivity is Fiction – And That’s Just Fine. |
157097 |
/digitalethics/researchinitiatives/essays/archive/2016/journalisticobjectivityisfictionandthatsjustfine/ |
| When workplace monitoring, behavioral analytics, and employee privacy collide |
157094 |
/digitalethics/researchinitiatives/essays/archive/2016/whenworkplacemonitoringbehavioralanalyticsandemployeeprivacycollide/ |
| Internet Trolls and the Ones Who Love Them |
157096 |
/digitalethics/researchinitiatives/essays/archive/2016/internettrollsandtheoneswholovethem/ |
| Spinning out of control: we need a code of campaign ethics |
157095 |
/digitalethics/researchinitiatives/essays/archive/2016/spinningoutofcontrolweneedacodeofcampaignethics/ |
| Death and the Internet: What Happens to Your Digital Assets When You Die? |
157076 |
/digitalethics/researchinitiatives/essays/archive/2016/deathandtheinternetwhathappenstoyourdigitalassetswhenyoudie/ |
| Invasions of Privacy in Virtual Reality Journalism |
157093 |
/digitalethics/researchinitiatives/essays/archive/2016/invasionsofprivacyinvirtualrealityjournalism/ |
| Online Talent Platforms — A Boon for Workers or Digital Sweatshop? |
157092 |
/digitalethics/researchinitiatives/essays/archive/2016/onlinetalentplatformsaboonforworkersordigitalsweatshop/ |
| Analytics, Ethics and Leadership: Dialogue with the Dean |
157070 |
/digitalethics/researchinitiatives/essays/archive/2016/analyticsethicsandleadershipdialoguewiththedean/ |
| The Ethics of Lifelogging |
157091 |
/digitalethics/researchinitiatives/essays/archive/2016/theethicsoflifelogging/ |
| Why a Cashless Society Should Scare You |
157089 |
/digitalethics/researchinitiatives/essays/archive/2016/whyacashlesssocietyshouldscareyou/ |
| Write Reviews – Get Free Stuff! |
157088 |
/digitalethics/researchinitiatives/essays/archive/2016/writereviewsgetfreestuff/ |
| Legislating for the open internet in a commercial world |
157087 |
/digitalethics/researchinitiatives/essays/archive/2016/legislatingfortheopeninternetinacommercialworld/ |
| Ethics of Using Eyewitness Footage |
157086 |
/digitalethics/researchinitiatives/essays/archive/2016/ethicsofusingeyewitnessfootage/ |
| Are Celebrity Scandals Changing The Privacy Landscape? |
157071 |
/digitalethics/researchinitiatives/essays/archive/2016/arecelebrityscandalschangingtheprivacylandscape/ |
| Balancing Security and Privacy in the Age of Encryption: Apple v. FBI |
157085 |
/digitalethics/researchinitiatives/essays/archive/2016/balancingsecurityandprivacyintheageofencryptionapplevfbi/ |
| Pre-Crime Monitoring |
157084 |
/digitalethics/researchinitiatives/essays/archive/2016/pre-crimemonitoring/ |
| Communities of Disinterest: How an Algorithm can put an End to Gerrymandering |
157074 |
/digitalethics/researchinitiatives/essays/archive/2016/communitiesofdisinteresthowanalgorithmcanputanendtogerrymandering/ |
| SXSW 2016: policy, privacy, and the president - An eyewitness account. |
157083 |
/digitalethics/researchinitiatives/essays/archive/2016/sxsw2016policyprivacyandthepresident-aneyewitnessaccount/ |
| Is “ethical smartphone” an oxymoron? |
157082 |
/digitalethics/researchinitiatives/essays/archive/2016/isethicalsmartphoneanoxymoron/ |
| Surveillance Art: Rebellion or Hypocrisy? |
157098 |
/digitalethics/researchinitiatives/essays/archive/2016/surveillanceartrebellionorhypocrisy/ |
| Is my data more private than yours? |
157079 |
/digitalethics/researchinitiatives/essays/archive/2016/ismydatamoreprivatethanyours/ |
| Athletes with Agendas |
157072 |
/digitalethics/researchinitiatives/essays/archive/2016/athleteswithagendas/ |
| Facebook Unfriends Free Speech |
157078 |
/digitalethics/researchinitiatives/essays/archive/2016/facebookunfriendsfreespeech/ |
| The Ethical Pitfalls of Crime Prevention Apps |
157077 |
/digitalethics/researchinitiatives/essays/archive/2016/theethicalpitfallsofcrimepreventionapps/ |
| Copyright in the Digital Age: How the TPP extends a flawed and harmful policy |
157075 |
/digitalethics/researchinitiatives/essays/archive/2016/copyrightinthedigitalagehowthetppextendsaflawedandharmfulpolicy/ |
| 2015 |
128760 |
/digitalethics/researchinitiatives/essays/archive/2015/ |
| 2014 |
129210 |
/digitalethics/researchinitiatives/essays/archive/2014/ |
| 2013 |
129209 |
/digitalethics/researchinitiatives/essays/archive/2013/ |
| 2011 |
128730 |
/digitalethics/researchinitiatives/essays/archive/2011/ |
| Resources |
146757 |
/digitalethics/researchinitiatives/essays/resources/ |
| Digital Documentarians: What You Need to Know |
127030 |
/digitalethics/researchinitiatives/essays/resources/digitaldocumentarianswhatyouneedtoknow/ |
| CDEP Publication: Ethics for a Digital Age, Vol. II |
127031 |
/digitalethics/researchinitiatives/essays/resources/cdeppublicationethicsforadigitalagevolii/ |
| CDEP Publication: Ethics for a Digital Age |
127032 |
/digitalethics/researchinitiatives/essays/resources/cdeppublicationethicsforadigitalage/ |
| Links |
142482 |
/digitalethics/researchinitiatives/essays/resources/links/ |
| Fellowships |
206295 |
/digitalethics/researchinitiatives/fellowships/ |
| Media Engagement and Resources |
158264 |
/digitalethics/mediaengagementandresources/ |
| Media Appearances |
161857 |
/digitalethics/mediaengagementandresources/mediaappearances/ |
| archive |
161858 |
/digitalethics/mediaengagementandresources/mediaappearances/archive/ |
| Social media bans spark censorship debate |
161859 |
/digitalethics/mediaengagementandresources/mediaappearances/archive/socialmediabanssparkcensorshipdebate/ |
| Teaching Resources |
201397 |
/digitalethics/mediaengagementandresources/teachingresources/ |
| site_logo |
126995 |
/digitalethics/sitelogo/ |
| Footer |
156508 |
/digitalethics/footer/ |
| social media |
127035 |
/digitalethics/socialmedia/ |
| School of Communication |
201369 |
https://www.luc.edu/soc |
| Center for Engaged Learning, Teaching, and Scholarship (CELTS) |
14935 |
/celts/ |
| modules-programming |
200543 |
/celts/modules-programming/ |
| site_logo |
200541 |
/celts/sitelogo/ |
| Footer |
15127 |
/celts/footer/ |
| social media |
161099 |
/celts/socialmedia/ |
| I Links |
161240 |
/celts/ilinks/ |
| Programs |
15000 |
/celts/programs/ |
| Engaged Learning |
61490 |
/celts/programs/engagedlearning/ |
| Student Resources |
61499 |
/celts/programs/engagedlearning/studentresources/ |
| Requesting EL Credit |
62130 |
/celts/programs/engagedlearning/studentresources/requestingelcredit/ |
| Engaged Learning Assessment |
82233 |
/celts/programs/engagedlearning/studentresources/engagedlearningassessment/ |
| Faculty Resources |
61500 |
/celts/programs/engagedlearning/facultyresources/ |
| EL Course Approval Process |
62138 |
/celts/programs/engagedlearning/facultyresources/elcourseapprovalprocess/ |
| Propose a New EL Course |
62140 |
/celts/programs/engagedlearning/facultyresources/proposeanewelcourse/ |
| EL Subcommittee Members |
62141 |
/celts/programs/engagedlearning/facultyresources/elsubcommitteemembers/ |
| Engaged Learning Assessment |
87099 |
/celts/programs/engagedlearning/facultyresources/engagedlearningassessment/ |
| Approved Classes |
61501 |
/celts/programs/engagedlearning/approvedclasses/ |
| Academic Internships |
62038 |
/celts/programs/engagedlearning/approvedclasses/academicinternships/ |
| Service-Learning |
62039 |
/celts/programs/engagedlearning/approvedclasses/service-learning/ |
| Undergraduate Research |
62040 |
/celts/programs/engagedlearning/approvedclasses/undergraduateresearch/ |
| Fieldwork |
62041 |
/celts/programs/engagedlearning/approvedclasses/fieldwork/ |
| Public Performance |
62042 |
/celts/programs/engagedlearning/approvedclasses/publicperformance/ |
| Contact Us |
61503 |
/celts/programs/engagedlearning/contactus/ |
| Academic Internship |
29545 |
/celts/programs/academicinternship/ |
| For Faculty and Staff |
37752 |
/celts/programs/academicinternship/forfacultyandstaff/ |
| Resources |
37674 |
/celts/programs/academicinternship/forfacultyandstaff/resources/ |
| Important Information for Students |
201008 |
/celts/programs/academicinternship/forstudents/ |
| Faculty Development Programs |
201009 |
/celts/engagedteachingscholarship/facultydevelopmentprograms/ |
| Recommended Organizations |
201010 |
/celts/resources/forstudents/recommendedorganizations/ |
| Ignatian Critical Reflection |
201011 |
/celts/resources/forfacultyandstaff/ignatiancriticalreflection/ |
| Loyola & Our Neighbors |
201012 |
https://www.luc.edu/media/lucedu/celts/celtspdfs/loyola-and-our-neighbors.pdf |
| Loyola History Timelines |
201013 |
https://www.luc.edu/media/lucedu/celts/celtspdfs/Loyola%20History%20Timelines.pdf |
| Risk Management |
54181 |
/celts/programs/academicinternship/forfacultyandstaff/riskmanagement/ |
| LOCUS |
43362 |
/celts/programs/academicinternship/forfacultyandstaff/locus/ |
| Upcoming Programs |
51862 |
/celts/programs/academicinternship/forfacultyandstaff/upcomingprograms/ |
| For Students |
29889 |
/celts/programs/academicinternship/forstudents/ |
| Seeking Academic Internships |
37676 |
/celts/programs/academicinternship/forstudents/seekingacademicinternships/ |
| Internship Contacts by Department and School |
71203 |
/celts/programs/academicinternship/forstudents/seekingacademicinternships/internshipcontactsbydepartmentandschool/ |
| Academic Internship Courses |
37692 |
/celts/programs/academicinternship/forstudents/seekingacademicinternships/academicinternshipcourses/ |
| EXPL 390: Internship Seminar |
45267 |
/celts/programs/academicinternship/forstudents/seekingacademicinternships/academicinternshipcourses/expl390internshipseminar/ |
| Faculty Contacts |
43082 |
/celts/programs/academicinternship/forstudents/seekingacademicinternships/facultycontacts/ |
| Timeline |
43682 |
/celts/programs/academicinternship/forstudents/seekingacademicinternships/timeline/ |
| Frequently Asked Questions |
87571 |
/celts/programs/academicinternship/forstudents/seekingacademicinternships/frequentlyaskedquestions/ |
| Enrolled in an Academic Internship Course |
37680 |
/celts/programs/academicinternship/forstudents/enrolledinanacademicinternshipcourse/ |
| Documenting Your Academic Internship |
104820 |
/celts/programs/academicinternship/forstudents/enrolledinanacademicinternshipcourse/documentingyouracademicinternship/ |
| Writing Learning Goals for Your Academic Internship |
96329 |
/celts/programs/academicinternship/forstudents/enrolledinanacademicinternshipcourse/writinglearninggoalsforyouracademicinternship/ |
| Reporting Problems |
104823 |
/celts/programs/academicinternship/forstudents/enrolledinanacademicinternshipcourse/reportingproblems/ |
| Now What? Extend your Academic Experience |
104824 |
/celts/programs/academicinternship/forstudents/enrolledinanacademicinternshipcourse/nowwhatextendyouracademicexperience/ |
| Unpaid Academic Internship Award |
157324 |
/celts/studentlearning/unpaidacademicinternshipaward/ |
| For Partners |
29890 |
/celts/programs/academicinternship/forpartners/ |
| Recruiting Interns |
37682 |
/celts/programs/academicinternship/forpartners/recruitinginterns/ |
| Writing a job description |
48914 |
/celts/programs/academicinternship/forpartners/writingajobdescription/ |
| Learning Objectives & Goals |
59432 |
/celts/programs/academicinternship/forpartners/learningobjectivesgoals/ |
| Partnership Statement |
117820 |
/celts/programs/academicinternship/forpartners/partnershipstatement/ |
| Learning Portfolio Program |
17070 |
/celts/programs/learningportfolio/ |
| Students |
17074 |
/celts/programs/learningportfolio/students/ |
| Classes |
70841 |
/celts/programs/learningportfolio/students/classes/ |
| Taskstream Archives |
158846 |
/celts/programs/learningportfolio/students/taskstreamarchives/ |
| About Learning Portfolios |
100573 |
/celts/programs/learningportfolio/aboutlearningportfolios/ |
| Faculty/Staff |
17073 |
/celts/programs/learningportfolio/facultystaff/ |
| Engaged Learning Assessment |
87211 |
/celts/programs/engagedlearning/studentresources/engagedlearningassessment/ |
| Learning Portfolio Gallery |
70961 |
/celts/programs/learningportfolio/learningportfoliogallery/ |
| Contact Us |
70962 |
/celts/programs/learningportfolio/contactus/ |
| News |
88261 |
/celts/eportfolio/news/ |
| Stories |
60495 |
/celts/eportfolio/news/stories/ |
| archive |
60496 |
/celts/eportfolio/news/stories/archive/ |
| Student Reflection Guide |
101291 |
/celts/programs/learningportfolio/studentreflectionguide/ |
| Getting Started with Digication |
197899 |
/celts/programs/learningportfolio/gettingstartedwithdigication/ |
| Digication Portfolios |
197896 |
/celts/programs/learningportfolio/digicationportfolios/ |
| Course Space: Digication Kora |
197897 |
/celts/programs/learningportfolio/coursespacedigicationkora/ |
| Course Space: Digication Classic |
197898 |
/celts/programs/learningportfolio/coursespacedigicationclassic/ |
| Service-Learning |
15294 |
/celts/programs/service-learning/ |
| Learning & Serving |
15018 |
/celts/programs/service-learning/overview.shtml |
| right_column |
57383 |
/celts/programs/service-learning/learningserving/rightcolumn/ |
| S-L Program Staff |
200562 |
/celts/programs/service-learning/learningserving/s-lprogramstaff/ |
| Profiles |
200563 |
/celts/programs/service-learning/learningserving/s-lprogramstaff/profiles/ |
| For Students |
15022 |
/celts/programs/service-learning/forstudents/ |
| Why Serve? |
68933 |
/celts/programs/service-learning/forstudents/whyserve/ |
| How Do I Serve? |
68934 |
/celts/programs/service-learning/forstudents/howdoiserve/ |
| Learning & Serving Safely |
60007 |
/celts/programs/service-learning/forstudents/howdoiserve/learningservingsafely/ |
| Where Can I Serve? |
60008 |
/celts/programs/service-learning/forstudents/wherecaniserve/ |
| Service-Learning Courses |
15017 |
/celts/programs/service-learning/forstudents/courses.shtml |
| Recommended Organizations |
200571 |
/celts/resources/forstudents/recommendedorganizations/ |
| For Faculty |
14959 |
/celts/programs/service-learning/forfaculty/ |
| Service-Learning Pedagogy |
83634 |
/celts/programs/service-learning/forfaculty/service-learningpedagogy/ |
| Benefits of S-L |
14961 |
/celts/programs/service-learning/forfaculty/benefitsofs-l/ |
| Course Design Resources |
14962 |
/celts/programs/service-learning/forfaculty/coursedesignresources/ |
| Faculty Development Programs |
197025 |
/celts/engagedteachingscholarship/facultydevelopmentprograms/ |
| Service-Learning Documentation |
35506 |
/celts/programs/service-learning/forfaculty/service-learningdocumentation/ |
| Curriculum Resources |
14964 |
/celts/programs/service-learning/forfaculty/curriculumresources/ |
| Resources on Reflection |
14963 |
/celts/programs/service-learning/forfaculty/resourcesonreflection/ |
| New Course Development |
53441 |
/celts/programs/service-learning/forfaculty/newcoursedevelopment/ |
| right_column |
66500 |
/celts/programs/service-learning/forfaculty/rightcolumn/ |
| Service-Learning Course Criteria |
86748 |
/celts/programs/service-learning/forfaculty/service-learningcoursecriteria/ |
| Ignatian Critical Reflection |
124167 |
/celts/programs/service-learning/forfaculty/ignatiancriticalreflection/ |
| Recommended Organizations |
200573 |
/celts/resources/forstudents/recommendedorganizations/ |
| For Partners |
14996 |
/celts/programs/service-learning/forpartners/ |
| Partnering for Mission |
56885 |
/celts/programs/service-learning/forpartners/ |
| Ways to Partner |
14998 |
/celts/programs/service-learning/forpartners/waystopartner/ |
| Where We Serve |
56878 |
/celts/programs/service-learning/forpartners/whereweserve/ |
| Engage Us! |
56882 |
/celts/programs/service-learning/forpartners/engageus/ |
| Partnership Statement |
124722 |
/celts/programs/service-learning/forpartners/partnershipstatement/ |
| Footer |
15301 |
/celts/programs/service-learning/footer/ |
| Stories |
57409 |
/celts/programs/service-learning/stories/ |
| archive |
57410 |
/celts/programs/service-learning/stories/archive/ |
| Undergraduate Research (LUROP) |
14039 |
/celts/programs/undergraduateresearch/ |
| About |
14040 |
/celts/programs/undergraduateresearch/about/ |
| Why Research? |
14108 |
/celts/programs/undergraduateresearch/about/whyresearch/ |
| Contact Us |
14041 |
/celts/programs/undergraduateresearch/about/contactus/ |
| LUROP Student Survey |
62502 |
/celts/programs/undergraduateresearch/about/luropstudentsurvey/ |
| LUROP Mentor Survey |
68603 |
/celts/programs/undergraduateresearch/about/luropmentorsurvey/ |
| Loyola Research Labs |
57461 |
/celts/programs/undergraduateresearch/about/loyolaresearchlabs/ |
| For Students |
59377 |
/celts/programs/undergraduateresearch/forstudents/ |
| Current Fellows |
118394 |
/celts/programs/undergraduateresearch/forstudents/currentfellows/ |
| How to Get Started |
14059 |
/celts/programs/undergraduateresearch/forstudents/howtogetstarted/ |
| How to Find a Mentor |
37476 |
/celts/programs/undergraduateresearch/forstudents/howtofindamentor/ |
| How to Develop a Research Project |
111652 |
/celts/programs/undergraduateresearch/forstudents/howtodeveloparesearchproject/ |
| On-Campus Research Opportunities |
117329 |
/celts/programs/undergraduateresearch/forstudents/howtodeveloparesearchproject/on-campusresearchopportunities/ |
| Off-Campus Research Opportunities |
117330 |
/celts/programs/undergraduateresearch/forstudents/howtodeveloparesearchproject/off-campusresearchopportunities/ |
| How to Fund Your Research |
111653 |
/celts/programs/undergraduateresearch/forstudents/howtofundyourresearch/ |
| How to Apply |
106753 |
/celts/programs/undergraduateresearch/forstudents/howtoapply/ |
| Online Application |
106754 |
https://webapps2.luc.edu/lurop/login/login |
| Application Information |
59103 |
/celts/programs/undergraduateresearch/forstudents/howtoapply/applicationinformation/ |
| How to Present Your Research |
200986 |
/celts/symposium/resources/ |
| Research FAQs |
64547 |
/celts/programs/undergraduateresearch/forstudents/researchfaqs/ |
| Research Courses |
59380 |
/celts/programs/undergraduateresearch/forstudents/researchcourses/ |
| STEM Lab Websites |
59378 |
/celts/programs/undergraduateresearch/forstudents/stemlabwebsites/ |
| Social Science Lab Websites |
59379 |
/celts/programs/undergraduateresearch/forstudents/socialsciencelabwebsites/ |
| right_column |
86814 |
/celts/programs/undergraduateresearch/forstudents/rightcolumn/ |
| For Mentors |
14104 |
/celts/programs/undergraduateresearch/resources.shtml |
| Responsible Research |
111661 |
/ors/index.shtml |
| For Mentors and Researchers |
62046 |
/celts/programs/undergraduateresearch/formentors/formentorsandresearchers/ |
| Resources for Mentors |
60949 |
/celts/programs/undergraduateresearch/formentors/formentorsandresearchers/resourcesformentors/ |
| LUROP Workshop Resources |
47810 |
/celts/programs/undergraduateresearch/formentors/luropworkshopresources/ |
| Key Loyola Offices/Programs |
43034 |
/celts/programs/undergraduateresearch/formentors/keyloyolaofficesprograms/ |
| archive |
61192 |
/celts/programs/undergraduateresearch/formentors/keyloyolaofficesprograms/archive/ |
| Learning Portfolios |
59507 |
/celts/programs/undergraduateresearch/formentors/learningportfolios/ |
| Research Guides/Lists |
59266 |
/celts/programs/undergraduateresearch/formentors/researchguideslists/ |
| archive |
59312 |
/celts/programs/undergraduateresearch/formentors/researchguideslists/archive/ |
| Critical Reflection Guide |
179637 |
https://www.luc.edu/celts/resources/forfacultyandstaff/ignatiancriticalreflection/ |
| Fellowships |
14056 |
/celts/programs/undergraduateresearch/fellowships/ |
| Application Suggestions |
53127 |
/celts/programs/undergraduateresearch/fellowships/applicationsuggestions/ |
| Old Provost Fellowship Site |
14061 |
/celts/programs/undergraduateresearch/fellowships/oldprovostfellowshipsite/ |
| Old Provost Application FAQs |
14062 |
/celts/programs/undergraduateresearch/fellowships/oldprovostapplicationfaqs/ |
| Information for Faculty |
14105 |
/celts/programs/undergraduateresearch/fellowships/informationforfaculty/ |
| Mulcahy Scholars, 2013-14 |
62142 |
/celts/programs/undergraduateresearch/fellowships/mulcahyscholars2013-14/ |
| Research Mentoring Program Fellows, Summer 2013 |
62370 |
/celts/programs/undergraduateresearch/fellowships/researchmentoringprogramfellowssummer2013/ |
| Rudis Fellows, 2013-14 |
62371 |
/celts/programs/undergraduateresearch/fellowships/rudisfellows2013-14/ |
| Ricci Scholars, 2013-14 |
62372 |
/celts/programs/undergraduateresearch/fellowships/riccischolars2013-14/ |
| Biology Research Fellows |
62374 |
/celts/programs/undergraduateresearch/fellowships/biologyresearchfellows/ |
| Biology Summer Research Fellows, Summer 2013 |
62375 |
/celts/programs/undergraduateresearch/fellowships/biologysummerresearchfellowssummer2013/ |
| Carbon Fellows |
62376 |
/celts/programs/undergraduateresearch/fellowships/carbonfellows/ |
| IES Undergraduate Research Fellows, 2013-14 |
62377 |
/celts/programs/undergraduateresearch/fellowships/iesundergraduateresearchfellows2013-14/ |
| Center for Interdisciplinary Thinking |
86330 |
/celts/programs/undergraduateresearch/fellowships/centerforinterdisciplinarythinking/ |
| right_column |
86822 |
/celts/programs/undergraduateresearch/fellowships/rightcolumn/ |
| Biology Research Fellowship Program |
106741 |
https://www.luc.edu/biology/research/fellowshipresearchprogram/ |
| Biology Summer Research Fellowship Program |
106742 |
https://www.luc.edu/biology/research/fellowshipresearchprogram/ |
| Carbon Undergraduate Research Fellowship |
106743 |
https://www.luc.edu/sustainability/research/studentfellowships/carbon_fellowships/index.shtml |
| Carroll and Adelaide Johnson Scholarship |
106744 |
https://www.luc.edu/gannon/Johnson_Scholarship.shtml |
| Center for Urban Research and Learning (CURL) Fellowship |
106745 |
https://www.luc.edu/curl/undergraduatefellowships/ |
| Community Research Fellowship |
100729 |
/celts/programs/undergraduateresearch/fellowships/communityresearchfellowship/ |
| School of Environmental Sustainability (IES) Undergraduate Research Fellowship |
106746 |
https://www.luc.edu/sustainability/research/studentfellowships/undergrad-research/index.shtml |
| Interdisciplinary Research Fellowship |
100740 |
/celts/programs/undergraduateresearch/fellowships/interdisciplinaryresearchfellowship/ |
| John Grant Fellowships for Research in Bioethics |
168185 |
/celts/programs/undergraduateresearch/fellowships/johngrantfellowshipsforresearchinbioethics/ |
| Mulcahy Scholars Program |
106748 |
https://www.luc.edu/cas/academics_mulcahyscholarship.shtml |
| Provost Fellowship |
55600 |
/celts/programs/undergraduateresearch/fellowships/provostfellowship/ |
| Provost Fellowship Events |
62078 |
/celts/programs/undergraduateresearch/fellowships/provostfellowship/provostfellowshipevents/ |
| Ricci Scholars Program |
106750 |
https://www.luc.edu/ricci/ |
| Rudis Fellowship Program |
106751 |
https://www.luc.edu/politicalscience/rudis.shtml |
| Social Justice Research Fellowship |
64152 |
/celts/programs/undergraduateresearch/fellowships/socialjusticeresearchfellowship/ |
| Women in Science Enabling Research (WISER) |
106752 |
https://www.luc.edu/gannon/wiser.shtml |
| Research Experience for Teachers in Biodiversity Studies |
191522 |
https://www.luc.edu/education/research/grantsandprojects/pre-ret/ |
| Symposium |
186808 |
https://www.luc.edu/celts/symposium/ |
| Research |
14064 |
/celts/programs/undergraduateresearch/research/ |
| Faculty Research Listing |
14065 |
/celts/programs/undergraduateresearch/research/facultyresearchlisting/ |
| Footer |
14069 |
/celts/programs/undergraduateresearch/footer/ |
| Student Employment |
15007 |
/celts/programs/sep_landing_page.shtml |
| Student Employment - Community-based Federal Work-Study Employment Sites |
15006 |
/celts/programs/student_employment.shtml |
| Engaged Teaching/Scholarship |
159340 |
/celts/engagedteachingscholarship/ |
| The Scholarship of Engagement |
159370 |
/celts/engagedteachingscholarship/thescholarshipofengagement/ |
| Faculty Development Programs |
65201 |
/celts/engagedteachingscholarship/facultydevelopmentprograms/ |
| Faculty Certificate in Experiential Learning |
104214 |
/celts/engagedteachingscholarship/facultydevelopmentprograms/facultycertificateinexperientiallearning/ |
| Experiential Learning Scholars |
109800 |
/celts/engagedteachingscholarship/facultydevelopmentprograms/facultycertificateinexperientiallearning/experientiallearningscholars/ |
| Write Now! Workshop Series |
114301 |
/celts/engagedteachingscholarship/facultydevelopmentprograms/writenowworkshopseries/ |
| Faculty Fellows |
197026 |
/celts/engagedteachingscholarship/engagedscholarsfacultyfellows/ |
| ENGAGED LEARNING COMMUNITY OF PRACTICE |
162238 |
/celts/engagedteachingscholarship/facultydevelopmentprograms/engagedlearningcommunityofpractice/ |
| Anti-Racist and Social Justice Pedagogy Programs |
149700 |
/celts/engagedteachingscholarship/facultydevelopmentprograms/anti-racistandsocialjusticepedagogyprograms/ |
| The Activist Academic |
112752 |
/celts/engagedteachingscholarship/facultydevelopmentprograms/anti-racistandsocialjusticepedagogyprograms/theactivistacademic/ |
| Academic Internship Faculty Learning Community |
193954 |
/celts/engagedteachingscholarship/facultydevelopmentprograms/academicinternshipfacultylearningcommunity/ |
| Active Learning Book Group |
205569 |
/celts/engagedteachingscholarship/facultydevelopmentprograms/activelearningbookgroup/ |
| Engaged Scholars Faculty Fellows |
127049 |
/celts/engagedteachingscholarship/engagedscholarsfacultyfellows/ |
| 2026 - 2028 Engaged Scholars Faculty Fellows: |
198419 |
/celts/engagedteachingscholarship/engagedscholarsfacultyfellows/2026-2028engagedscholarsfacultyfellows/ |
| Previous Faculty Fellows |
198418 |
/celts/engagedteachingscholarship/engagedscholarsfacultyfellows/previousfacultyfellows/ |
| Innovative/Experiential Pedagogies Faculty Fellows 2022 – 2024 |
185813 |
/celts/engagedteachingscholarship/engagedscholarsfacultyfellows/innovativeexperientialpedagogiesfacultyfellows20222024/ |
| 2022 - 2024 Faculty Fellows |
186441 |
/celts/engagedteachingscholarship/engagedscholarsfacultyfellows/2022-2024facultyfellows/ |
| Culturally Aware Mentoring for Undergraduate Research Faculty Fellowship |
196183 |
/celts/engagedteachingscholarship/culturallyawarementoringforundergraduateresearchfacultyfellowship/ |
| CELTS Awards |
166083 |
/celts/engagedteachingscholarship/celtsawards/ |
| CELTS Scholarship |
167135 |
/celts/engagedteachingscholarship/celtsscholarship/ |
| Scholarship of Teaching and Learning |
147841 |
/celts/engagedteachingscholarship/scholarshipofteachingandlearning/ |
| Student Learning |
14955 |
/celts/studentlearning/ |
| CELTS EXPL Courses |
15115 |
/celts/studentlearning/celtsexplcourses/ |
| Social Justice Initiatives |
81962 |
/celts/studentlearning/socialjusticeinitiatives/ |
| Social Justice Internship |
19082 |
/celts/studentlearning/socialjusticeinitiatives/sjinternship/ |
| Current Social Justice Interns |
52925 |
/celts/studentlearning/socialjusticeinitiatives/sjinternship/currentsocialjusticeinterns/ |
| Internship Descriptions |
19091 |
/celts/studentlearning/socialjusticeinitiatives/sjinternship/internshipdescriptions/ |
| Past Cohorts |
203933 |
/celts/studentlearning/socialjusticeinitiatives/sjinternship/pastcohorts/ |
| Social Justice Fellowship |
65172 |
https://www.luc.edu/celts/programs/undergraduateresearch/fellowships/socialjusticeresearchfellowship/ |
| Social Justice Photo Contest |
52795 |
/celts/studentlearning/socialjusticephotocontest/ |
| High Impact Learning Faculty Development Series |
69794 |
/celts/studentlearning/highimpactlearningfacultydevelopmentseries/ |
| CEL Lunch and Learn |
70744 |
/celts/studentlearning/cellunchandlearn/ |
| ASPIRE Scholarship |
128225 |
/celts/studentlearning/aspirescholarship/ |
| Spring 2026 Recipients |
207173 |
/celts/studentlearning/aspirescholarship/spring2026recipients/ |
| Fall 2025 Recipients |
205523 |
/celts/studentlearning/aspirescholarship/fall2025recipients/ |
| Summer 2025 Recipients |
204724 |
/celts/studentlearning/aspirescholarship/summer2025recipients/ |
| Spring 2025 Recipients |
201983 |
/celts/studentlearning/aspirescholarship/spring2025recipients/ |
| Fall 2024 Recipients |
200097 |
/celts/studentlearning/aspirescholarship/fall2024recipients/ |
| Summer 2024 Recipients |
198127 |
/celts/studentlearning/aspirescholarship/summer2024recipients/ |
| Spring 2024 Recipients |
194215 |
/celts/studentlearning/aspirescholarship/spring2024recipients/ |
| Fall 2023 Recipients |
190343 |
/celts/studentlearning/aspirescholarship/fall2023recipients/ |
| Summer 2023 Recipients |
188248 |
/celts/studentlearning/aspirescholarship/summer2023recipients/ |
| Spring 2023 Recipients |
184996 |
/celts/studentlearning/aspirescholarship/spring2023recipients/ |
| Fall 2022 Recipients |
181523 |
/celts/studentlearning/aspirescholarship/fall2022recipients/ |
| Summer 2022 Recipients |
180011 |
/celts/studentlearning/aspirescholarship/summer2022recipients/ |
| Spring 2022 Recipients |
168917 |
/celts/studentlearning/aspirescholarship/spring2022recipients/ |
| Fall 2021 Recipients |
168916 |
/celts/studentlearning/aspirescholarship/fall2021recipients/ |
| Summer 2021 Recipients |
166209 |
/celts/studentlearning/aspirescholarship/summer2021recipients/ |
| Spring 2021 Recipients |
159115 |
/celts/studentlearning/aspirescholarship/spring2021recipients/ |
| Fall 2020 Recipients |
156219 |
/celts/studentlearning/aspirescholarship/fall2020recipients/ |
| Unpaid Academic Internship Award |
157322 |
/celts/studentlearning/unpaidacademicinternshipaward/ |
| Spring 2026 Recipients |
207175 |
/celts/studentlearning/unpaidacademicinternshipaward/spring2026recipients/ |
| Fall 2025 Recipients |
205419 |
/celts/studentlearning/unpaidacademicinternshipaward/fall2025recipients/ |
| Spring 2025 Recipients |
201984 |
/celts/studentlearning/unpaidacademicinternshipaward/spring2025recipients/ |
| Fall 2024 Recipients |
200120 |
/celts/studentlearning/unpaidacademicinternshipaward/fall2024recipients/ |
| Spring 2024 Recipients |
194213 |
/celts/studentlearning/unpaidacademicinternshipaward/spring2024recipients/ |
| Fall 2023 Recipients |
190701 |
/celts/studentlearning/unpaidacademicinternshipaward/fall2023recipients/ |
| Spring 2023 Recipients |
184995 |
/celts/studentlearning/unpaidacademicinternshipaward/spring2023recipients/ |
| Fall 2022 Recipients |
181581 |
/celts/studentlearning/unpaidacademicinternshipaward/fall2022recipients/ |
| Fall 2021 Recipients |
168077 |
/celts/studentlearning/unpaidacademicinternshipaward/fall2021recipients/ |
| Fall 2020 Recipients |
157323 |
/celts/studentlearning/unpaidacademicinternshipaward/fall2020recipients/ |
| Resources |
15113 |
/celts/resources/ |
| For Students |
62672 |
/celts/resources/forstudents/ |
| Take Action! |
15120 |
/celts/resources/forstudents/cprg.shtml |
| Recommended Organizations |
86129 |
/celts/resources/forstudents/recommendedorganizations/ |
| Where We Served |
86128 |
/celts/resources/forstudents/whereweserved/ |
| Handshake |
15114 |
https://www.luc.edu/career/handshake/ |
| Engaged Learning in LOCUS |
96336 |
/celts/resources/forstudents/engagedlearninginlocus/ |
| Incident Report |
15119 |
/celts/incident_report.shtml |
| Spring Non-Profit Fair |
75283 |
/celts/resources/forstudents/springnon-profitfair/ |
| Specific Programs |
81963 |
/celts/resources/forstudents/specificprograms/ |
| Social Media Guidelines |
124703 |
/celts/resources/forstudents/socialmediaguidelines/ |
| Pathways to Engagement |
154670 |
/celts/resources/forstudents/pathwaystoengagement/ |
| Frequently Asked Questions about Engaged Learning |
198837 |
/celts/resources/forstudents/frequentlyaskedquestionsaboutengagedlearning/ |
| Schedule an Appointment |
157022 |
https://luc.navigate.eab.com/app/#!/authentication/remote/ |
| CELTS Community Partners Near the Lakeshore Campus |
203693 |
/celts/resources/forstudents/celtscommunitypartnersnearthelakeshorecampus/ |
| For Faculty and Staff |
62673 |
/celts/resources/forfacultyandstaff/ |
| Faculty Development Programs |
186026 |
/celts/engagedteachingscholarship/facultydevelopmentprograms/ |
| Faculty Resources for Engaged Learning |
186028 |
/celts/programs/engagedlearning/facultyresources/ |
| Engaged Learning Course Proposal Form |
46673 |
/celts/resources/forfacultyandstaff/engagedlearningcourseproposalform/ |
| Frequently Asked Questions about Engaged Learning? |
201004 |
https://www.luc.edu/media/lucedu/celts/Engaged%20Learning%20FAQs.pdf |
| Documenting on LOCUS |
83790 |
/celts/resources/forfacultyandstaff/documentingonlocus/ |
| Recommended Organizations |
200606 |
/celts/resources/forstudents/recommendedorganizations/ |
| Faculty Resource Tool Kit |
196040 |
/celts/resources/forfacultyandstaff/facultyresourcetoolkit/ |
| Active / Engaged Learning |
196143 |
/celts/resources/forfacultyandstaff/facultyresourcetoolkit/activeengagedlearning/ |
| Justice-Rooted Pedagogy |
196144 |
/celts/resources/forfacultyandstaff/facultyresourcetoolkit/justice-rootedpedagogy/ |
| Grading & Assessment |
196145 |
/celts/resources/forfacultyandstaff/facultyresourcetoolkit/gradingassessment/ |
| Critical Reflection |
196141 |
/celts/resources/forfacultyandstaff/facultyresourcetoolkit/criticalreflection/ |
| Working with Community Partners |
196147 |
/celts/resources/forfacultyandstaff/facultyresourcetoolkit/workingwithcommunitypartners/ |
| Undergraduate Research |
196148 |
/celts/resources/forfacultyandstaff/facultyresourcetoolkit/undergraduateresearch/ |
| Community Based Learning |
196149 |
/celts/resources/forfacultyandstaff/facultyresourcetoolkit/communitybasedlearning/ |
| Ignatian Critical Reflection |
124302 |
/celts/resources/forfacultyandstaff/ignatiancriticalreflection/ |
| Loyola & Our Neighbors |
201005 |
https://www.luc.edu/media/lucedu/celts/celtspdfs/loyola-and-our-neighbors.pdf |
| Loyola History Timelines |
201006 |
https://www.luc.edu/media/lucedu/celts/celtspdfs/Loyola%20History%20Timelines.pdf |
| Social Media Guidelines |
124705 |
/celts/resources/forfacultyandstaff/socialmediaguidelines/ |
| Risk Management |
200605 |
/celts/programs/academicinternship/forfacultyandstaff/riskmanagement/ |
| CELTS Community Partners Near the Lakeshore Campus |
203692 |
/celts/resources/forfacultyandstaff/celtscommunitypartnersnearthelakeshorecampus/ |
| For Community Partners |
62674 |
/celts/resources/forcommunitypartners/ |
| Partnership Agreement |
163119 |
https://www.luc.edu/media/lucedu/experiential/pdfs/CELTS%20Partnership%20Statement.pdf |
| Program Support Resources |
184878 |
/celts/resources/forcommunitypartners/programsupportresources/ |
| Types of Student Placements |
88623 |
/celts/resources/forcommunitypartners/typesofstudentplacements/ |
| Community Partner Events |
107384 |
/celts/resources/forcommunitypartners/communitypartnerevents/ |
| Recruiting Timeline |
88622 |
/celts/resources/forcommunitypartners/recruitingtimeline/ |
| Working with Faculty Toolkit |
204040 |
/celts/resources/forcommunitypartners/workingwithfacultytoolkit/ |
| Creating & Posting Job Descriptions |
88294 |
/celts/resources/forcommunitypartners/creatingpostingjobdescriptions/ |
| Community Partner Fellowship Program |
206697 |
/celts/resources/forcommunitypartners/communitypartnerfellowshipprogram/ |
| Home Visit Policy |
86133 |
/celts/resources/forcommunitypartners/homevisitpolicy/ |
| Community Engagement Awards |
107395 |
/celts/resources/forcommunitypartners/communityengagementawards/ |
| CELTS Learning Outcomes |
117424 |
/celts/resources/forcommunitypartners/celtslearningoutcomes/ |
| Learning Competencies |
120534 |
/celts/resources/forcommunitypartners/learningcompetencies/ |
| Social Media Guidelines |
126838 |
/celts/resources/forcommunitypartners/socialmediaguidelines/ |
| Conceptual Framework of Partnership |
147383 |
/celts/resources/forcommunitypartners/conceptualframeworkofpartnership/ |
| CELTS Community Partners Near the Lakeshore Campus |
203691 |
/celts/resources/forcommunitypartners/celtscommunitypartnersnearthelakeshorecampus/ |
| Engaged Learning |
150029 |
/celts/programs/engagedlearning/ |
| Annual Impact Report |
151778 |
https://www.luc.edu/media/lucedu/celts/impactreports/celts-impact-report2024.pdf |
| Anchor Mission |
124551 |
/celts/resources/anchormission/ |
| About Anchor Mission |
124557 |
/celts/resources/anchormission/ |
| Buy Local |
124559 |
/celts/resources/anchormission/buylocal/ |
| Dine Local |
124555 |
/celts/resources/anchormission/dinelocal/ |
| Resources |
124558 |
/celts/resources/anchormission/resources/ |
| Task Force |
124694 |
/celts/resources/anchormission/taskforce/ |
| Stay Informed |
191041 |
/celts/stayinformed/ |
| Newsletter for Faculty |
115607 |
/celts/stayinformed/newsletterforfaculty/ |
| Newsletter for Partners |
188087 |
/celts/stayinformed/newsletterforpartners/ |
| Newsletter for Students |
70148 |
/celts/stayinformed/newsletterforstudents/ |
| Symposium |
142385 |
/celts/symposium/ |
| Ways to Participate |
142387 |
/celts/symposium/waystoparticipate/ |
| Resources |
166415 |
/celts/symposium/resources/ |
| Research Posters |
142390 |
/celts/symposium/resources/researchposters/ |
| Including Audio in Presentations |
142392 |
/celts/symposium/resources/includingaudioinpresentations/ |
| Community Engagement Project Posters |
142391 |
/celts/symposium/resources/communityengagementprojectposters/ |
| FAQs |
142393 |
/celts/symposium/faqs/ |
| About |
14937 |
/celts/about/ |
| CELTS Staff |
186182 |
/celts/about/celtsstaff/ |
| Profiles |
186183 |
/celts/about/celtsstaff/profiles/ |
| Undergraduate Program Assistants |
98584 |
/celts/about/undergraduateprogramassistants/ |
| Contact Us |
14938 |
/celts/contact.shtml |
| CELTS Framework |
104207 |
/celts/about/celtsframework/ |
| Featured Learning Portfolios |
112633 |
/celts/about/featuredlearningportfolios/ |
| Commitment to Diversity, Inclusion, Equity, Anti-Racism and Anti-Oppression Statement |
124927 |
/celts/about/commitmenttodiversityinclusionequityanti-racismandanti-oppressionstatement/ |
| Carnegie Community Engagement Classification |
201907 |
/celts/about/carnegiecommunityengagementclassification/ |
| Annual Impact Report |
151779 |
https://www.luc.edu/media/lucedu/celts/impactreports/celts-impact-report2024.pdf |
| Land Acknowledgment Statement |
166098 |
/celts/about/landacknowledgmentstatement/ |
| COS16 |
55639 |
/celts/cos16/ |
| Assets (DO NOT DELETE) |
201356 |
/celts/assetsdonotdelete/ |
| Center for Faculty Development |
204657 |
/centerforfacultydevelopment/ |
| site_logo |
204658 |
/centerforfacultydevelopment-dev/sitelogo/ |
| Recognition |
206600 |
/centerforfacultydevelopment/recognition/ |
| Center for Immigrant and Refugee Accompaniment |
117859 |
/cira-dev/ |
| About Us |
117870 |
/cira-dev/about,us/About Us |
| Leadership |
168145 |
/cira-dev/about,us/leadership/Leadership |
| Affiliates |
168146 |
/cira-dev/about,us/affiliates/Affiliates |
| Programming |
117865 |
/cira-dev/programs/Programs |
| Migration Studies Track |
117866 |
/cira-dev/programs/migrationstudiestrack/ |
| International Fieldwork and Service Learning Internship Program |
117867 |
/cira-dev/programs/internationalfieldworkandservicelearninginternshipprogram/ |
| Spanish for Social Workers |
117869 |
/cira-dev/programs/spanishforsocialworkers/ |
| Partnerships |
168148 |
/cira-dev/partnerships/Partnerships |
| Center Projects |
117864 |
/cira-dev/centerprojects/ |
| Scholarship |
168071 |
/cira-dev/scholarship/ |
| Publications |
117860 |
/cira-dev/publications/ |
| Events |
168149 |
/cira/events/Events |
| 6th. Virtual Regional Conference |
167581 |
/cira-dev/events/6thvirtualregionalconference/ |
| The Physical and Emotional Impact of Covid-19 On Immigrants: Health & Policy Implications |
168150 |
/cira/events/cira,event/CIRA Event |
| site_logo |
117863 |
/cira/sitelogo/index.shtml |
| Footer |
203306 |
/cira-dev/footer/ |
| social media |
203308 |
/cira-dev/socialmedia/ |
| cta |
203309 |
/cira-dev/cta/ |
| Center for Science and Math Education (CSME) |
188572 |
/csme/ |
| Test Page |
190475 |
/csme/testpage/ |
| site_logo |
188602 |
/csme/sitelogo/ |
| Footer |
188603 |
/csme/footer/ |
| social media |
188604 |
/csme/socialmedia/ |
| modules-programming |
188605 |
/csme/modules-programming/ |
| cta |
188612 |
/csme/cta/ |
| I Links |
188613 |
/csme/ilinks/ |
| Profiles |
188852 |
/csme/profiles/ |
| Timothy Stoelinga |
188854 |
/csme/profiles/timothystoelinga/ |
| Julie Jacobi |
188855 |
/csme/profiles/juliejacobi/ |
| Patrick Daubenmire |
188856 |
/csme/profiles/patrickdaubenmire/ |
| Kayla Cherry |
188857 |
/csme/profiles/kaylacherry/ |
| Elijah K. Hurnes |
188858 |
/csme/profiles/elijahkhurnes/ |
| Saswati Koya |
188860 |
/csme/profiles/saswatikoya/ |
| Sarah Stults |
188861 |
/csme/profiles/sarahstults/ |
| Nina Hike |
188870 |
/csme/profiles/ninahike/ |
| Melissa Sears |
199562 |
/csme/profiles/melissasears/ |
| Jenny Croitoru (Archived #1) |
204090 |
/csme/profiles/jennycroitoruarchived1/ |
| Dre Parker |
204142 |
/csme/profiles/dreparker/ |
| Claire Trainer (Archived #2) |
204502 |
/csme/profiles/clairetrainerarchived2/ |
| Stephanie Morales (Archived #3) |
205203 |
/csme/profiles/stephaniemoralesarchived3/ |
| Mariel Melesio |
207346 |
/csme/profiles/marielmelesio/ |
| CSME News |
205204 |
/csme/csmenews/ |
| Loyola CSME Celebrates 2026 Golden Apple Award Recipients! |
207379 |
/csme/loyolacsmecelebrates2026goldenappleawardrecipients/ |
| Beyond100K Summit 2025! |
205319 |
/csme/beyond100ksummit2025/ |
| CARE 6-12 Brings Environmental Research to Chicago Public Schools |
204077 |
/csme/care6-12bringsenvironmentalresearchtochicagopublicschools/ |
| Celebrating Seven Years of Innovation: The CFC and CSME Partnership |
203156 |
/csme/celebratingsevenyearsofinnovationthecfcandcsmepartnership/ |
| CSME Presents at NSTA New Orleans, 2024 |
199692 |
/csme/csmepresentsatnstaneworleans2024/ |
| ETHOS: Building STEM Awareness Through Ethical Communication in Neuroscience |
199993 |
/csme/ethosbuildingstemawarenessthroughethicalcommunicationinneuroscience/ |
| Loyola CSME Hosts the 26th Chicago Symposium Series, Excellence in Teaching Mathematics and Science: Research and Practice |
195138 |
/csme/loyolacsmehoststhe26thchicagosymposiumseriesexcellenceinteachingmathematicsandscienceresearchandpractice/ |
| CSME Team Presents on Science Teacher Leadership at NSTA Denver 2024 |
193727 |
/csme/csmeteampresentsonscienceteacherleadershipatnstadenver2024/ |
| CSME Article on CPS Science Master Teacher Leader Program |
191392 |
/csme/csmearticleoncpssciencemasterteacherleaderprogram/ |
| Welcoming Delegates from Burkina Faso |
191418 |
/csme/welcomingdelegatesfromburkinafaso/ |
| CSME Presents at NSTA Chicago22! |
188796 |
/csme/csmepresentsatnstachicago22/ |
| CSME Science Coach Advocates for Teachers at Legislative Forum |
188797 |
/csme/csmesciencecoachadvocatesforteachersatlegislativeforum/ |
| About Us |
188615 |
/csme/aboutus/ |
| Our Mission |
188622 |
/csme/aboutus/ourmission/ |
| Map of Schools We Support |
188623 |
/csme/aboutus/mapofschoolswesupport/ |
| CSME Team Members |
188624 |
/csme/aboutus/csmeteammembers/ |
| Contact Us |
188625 |
/csme/aboutus/contactus/ |
| K-12 STEM Support |
188661 |
/csme/k-12stemsupport/ |
| AP Summer Training |
188675 |
/csme/k-12stemsupport/apsummertraining/ |
| OpenSciEd Summer PD |
207451 |
/csme/k-12stemsupport/opensciedsummerpd/ |
| Curriculum Adoption |
206952 |
/csme/k-12stemsupport/curriculumadoption/ |
| Professional Learning Services |
188673 |
/csme/k-12stemsupport/professionallearningservices/ |
| AP Institute Housing Form |
168972 |
/csme/k-12stemsupport/apinstitutehousingform/ |
| Thank You |
168973 |
/csme/k-12stemsupport/apinstitutehousingform/thankyou/ |
| Undergraduate STEM |
188695 |
/csme/undergraduatestem/ |
| SEMINAL |
188709 |
https://www.luc.edu/math/stories/ay17-18/archive/stemgrantawardedtomathstatdepartment.shtml |
| Noyce Scholars (National Science Foundation) |
188710 |
https://www.luc.edu/education/admission/financialassistance/scholarships/noycescholars/ |
| Research & Evaluation |
188711 |
/csme/researchevaluation/ |
| Services |
188728 |
/csme/researchandevaluation/services/ |
| Methods |
188727 |
/csme/researchandevaluation/methods/ |
| Clients and Partners |
188729 |
/csme/researchandevaluation/clientsandpartners/ |
| Partnerships |
188676 |
/csme/partnerships/ |
| Big Shoulders Fund |
188691 |
/csme/partnerships/bigshouldersfund/ |
| Polk Bros. Foundation |
188692 |
/csme/partnerships/polkbrosfoundation/ |
| Noyce Scholars (National Science Foundation) |
188693 |
https://www.luc.edu/education/admission/financialassistance/scholarships/noycescholars/ |
| Previous CSME Partnerships |
188694 |
/csme/partnerships/previouscsmepartnerships/ |
| Resources |
188737 |
/csme/resources/ |
| NEXT GENERATION SCIENCE STANDARDS (NGSS) |
188768 |
https://www.nextgenscience.org/ |
| NATIONAL SCIENCE EDUCATION STANDARDS |
188756 |
https://nap.nationalacademies.org/read/4962/chapter/1 |
| ILLINOIS LEARNING STANDARDS - SCIENCE |
188757 |
https://www.isbe.net/Documents/Il-Learning-Standards-Science.pdf |
| COMMON CORE STATE STANDARDS - MATH |
188758 |
https://www.nctm.org/ccssm/ |
| ILLINOIS LEARNING STANDARDS - MATH |
188759 |
https://www.isbe.net/Documents/math-standards.pdf |
| PROJECT 2061 |
188760 |
https://www.aaas.org/programs/project-2061 |
| COMMON CORE STATE STANDARDS - ELA-LITERACY |
188762 |
https://www.isbe.net/Documents/ela-standards.pdf |
| NATIONAL BOARD FOR PROFESSIONAL TEACHING STANDARDS |
188763 |
https://www.nbpts.org/ |
| NATIONAL CENTER FOR SCIENCE EDUCATION |
188764 |
https://ncse.ngo/ |
| NATIONAL COUNCIL OF TEACHERS OF MATHEMATICS |
188765 |
https://www.nctm.org/ |
| NATIONAL SCIENCE TEACHERS ASSOCIATION |
188766 |
https://www.nsta.org/ |
| Center for Student Inclusion and Belonging |
202958 |
/belonging/ |
| site_logo |
202960 |
/belonging/sitelogo/ |
| Footer |
202961 |
/belonging/footer/ |
| About |
205020 |
/belonging/about/ |
| Meet Our Team |
207362 |
/belonging/about/meetourteam/ |
| profiles |
207363 |
/belonging/about/directory/profiles/ |
| Programs and Initiatives |
205021 |
/belonging/programsandinitiatives/ |
| LGBTQIA+ Initiatives |
207316 |
/belonging/programsandinitiatives/lgbtqiainitiatives/ |
| right_column |
207317 |
/belonging/programsandinitiatives/lgbtqiainitiatives/rightcolumn/ |
| Womxn of Color Initiatives |
207354 |
/belonging/programsandinitiatives/womxnofcolorinitiatives/ |
| right_column |
207355 |
/belonging/programsandinitiatives/womxnofcolorinitiatives/rightcolumn/ |
| Monarch Initiatives |
207365 |
/belonging/programsandinitiatives/monarchinitiatives/ |
| right_column |
207366 |
/belonging/programsandinitiatives/monarchinitiatives/rightcolumn/ |
| MOSAIC Cultural Initiatives |
207368 |
/belonging/programsandinitiatives/mosaicculturalinitiatives/ |
| right_column |
207369 |
/belonging/programsandinitiatives/mosaicculturalinitiatives/rightcolumn/ |
| First-Generation and Low-Income Initiatives |
207370 |
/belonging/programsandinitiatives/first-generationandlow-incomeinitiatives/ |
| right_column |
207371 |
/belonging/programsandinitiatives/first-generationandlow-incomeinitiatives/rightcolumn/ |
| Events and Partnerships |
206279 |
/belonging/eventsandpartnerships/ |
| Center for Textual Studies and Digital Humanities |
54753 |
/ctsdh/ |
| site_logo |
54754 |
/ctsdh/sitelogo/ |
| Footer |
54755 |
/ctsdh/footer/ |
| social media |
200376 |
/ctsdh/socialmedia/ |
| modules-programming |
200378 |
/ctsdh/modules-programming/ |
| About |
54769 |
/ctsdh/about/ |
| About |
202720 |
/ctsdh/about/about/ |
| Director's Welcome |
54773 |
/ctsdh/about/directorswelcome/ |
| People |
54774 |
/ctsdh/about/people/ |
| Directory |
200407 |
/ctsdh/about/people/directory/ |
| profiles |
200408 |
/ctsdh/about/people/directory/profiles/ |
| right_column |
200409 |
/ctsdh/about/people/directory/profiles/rightcolumn/ |
| Contact Us |
54772 |
/ctsdh/about/contactus/ |
| Events & News |
54766 |
/ctsdh/about/eventsnews/ |
| archive |
200387 |
/ctsdh/about/eventsnews/archive/ |
| Student Life |
202746 |
/ctsdh/studentlife/ |
| Meet Our Students |
202748 |
/ctsdh/studentlife/meetourstudents/ |
| Specialization in Digital Humanities |
202779 |
/ctsdh/studentlife/specializationindigitalhumanities/ |
| Student Resources |
202760 |
/ctsdh/studentlife/studentresources/ |
| Loyola Resources |
202763 |
/ctsdh/studentlife/studentresources/loyolaresources/ |
| DH Across Institutions |
202764 |
/ctsdh/studentlife/studentresources/dhacrossinstitutions/ |
| Academics |
200393 |
https://gpem.luc.edu/portal/program?name=digitalhumanitiesma |
| Work With Us |
54770 |
/ctsdh/workwithus/ |
| Start a Project |
95180 |
/ctsdh/workwithus/startaproject/ |
| Projects at CTSDH |
202788 |
/ctsdh/workwithus/projectsatctsdh/ |
| Services |
54775 |
/ctsdh/services/ |
| Digital Humanities Resources & Toolbox |
202796 |
/ctsdh/services/digitalhumanitiesresourcestoolbox/ |
| DH in the Classroom |
155086 |
/ctsdh/services/dhintheclassroom/ |
| Humanities Datebook |
105107 |
/ctsdh/services/humanitiesdatebook/ |
| CTSDH Mailing List |
202809 |
/ctsdh/services/ctsdhmailinglist/ |
| Archive |
202808 |
/ctsdh/services/archive/ |
| CTSDH Room Reservation |
97907 |
/ctsdh/services/archive/ctsdhroomreservation/ |
| Equipment Reservation |
98418 |
/ctsdh/services/archive/equipmentreservation/ |
| Policy |
98419 |
/ctsdh/services/archive/equipmentreservation/policy/ |
| Reserve |
98420 |
/ctsdh/services/archive/equipmentreservation/reserve/ |
| 3D Printing Guidelines |
101825 |
/ctsdh/services/archive/3dprintingguidelines/ |
| Learning Opportunities |
98417 |
/ctsdh/services/archive/learningopportunities/ |
| Girls Who Code |
105131 |
/ctsdh/girlswhocode/ |
| About |
105233 |
/ctsdh/girlswhocode/about/ |
| People |
105190 |
/ctsdh/girlswhocode/people/ |
| Events & News |
205035 |
/ctsdh/about/eventsnews/ |
| Center For Translational Research and Education |
93356 |
/ctre/ |
| site_logo |
202997 |
/ctre/sitelogo/ |
| Center for Urban Research and Learning |
27458 |
/curl/ |
| About |
27427 |
/curl/About.shtml |
| Contact Us |
27429 |
/curl/contact.shtml |
| Mission |
27431 |
/curl/Mission.shtml |
| Videos |
86100 |
/curl/videos/ |
| Governing Standards |
27755 |
/curl/governing_standards.shtml |
| Newsletters |
27432 |
/curl/newsletters.shtml |
| Media & Public Policy Impact |
27436 |
/curl/Media.shtml |
| PRAG Archive |
60477 |
/curl/pragarchive/ |
| CURL Network Map |
89096 |
/curl/curlnetworkmap/ |
| Foundations and Agencies Funding CURL |
27433 |
/curl/funders.shtml |
| University Partners |
27437 |
/curl/partners_university.shtml |
| 20 Year Celebration |
81285 |
/curl/20yearcelebration/ |
| Phil Nyden's Retirement |
100963 |
/curl/philnydensretirement/ |
| CURL Blog |
27430 |
/curl/CURL_Blog.html |
| News and Events |
198648 |
/curl/newsandevents/ |
| Research |
27599 |
/curl/research.shtml |
| Eminent Domain |
90282 |
/curl/eminentdomain/ |
| Dudley Square |
90285 |
/curl/eminentdomain/dudleysquare/ |
| Team |
27465 |
/curl/curl_team.shtml |
| Staff and Visiting Scholars |
27493 |
/curl/staff/index.shtml |
| Inactive |
183515 |
/curl/staff/inactive/ |
| Fellows |
27478 |
/curl/Fellows.shtml |
| Undergraduate Fellows |
27496 |
/curl/undergraduate_fellows.shtml |
| archive |
53174 |
/curl/archive/ |
| Graduate Fellows |
27479 |
/curl/graduate_fellows.shtml |
| archive |
53175 |
/curl/archive/ |
| Community Fellows |
27474 |
/curl/community_fellows.shtml |
| Fellowship Applications |
27475 |
/curl/fellowship_applications.shtml |
| Undergraduate Fellowships |
105675 |
/curl/undergraduatefellowships/ |
| Graduate Fellowships |
105676 |
/curl/graduatefellowships/ |
| Community Partners |
27467 |
/curl/past_and_present_affiliates_.shtml |
| Faculty |
27468 |
/curl/faculty.shtml |
| Faculty: Getting Involved |
69050 |
/curl/facultygettinginvolved/ |
| Former Visiting Scholars |
83838 |
/curl/formervisitingscholars/ |
| Programs |
27534 |
/curl/programs.shtml |
| Friday Morning Seminars |
35719 |
/curl/fridaymorningseminars/ |
| Upcoming CURL Events |
70984 |
/curl/upcomingcurlevents/ |
| Opportunities for Freshmen |
43555 |
/curl/opportunitiesforfreshmen/ |
| Past CURL Events |
67631 |
/curl/pastcurlevents/ |
| MA in Urban Affairs and Public Policy |
27543 |
/curl/mppmaua.html |
| Kale Williams Scholarship |
58294 |
/curl/kalewilliamsscholarship/ |
| Gateways |
57743 |
/curl/gateways/ |
| eNewsletter |
27501 |
/curl/enewsletter/NewsletterSummer2010.html |
| CURL Newsletter Articles Summer 2010 |
27502 |
/curl/enewsletter/NewsletterSummer2010.html |
| Footer |
27751 |
/curl/footer/ |
| site_logo |
27752 |
/curl/sitelogo/ |
| Stories |
79682 |
/curl/stories/ |
| archive |
79683 |
/curl/stories/archive/ |
| custom_css |
79690 |
/curl/stories/customcss/ |
| CURL and Cook County Domestic Violence Court Release Report |
198655 |
/curl/stories/curlandcookcountydomesticviolencecourtreleasereport/ |
| HEART and CURL |
198656 |
/curl/stories/heartandcurl/ |
| FHP Evaluation |
202985 |
/curl/stories/fhpevaluation/ |
| old seminars |
27412 |
/curl/andersonville.shtml |
| Mailing List |
35840 |
/curl/mailinglist/ |
| Thank You!!! |
35841 |
/curl/mailinglist/thankyou/ |
| archive |
53141 |
/curl/archive/ |
| home_top |
53145 |
/curl/archive/hometop/ |
| home_content |
53143 |
/curl/archive/homecontent/ |
| Chemistry & Biochemistry, Department of |
16439 |
/chemistry/ |
| site_logo |
16548 |
/chemistry/sitelogo/ |
| Footer |
16547 |
/chemistry/footer/ |
| I Links |
198838 |
/chemistry/ilinks/ |
| social media |
198790 |
/chemistry/socialmedia/ |
| modules-programming |
198789 |
/chemistry/modules-programming/ |
| right_column |
47053 |
/chemistry/rightcolumn/ |
| About Us |
16442 |
/chemistry/about.shtml |
| Faculty & Staff |
16447 |
/chemistry/facultystaff/index.shtml |
| Profiles |
198828 |
/chemistry/facultystaff/profiles/ |
| right_column |
198829 |
/chemistry/facultystaff/rightcolumn/ |
| Current Graduate Students |
104683 |
/chemistry/currentgraduatestudents/ |
| Available Positions |
16454 |
/chemistry/positions.html |
| News & Stories |
47055 |
/chemistry/news/ |
| archive |
84982 |
/chemistry/news/archive/ |
| Research Experiences for Undergraduates in Chemistry and Biochemistry |
198793 |
/chemistry/news/researchexperiencesforundergraduatesinchemistryandbiochemistry/ |
| Distinguished Service Award - David Crumrine, Ph.D. |
16497 |
/chemistry/acs_award.shtml |
| Emerging Chemists Workshop Form |
16498 |
/chemistry/emerging_chemists_form.shtml |
| Informational Videos |
84924 |
/chemistry/informationalvideos/ |
| Shared Instrumentation Resources |
116191 |
/chemistry/sharedinstrumentationresources/ |
| Departmental and Group Instrumentation |
116197 |
/chemistry/sharedinstrumentationresources/departmentalandgroupinstrumentation/ |
| NMR/EPR Facilities |
116198 |
/chemistry/sharedinstrumentationresources/nmreprfacilities/ |
| Shared Instrumentation Facility |
116210 |
/chemistry/sharedinstrumentationresources/sharedinstrumentationfacility/ |
| Computational Resources |
116368 |
/chemistry/sharedinstrumentationresources/computationalresources/ |
| Faculty Meeting Minutes |
16446 |
/chemistry/minutes/index.shtml |
| Academics |
16464 |
/chemistry/academics.shtml |
| 5-year BS/MS in Chemistry or Biochemistry |
16463 |
/chemistry/BSMS.shtml |
| Curriculum |
124295 |
/chemistry/curriculum/ |
| Admission |
124296 |
/chemistry/admission/ |
| Tuition |
124297 |
/chemistry/tuition/ |
| Support |
124298 |
/chemistry/support/ |
| Courses |
16469 |
/chemistry/courses.shtml |
| Graduate Programs |
16471 |
/chemistry/graduate_program.shtml |
| Doctor of Philosophy (PhD) |
123986 |
/chemistry/doctorofphilosophyphd/ |
| Curriculum |
124019 |
/chemistry/doctorofphilosophyphd/curriculum/ |
| Admission |
124020 |
/chemistry/doctorofphilosophyphd/admission/ |
| Tuition |
124055 |
/chemistry/doctorofphilosophyphd/tuition/ |
| Support |
124051 |
/chemistry/doctorofphilosophyphd/support/ |
| Master of Science in Chemistry (MS) |
198832 |
https://gpem.luc.edu/portal/program?name=chemistryms |
| Outcomes |
123988 |
/chemistry/outcomes/ |
| Undergraduate Programs |
16476 |
/chemistry/undergraduate_program.shtml |
| Bachelor of Science (B.S.) Major in Chemistry with Emphasis in Biochemistry |
16467 |
/chemistry/undergrad_bsbi.shtml |
| Bachelor of Arts (B.A.) Major in Chemistry- OLD (2022 and earlier) |
16465 |
/chemistry/undergrad_ba.shtml |
| Bachelor of Science (B.S.) Major in Chemistry- OLD (2022 and earlier) |
16466 |
/chemistry/undergrad_bs.shtml |
| Bachelor of Science (B.S.) Major in Biochemistry- OLD (2022 and earlier) |
20299 |
/chemistry/bachelorofsciencebsmajorinbiochemistry-old2022andearlier/ |
| Minor in Chemistry |
16472 |
/chemistry/undergrad_minor.shtml |
| Bachelor of Arts (B.A.) Major in Biochemistry |
159729 |
/chemistry/bachelorofartsbamajorinbiochemistry/ |
| Bachelor of Science (B.S.) Major in Chemistry |
184885 |
/chemistry/undergrad_bs_new.shtml |
| Bachelor of Science (B.S.) Major in Biochemistry |
184886 |
/chemistry/bachelorofsciencebsmajorinbiochemistry/ |
| Bachelor of Arts (B.A.) Major in Chemistry |
184887 |
/chemistry/undergrad_ba_new.shtml |
| Bachelor of Arts (B.A.) Major in Biochemistry |
184888 |
/chemistry/bachelorofartsbamajorinbiochemistry/ |
| CHEMISTRY Course Syllabi |
16468 |
/chemistry/syllabus.shtml |
| AY 2018-2019 |
118685 |
/chemistry/ay2018-2019/ |
| Summer 2018 |
119793 |
/chemistry/summer2018/ |
| AY 2009-2010 |
121817 |
/chemistry/ay2009-2010/ |
| Summer 2011 |
121820 |
/chemistry/summer2011/ |
| AY 2011-2012 |
121821 |
/chemistry/ay2011-2012/ |
| Summer 2012 |
121822 |
/chemistry/summer2012/ |
| AY 2012-2013 |
121824 |
/chemistry/ay2012-2013/ |
| Summer 2013 |
121825 |
/chemistry/summer2013/ |
| AY 2013-2014 |
121826 |
/chemistry/ay2013-2014/ |
| Summer 2014 |
121827 |
/chemistry/summer2014/ |
| AY 2014-2015 |
121828 |
/chemistry/ay2014-2015/ |
| Summer 2015 |
121829 |
/chemistry/summer2015/ |
| AY 2015-2016 |
121830 |
/chemistry/ay2015-2016/ |
| Summer 2016 |
121831 |
/chemistry/summer2016/ |
| AY 2016-2017 |
121832 |
/chemistry/ay2016-2017/ |
| Summer 2017 |
121833 |
/chemistry/summer2017/ |
| AY 2017-2018 |
121834 |
/chemistry/ay2017-2018/ |
| Summer 2019 |
123311 |
/chemistry/summer2019/ |
| AY 2019-2020 |
127470 |
/chemistry/ay2019-2020/ |
| Summer 2020 |
147894 |
/chemistry/summer2020/ |
| AY 2020 - 2021 |
156283 |
/chemistry/ay2020-2021/ |
| Summer 2021 |
160798 |
/chemistry/summer2021/ |
| AY 2021 - 2022 |
166161 |
/chemistry/ay2021-2022/ |
| Summer 2022 |
178332 |
/chemistry/summer2022/ |
| AY 2022 - 2023 |
180371 |
/chemistry/ay2022-2023/ |
| Summer 2023 |
187140 |
/chemistry/summer2023/ |
| AY 2023 - 2024 |
188436 |
/chemistry/ay2023-2024/ |
| Summer 2024 |
195923 |
/chemistry/summer2024/ |
| AY 2024 - 2025 |
198561 |
/chemistry/ay2024-2025/ |
| Summer School |
191724 |
/chemistry/summerschool/ |
| Admission |
16478 |
/chemistry/admission.shtml |
| Financial Aid |
198833 |
https://www.luc.edu/finaid/index.shtml |
| Graduate |
198834 |
https://gpem.luc.edu/portal/admission?tab=admission-process |
| Undergraduate |
198835 |
https://www.luc.edu/undergrad |
| Research |
55129 |
/chemistry/research/ |
| Profiles |
205192 |
/chemistry/research/profiles/ |
| Resources |
16536 |
/chemistry/resources.shtml |
| Library Guides |
198836 |
https://libguides.luc.edu/chemistry |
| Events |
95690 |
/chemistry/events/ |
| Alumni of the Year |
101554 |
/chemistry/events/alumnioftheyear/ |
| Departmental Award Ceremony |
102904 |
/chemistry/events/departmentalawardceremony/ |
| 2020 Awards |
142514 |
/chemistry/events/departmentalawardceremony/2020awards/ |
| 2021 Awards |
160035 |
/chemistry/events/departmentalawardceremony/2021awards/ |
| 2022 Awards |
177505 |
/chemistry/events/departmentalawardceremony/2022awards/ |
| 2023 Awards |
185599 |
/chemistry/events/departmentalawardceremony/2023awards/ |
| 2024 Awards |
195932 |
/chemistry/events/departmentalawardceremony/2024awards/ |
| 2025 Awards |
206539 |
/chemistry/events/departmentalawardceremony/2025awards/ |
| Denkewalter Lecture |
98164 |
/chemistry/events/denkewalterlecture/ |
| 2024 Denkewalter Lecture |
189133 |
/chemistry/events/denkewalterlecture/2024denkewalterlecture/ |
| Former Denkewalter Lecturers |
98167 |
/chemistry/events/denkewalterlecture/formerdenkewalterlecturers/ |
| Chemistry Seminars Fall 2024 |
16489 |
/chemistry/weekly_seminar.shtml |
| Chicago Organic Symposium |
95636 |
/chemistry/events/chicagoorganicsymposium/ |
| Chicago Region JSHS |
54631 |
/chemistry/events/chicagojshs/ |
| Students |
109734 |
/chemistry/events/students/ |
| Forms |
101661 |
/chemistry/forms/ |
| Senior Awards |
16865 |
/chemistry/seniorawards/ |
| Children's Memory and Learning |
25078 |
/childrensmemory/ |
| Our Lab |
25079 |
/childrensmemory/About_Us.shtml |
| Catherine Haden, Ph.D. |
25080 |
/childrensmemory/haden.shtml |
| Research Team |
25082 |
/childrensmemory/research_team.shtml |
| Lab Alumni |
168431 |
/childrensmemory/labalumni/ |
| Contact Us |
25081 |
/childrensmemory/contact.shtml |
| Research Projects |
25084 |
/childrensmemory/research.shtml |
| Somos Ingenieros/We are Engineers |
198565 |
/childrensmemory/somosingenierosweareengineers/ |
| Somos Ingenieros Publications |
206916 |
/childrensmemory/publications/somosingenierospublications/ |
| Ciencia en Relatos |
168307 |
/childrensmemory/cienciaenrelatos/ |
| Ciencia en Relatos Publications |
204202 |
/childrensmemory/publications/cienciaenrelatospublications/ |
| TALES: Tinkering and Learning Engineering Stories |
126723 |
/childrensmemory/talestinkeringandlearningengineeringstories/ |
| TALES Publications |
204203 |
/childrensmemory/publications/talespublications/ |
| LabVenture |
168308 |
/childrensmemory/labventure/ |
| LabVenture Publications |
204204 |
/childrensmemory/publications/labventurepublications/ |
| TRAEL: Tinkering and Reflection |
92909 |
/childrensmemory/traeltinkeringandreflection/ |
| TRAEL Publications |
202417 |
/childrensmemory/traeltinkeringandreflection/traelpublications/ |
| EEE: Engaging Engineering Experts |
108173 |
/childrensmemory/eeeengagingengineeringexperts/ |
| Past Projects |
90214 |
/childrensmemory/pastprojects/ |
| Children's Memory Study |
90213 |
/childrensmemory/pastprojects/childrensmemorystudy/ |
| Family Learning in Museums |
25086 |
/childrensmemory/family-learning-museums.shtml |
| Learning with Objects |
25087 |
/childrensmemory/Field_Museum.shtml |
| Publications & Resources |
25092 |
/childrensmemory/Publications.shtml |
| Publications |
199742 |
/childrensmemory/publications/ |
| LabVenture Publications |
198671 |
/childrensmemory/labventure/labventurepublications/ |
| TALES Publications |
198662 |
/childrensmemory/talestinkeringandlearningengineeringstories/talespublications/ |
| Ciencia en Relatos Publications |
198663 |
/childrensmemory/cienciaenrelatos/cienciaenrelatospublications/ |
| Somos Ingenieros Publications |
206915 |
/childrensmemory/publications/somosingenierospublications/ |
| Narrative Coding Resources |
56773 |
/childrensmemory/narrativecodingresources/ |
| Join Us |
25094 |
/childrensmemory/Student_Resources.shtml |
| Research Opportunities for Undergraduates |
25097 |
/childrensmemory/researchopportunitiesforundergraduates/ |
| Ph.D. Opportunities |
204119 |
/childrensmemory/phdopportunities/ |
| Photo Gallery (ChildrenML2468) |
93076 |
/childrensmemory/homeright/photogallerychildrenml2468/ |
| Footer |
25106 |
/childrensmemory/footer/ |
| site_logo |
203430 |
/childrensmemory/sitelogo/ |
| cta |
203431 |
/childrensmemory/cta/ |
| modules-programming |
203434 |
/childrensmemory/modules-programming/ |
| CLAS |
184537 |
/clas/ |
| site_logo |
184539 |
/clas/sitelogo/ |
| Footer |
184540 |
/clas/footer/ |
| modules-programming |
184544 |
/clas/modules-programming/ |
| About CLAS |
184545 |
/clas/aboutclas/ |
| Overview |
184558 |
/clas/aboutclas/ |
| Project Timeline |
184549 |
/clas/aboutclas/projecttimeline/ |
| Project Supports |
184546 |
/clas/projectsupports/ |
| Workshops |
184553 |
/clas/projectsupports/workshops/ |
| Request Support |
184555 |
/clas/projectsupports/requestsupport/ |
| New resource! Self-paced Learning Modules |
201404 |
/clas/projectsupports/newresourceself-pacedlearningmodules/ |
| Continuous Improvement at Loyola |
184547 |
/clas/continuousimprovementatloyola/ |
| Overview |
184557 |
/clas/continuousimprovementatloyola/ |
| Culture of Assessment |
184556 |
/clas/continuousimprovementatloyola/cultureofassessment/ |
| Annual Assessment Reports |
184552 |
/clas/continuousimprovementatloyola/annualassessmentreports/ |
| Classical Studies, Department of |
12967 |
/classicalstudies/index.shtml |
| Faculty Directory |
97621 |
/classicalstudies/facultydirectory/ |
| right_column |
203581 |
/classicalstudies/facultydirectory/rightcolumn/ |
| Faculty Directory |
203580 |
/classicalstudies/facultydirectory/ |
| Emeritus Faculty |
202903 |
/classicalstudies/facultydirectory/emeritusfaculty/ |
| In Memoriam |
203579 |
/classicalstudies/facultydirectory/inmemoriam/ |
| Profiles |
97610 |
/classicalstudies/facultydirectory/profiles/ |
| Update Profiles |
202905 |
/classicalstudies/facultydirectory/updateprofiles/ |
| Special Events |
12980 |
/classicalstudies/events.shtml |
| Eta Sigma Phi |
24316 |
/classicalstudies/etasigmaphi.shtml/ |
| Job Search 2013 |
12974 |
/classicalstudies/Job_Search.shtml |
| Prize Competitions and Awards |
12978 |
/classicalstudies/contest.shtml |
| Classical Studies and the Jesuit Educational Tradition |
14388 |
/classicalstudies/clstjestrad.shtml/ |
| Classical Studies and the Jesuit Educational Tradition Program |
19651 |
/classicalstudies/clstjestrad-pgrm.shtml/ |
| Newsletter |
77788 |
/classicalstudies/newsletter/ |
| News Archive |
94251 |
/classicalstudies/newsarchive/ |
| Photos |
94254 |
/classicalstudies/newsarchive/photos/ |
| archive |
94407 |
/classicalstudies/newsarchive/photos/archive/ |
| custom_js |
94535 |
/classicalstudies/newsarchive/photos/archive/customjs/ |
| Stories |
98607 |
/classicalstudies/stories/ |
| archive |
98608 |
/classicalstudies/stories/archive/ |
| Land Acknowledgement |
156626 |
/classicalstudies/landacknowledgement/ |
| Academics |
12982 |
/classicalstudies/academics.shtml |
| Minor in Latin |
108612 |
/classicalstudies/minorinlatin/ |
| Minor in Ancient Greek |
108613 |
/classicalstudies/minorinancientgreek/ |
| BA and Minor in Classical Civilization |
108611 |
/classicalstudies/baandminorinclassicalcivilization/ |
| Portfolio requirement for majors |
160215 |
/classicalstudies/portfoliorequirementformajors/ |
| Post-Baccalaureate Certificate in Classical Studies |
12988 |
/classicalstudies/postbacc.shtml |
| right_column |
92136 |
/classicalstudies/rightcolumn/ |
| Classics Bachelor's degree distinction |
12983 |
/classicalstudies/ba_classics.shtml |
| Interdisciplinary Program Minors |
108614 |
/classicalstudies/interdisciplinaryprogramminors/ |
| Academic Integrity |
104715 |
/classicalstudies/academicintegrity/ |
| Course Offerings |
12985 |
/classicalstudies/courses.shtml |
| Course Catalogue |
24025 |
/classicalstudies/catalogue.shtml/ |
| TUNISIA 2007 - SUMMER STUDY TRAVEL PROGRAM |
12989 |
/classicalstudies/plsc300_tunisia2007.shtml |
| Language Placement |
63442 |
/classicalstudies/languageplacement/ |
| Latin |
122402 |
/classicalstudies/languageplacement/latin/ |
| Ancient Greek |
122403 |
/classicalstudies/languageplacement/ancientgreek/ |
| Financial Aid |
12994 |
/classicalstudies/finaid.html |
| Tuition |
12996 |
/classicalstudies/tuition.html |
| Graduate Admission: Post-Bac |
76836 |
/classicalstudies/graduateadmissionpost-bac/ |
| Resources |
13174 |
/classicalstudies/resources/ |
| Departmental Scholarships and Funding |
155376 |
/classicalstudies/resources/departmentalscholarshipsandfunding/ |
| Fellowships, Internships, Fieldwork |
13177 |
/classicalstudies/resources/fellowshipsinternshipsfieldwork/ |
| Career Resources |
13176 |
/classicalstudies/resources/careerresources/ |
| Career Resources: Academia |
13175 |
/classicalstudies/resources/careerresourcesacademia/ |
| Classics Communities |
13178 |
/classicalstudies/resources/classicscommunities/ |
| Diversity, Equity & Inclusion |
158850 |
/classicalstudies/resources/diversityequityinclusion/ |
| Library Resources |
75092 |
/classicalstudies/resources/libraryresources/ |
| Faculty Resources |
159943 |
/classicalstudies/resources/facultyresources/ |
| Footer |
13172 |
/classicalstudies/footer/ |
| site_logo |
13173 |
/classicalstudies/sitelogo/ |
| home_center |
48061 |
/classicalstudies/homecenter/ |
| modules-programming |
199834 |
/classicalstudies/modules-programming/ |
| Coldfusion |
66167 |
/coldfusion/linda.cfm |
| Test |
67582 |
/coldfusion/test.cfm |
| Collective Bargaining Update |
207206 |
/bargaining/ |
| site_logo |
207207 |
/dev-bargaining/sitelogo/ |
| Updates |
207211 |
https://www.luc.edu/dev-bargaining/#previousupdates |
| Frequently Asked Questions |
207209 |
/bargaining/frequentlyaskedquestions/ |
| Resources |
207210 |
/dev-bargaining/resources/ |
| Messages |
204712 |
/bargaining-dev/messages/ |
| October 28, 2025 |
204788 |
/bargaining-dev/messages/october282025/ |
| October 2, 2025 |
204787 |
/bargaining-dev/messages/october22025/ |
| September 23, 2025 |
204714 |
/bargaining-dev/messages/september232025/ |
| College of Arts and Sciences |
183506 |
/cas/ |
| site_logo |
183507 |
/cas/sitelogo/ |
| Footer |
183508 |
/cas/footer/ |
| cta |
183509 |
/cas/cta/ |
| social media |
183511 |
/cas/socialmedia/ |
| modules-programming |
183512 |
/cas/modules-programming/ |
| About |
183517 |
/cas/about/ |
| From the Dean |
183565 |
/cas/about/fromthedean/ |
| Dean's Desk |
190008 |
/cas/about/fromthedean/deansdesk/ |
| November 21, 2023 |
190009 |
/cas/about/fromthedean/deansdesk/november212023/ |
| December 18, 2023 |
190736 |
/cas/about/fromthedean/deansdesk/december182023/ |
| Mission and Identity |
183564 |
/cas/about/missionandidentity/ |
| Our People |
184102 |
/cas/about/ourpeople/ |
| Directory |
184103 |
/cas/about/ourpeople/directory/ |
| Profiles |
201852 |
/cas/about/ourpeople/directory/profiles/ |
| right_column |
201853 |
/cas/about/ourpeople/directory/profiles/rightcolumn/ |
| Diversity, Equity, & Inclusion |
183566 |
/cas/about/diversityequityinclusion/ |
| Interdisciplinary Centers |
183567 |
/cas/about/interdisciplinarycenters/ |
| Councils & Boards |
183568 |
/cas/about/councilsboards/ |
| Faculty Recognition |
183569 |
/cas/about/facultyrecognition/ |
| Alumni |
183570 |
/cas/about/alumni/ |
| modules-programming |
184294 |
/cas/about/alumni/modules-programming/ |
| FAQs |
183571 |
/cas/about/faqs/ |
| News & Events |
183572 |
/cas/about/newsevents/ |
| archive |
184313 |
/cas/about/newsevents/archive/ |
| Stories |
189134 |
/cas/about/newsevents/stories/ |
| Summer in the City |
189135 |
/cas/about/newsevents/stories/summerinthecity/ |
| Staff Spotlights |
188498 |
/cas/about/newsevents/staffspotlights/ |
| Staff Spotlight: Joyce Knight |
189055 |
/cas/about/newsevents/staffspotlights/staffspotlightjoyceknight/ |
| Staff Spotlight: Annette LePique |
189057 |
/cas/about/newsevents/staffspotlights/staffspotlightannettelepique/ |
| Staff Spotlight: Almudena Rincón Sáez |
194556 |
/cas/about/newsevents/staffspotlights/staffspotlightalmudenarinconsaez/ |
| Academic Advising Spotlight |
200417 |
/cas/about/newsevents/staffspotlights/academicadvisingspotlight/ |
| Alumni Spotlights |
188499 |
/cas/about/newsevents/alumnispotlights/ |
| Alumni Spotlight: Amanda White |
189056 |
/cas/about/newsevents/alumnispotlights/alumnispotlightamandawhite/ |
| Alumni Spotlight: Mary Jane Theis |
189642 |
/cas/about/newsevents/alumnispotlights/alumnispotlightmaryjanetheis/ |
| Alumni Spotlight: Meghan Anzelc |
195812 |
/cas/about/newsevents/alumnispotlights/alumnispotlightmeghananzelc/ |
| Alumni Spotlight: Daniella Pombo |
198759 |
/cas/about/newsevents/alumnispotlights/alumnispotlightdaniellapombo/ |
| Ian Brennan Scholarship |
205801 |
/cas/about/newsevents/alumnispotlights/ianbrennanscholarship/ |
| Faculty Spotlights |
188500 |
/cas/about/newsevents/facultyspotlights/ |
| Peter J. Schraeder |
189959 |
/cas/about/newsevents/facultyspotlights/peterjschraeder/ |
| Spotlight On: Zoe Smith |
188501 |
/cas/about/newsevents/facultyspotlights/spotlightonzoesmith/ |
| Spotlight On: Reinhard Andress |
188502 |
/cas/about/newsevents/facultyspotlights/spotlightonreinhardandress/ |
| Spotlight On: Tofigh Maboudi |
188503 |
/cas/about/newsevents/facultyspotlights/spotlightontofighmaboudi/ |
| Spotlight On: Hille Haker |
188504 |
/cas/about/newsevents/facultyspotlights/spotlightonhillehaker/ |
| Spotlight On: Gregory Matthews |
160353 |
/cas/about/newsevents/facultyspotlights/spotlightongregorymatthews/ |
| Spotlight On: Elizabeth Shermer |
163695 |
/cas/about/newsevents/facultyspotlights/spotlightonelizabethshermer/ |
| Spotlight On: Bozena Nowicka McLees |
178477 |
/cas/about/newsevents/facultyspotlights/spotlightonbozenanowickamclees/ |
| Spotlight on: Jenn Finn |
180583 |
/cas/about/newsevents/facultyspotlights/spotlightonjennfinn/ |
| Spotlight On: Kristin Krueger |
180684 |
/cas/about/newsevents/facultyspotlights/spotlightonkristinkrueger/ |
| Spotlight On: Yas Silva |
180929 |
/cas/about/newsevents/facultyspotlights/spotlightonyassilva/ |
| Spotlight On: Chris Donner |
189127 |
/cas/about/newsevents/facultyspotlights/spotlightonchrisdonner/ |
| Spotlight On: James Cheverud |
189313 |
/cas/about/newsevents/facultyspotlights/spotlightonjamescheverud/ |
| Spotlight On: Perla B Gamez |
189641 |
/cas/about/newsevents/facultyspotlights/spotlightonperlabgamez/ |
| Alexandru V Grigorescu |
189776 |
/cas/about/newsevents/facultyspotlights/alexandruvgrigorescu/ |
| Kelvin Billingsley |
189905 |
/cas/about/newsevents/facultyspotlights/kelvinbillingsley/ |
| David Olson |
190209 |
/cas/about/newsevents/facultyspotlights/davidolson/ |
| Eric Chan Tin |
191079 |
/cas/about/newsevents/facultyspotlights/ericchantin/ |
| Victor Ottati |
191280 |
/cas/about/newsevents/facultyspotlights/victorottati/ |
| Yas Silva |
191506 |
/cas/about/newsevents/facultyspotlights/yassilva/ |
| George K. Thiruvathukal |
191764 |
/cas/about/newsevents/facultyspotlights/georgekthiruvathukal/ |
| Spotlight: CAS Faculty Serving as Journal Editors |
192046 |
/cas/about/newsevents/facultyspotlights/spotlightcasfacultyservingasjournaleditors/ |
| Spotlight On: Judson G. Everitt |
192183 |
/cas/about/newsevents/facultyspotlights/spotlightonjudsongeveritt/ |
| Spotlight On: Thea Strand |
193718 |
/cas/about/newsevents/facultyspotlights/spotlightontheastrand/ |
| Spotlight On: Olivia Wolf |
193790 |
/cas/about/newsevents/facultyspotlights/spotlightonoliviawolf/ |
| Spotlight On: Miguel Díaz |
194105 |
/cas/about/newsevents/facultyspotlights/spotlightonmigueldiaz/ |
| Spotlight On: Caludio Katz |
194354 |
/cas/about/newsevents/facultyspotlights/spotlightoncaludiokatz/ |
| Yoel Stuart |
195134 |
/cas/about/newsevents/facultyspotlights/yoelstuart/ |
| Ben Johnson |
195171 |
/cas/about/newsevents/facultyspotlights/benjohnson/ |
| Spotlight On: Art Lurigio |
197067 |
/cas/about/newsevents/facultyspotlights/spotlightonartlurigio/ |
| Platform Awards |
197975 |
/cas/about/newsevents/facultyspotlights/platformawards/ |
| Kristin Krueger |
198449 |
/cas/about/newsevents/facultyspotlights/kristinkrueger/ |
| Joseph Vukov |
198607 |
/cas/about/newsevents/facultyspotlights/josephvukov/ |
| Michelle Nickerson |
198742 |
/cas/about/newsevents/facultyspotlights/michellenickerson/ |
| Amanda Ward |
199079 |
/cas/about/newsevents/facultyspotlights/amandaward/ |
| Tracy Pintchman |
199278 |
/cas/about/newsevents/facultyspotlights/tracypintchman/ |
| Xiang Wan |
199630 |
/cas/about/newsevents/facultyspotlights/xiangwan/ |
| David Chinitz |
199994 |
/cas/about/newsevents/facultyspotlights/davidchinitz/ |
| Mausumi Mahapatra |
200412 |
/cas/about/newsevents/facultyspotlights/mausumimahapatra/ |
| Betsy Odom |
200629 |
/cas/about/newsevents/facultyspotlights/betsyodom/ |
| Priyanka Jacob |
201333 |
/cas/about/newsevents/facultyspotlights/priyankajacob/ |
| Michael Andrews |
201371 |
/cas/about/newsevents/facultyspotlights/michaelandrews/ |
| Chris Donner |
201453 |
/cas/about/newsevents/facultyspotlights/chrisdonner/ |
| Jack Kerkering |
201547 |
/cas/about/newsevents/facultyspotlights/jackkerkering/ |
| Paul Moser |
201614 |
/cas/about/newsevents/facultyspotlights/paulmoser/ |
| Suzanne Bost |
201709 |
/cas/about/newsevents/facultyspotlights/suzannebost/ |
| Ochin Pakhi |
201786 |
/cas/about/newsevents/facultyspotlights/ochinpakhi/ |
| Michael Grillo |
201936 |
/cas/about/newsevents/facultyspotlights/michaelgrillo/ |
| Polina Pine |
201937 |
/cas/about/newsevents/facultyspotlights/polinapine/ |
| James Murphy |
202198 |
/cas/about/newsevents/facultyspotlights/jamesmurphy/ |
| Stephanie Grella |
202449 |
/cas/about/newsevents/facultyspotlights/stephaniegrella/ |
| Nancy Caronia |
203099 |
/cas/about/newsevents/facultyspotlights/nancycaronia/ |
| Silva NSF Grant |
204195 |
/cas/about/newsevents/facultyspotlights/silvansfgrant/ |
| Bradshaw NEH Grant |
204223 |
/cas/about/newsevents/facultyspotlights/bradshawnehgrant/ |
| Maboudi NSF |
204273 |
/cas/about/newsevents/facultyspotlights/maboudinsf/ |
| Hallett Nature |
204346 |
/cas/about/newsevents/facultyspotlights/hallettnature/ |
| Pengfei Li NIH |
204384 |
/cas/about/newsevents/facultyspotlights/pengfeilinih/ |
| Wolf Book 2025 |
204527 |
/cas/about/newsevents/facultyspotlights/wolfbook2025/ |
| Collab on Physics Book |
204789 |
/cas/about/newsevents/facultyspotlights/collabonphysicsbook/ |
| Brecht’s Book Explores Faith, Race, and Belonging |
204790 |
/cas/about/newsevents/facultyspotlights/brechtsbookexploresfaithraceandbelonging/ |
| Evans Punk Culture |
205331 |
/cas/about/newsevents/facultyspotlights/evanspunkculture/ |
| Jesuit Heritage Research Signage |
205519 |
/cas/about/newsevents/facultyspotlights/jesuitheritageresearchsignage/ |
| Janangelo Publishes Book |
205858 |
/cas/about/newsevents/facultyspotlights/janangelopublishesbook/ |
| Finn's Book 2026 |
205921 |
/cas/about/newsevents/facultyspotlights/finnsbook2026/ |
| Dickinson Spotlight |
206103 |
/cas/about/newsevents/facultyspotlights/dickinsonspotlight/ |
| Cutrofello Book |
206275 |
/cas/about/newsevents/facultyspotlights/cutrofellobook/ |
| Hamilton Book |
206319 |
/cas/about/newsevents/facultyspotlights/hamiltonbook/ |
| Banerjee ACS Award |
206552 |
/cas/about/newsevents/facultyspotlights/banerjeeacsaward/ |
| Gordon Book |
206675 |
/cas/about/newsevents/facultyspotlights/gordonbook/ |
| Putonti NIH |
206879 |
/cas/about/newsevents/facultyspotlights/putontinih/ |
| Stewart Lester Book |
206954 |
/cas/about/newsevents/facultyspotlights/stewartlesterbook/ |
| 2026 Sujack Awards |
207034 |
/cas/about/newsevents/facultyspotlights/2026sujackawards/ |
| Student Profiles |
189778 |
/cas/about/newsevents/studentprofiles/ |
| President's Medallion 2023: Joshua Jones |
189779 |
/cas/about/newsevents/studentprofiles/presidentsmedallion2023joshuajones/ |
| Kristina Martinet Presents at American Academy of Forensic Sciences |
193736 |
/cas/about/newsevents/studentprofiles/kristinamartinetpresentsatamericanacademyofforensicsciences/ |
| Student Spotlight: Amara Grajewski |
197106 |
/cas/about/newsevents/studentprofiles/studentspotlightamaragrajewski/ |
| Two DFPA Students Recognized for Achievements in Art History Research |
199185 |
/cas/about/newsevents/studentprofiles/twodfpastudentsrecognizedforachievementsinarthistoryresearch/ |
| CyberForce Competition |
200758 |
/cas/about/newsevents/studentprofiles/cyberforcecompetition/ |
| LUC in DC Program |
202478 |
/cas/about/newsevents/studentprofiles/lucindcprogram/ |
| Fiona Schneider Internship |
203529 |
/cas/about/newsevents/studentprofiles/fionaschneiderinternship/ |
| 2026 Commencement Speakers |
207069 |
/cas/about/newsevents/studentprofiles/2026commencementspeakers/ |
| Past Interdisciplinary Lecture Series |
188949 |
/cas/about/newsevents/pastinterdisciplinarylectureseries/ |
| A Dialogue on Community Healthcare |
198166 |
/cas/about/newsevents/symposiumseptember2024/ |
| A Dialogue on Gene Editing |
190839 |
/cas/about/newsevents/adialogueongeneediting/ |
| CAS Community |
194539 |
/cas/about/newsevents/cascommunity/ |
| Mary McAleese Visit |
191247 |
/cas/about/newsevents/marymcaleesevisit/ |
| Polish Diaspora Center |
204157 |
/cas/about/newsevents/polishdiasporacenter/ |
| 2023 |
191422 |
/cas/about/newsevents/2023/ |
| Mary Jane Theis |
191423 |
/cas/about/newsevents/2023/maryjanetheis/ |
| 2024 |
191337 |
/cas/about/newsevents/2024/ |
| Jenn Finn in Netflix Special |
191340 |
/cas/about/newsevents/2024/jennfinninnetflixspecial/ |
| 2024 Sujack Awards |
193737 |
/cas/about/newsevents/2024/2024sujackawards/ |
| 2024 Student Commencement Speakers |
194216 |
/cas/about/newsevents/2024/2024studentcommencementspeakers/ |
| 2024 Alumni Keynote Commencement Speakers |
194240 |
/cas/about/newsevents/2024/2024alumnikeynotecommencementspeakers/ |
| Engineering US News Rankings |
198696 |
/cas/about/newsevents/2024/engineeringusnewsrankings/ |
| Building Bridges Awards Fall 2024 |
199300 |
/cas/about/newsevents/2024/buildingbridgesawardsfall2024/ |
| 2025 |
202524 |
/cas/about/newsevents/2025/ |
| 2025 Sujack Awards |
202525 |
/cas/about/newsevents/2025/2025sujackawards/ |
| 2025 Student Commencement Speakers |
202800 |
/cas/about/newsevents/2025/2025studentcommencementspeakers/ |
| Ian Brennan Scholarship |
205834 |
/cas/about/newsevents/2025/ianbrennanscholarship/ |
| Building Bridges Awards 2025 |
206108 |
/cas/about/newsevents/2025/buildingbridgesawards2025/ |
| 2025-26 Building Bridges Awards |
206169 |
/cas/about/newsevents/2025/2025-26buildingbridgesawards/ |
| 2025 Science and Society Lecture |
204528 |
/cas/about/newsevents/2025scienceandsocietylecture/ |
| 2026 Denkewalter Lecture |
206151 |
/cas/about/newsevents/2026denkewalterlecture/ |
| Contact Us |
183573 |
/cas/about/contactus/ |
| Directory |
184332 |
/cas/about/ourpeople/ |
| Admission |
183560 |
/cas/admission/ |
| Apply |
184062 |
/cas/admission/apply/ |
| Tuition & Financial Aid |
184063 |
/cas/admission/tuitionfinancialaid/ |
| Scholarships |
184064 |
/cas/admission/scholarships/ |
| Academics |
183561 |
/cas/academics/ |
| Majors & Minors |
184067 |
/cas/academics/majorsminors/ |
| Departments |
184065 |
/cas/academics/departments/ |
| Interdisciplinary Programs |
184066 |
/cas/academics/interdisciplinaryprograms/ |
| List of Programs |
188567 |
/cas/academics/interdisciplinaryprograms/listofprograms/ |
| Graduate Programs |
185973 |
/cas/academics/graduateprograms/ |
| Degree Requirements |
184068 |
/cas/academics/degreerequirements/ |
| Engaged Learning |
184070 |
/cas/academics/engagedlearning/ |
| modules-programming |
184331 |
/cas/academics/engagedlearning/modules-programming/ |
| Earning Honors |
184069 |
/cas/academics/earninghonors/ |
| Undergraduate Research Opportunities |
184082 |
/cas/academics/undergraduateresearchopportunities/ |
| Mulcahy Fellowship Experiences |
201935 |
/cas/academics/undergraduateresearchopportunities/mulcahyfellowshipexperiences/ |
| International Opportunities |
184314 |
https://www.luc.edu/studyabroad/ |
| Student Fellowships |
185976 |
/cas/academics/studentfellowships/ |
| Visiting Students |
184072 |
/cas/academics/visitingstudents/ |
| CUREs |
192354 |
/cas/academics/cures/ |
| Academic Advising |
183562 |
/cas/academicadvising/ |
| Meet the Advisors |
184074 |
/cas/academicadvising/meettheadvisors/ |
| Talk to an Advisor |
184075 |
/cas/academicadvising/talktoanadvisor/ |
| Advising FAQs |
184076 |
/cas/academicadvising/advisingfaqs/ |
| Apply for Graduation |
184077 |
/cas/academicadvising/applyforgraduation/ |
| Academic Integrity & Appeal |
184078 |
/cas/academicadvising/academicintegrityappeal/ |
| Student Resources |
184079 |
/cas/academicadvising/studentresources/ |
| Student Forms |
184080 |
/cas/academicadvising/studentforms/ |
| Faculty Activities |
183563 |
/cas/facultyactivities/ |
| Policies and Procedures |
184073 |
/cas/facultyactivities/policiesandprocedures/ |
| Developmental Leave |
185994 |
/cas/facultyactivities/developmentalleave/ |
| Rank and Tenure |
185995 |
/cas/facultyactivities/rankandtenure/ |
| Faculty Fellowships |
184081 |
/cas/facultyactivities/facultyfellowships/ |
| Grants |
184083 |
/cas/facultyactivities/grants/ |
| College of Arts & Sciences Academic Council |
105061 |
/casacademiccouncil/ |
| About CAS-AC |
105062 |
/casacademiccouncil/aboutcas-ac/ |
| Charter |
105067 |
/casacademiccouncil/aboutcas-ac/charter/ |
| By-Laws |
122892 |
/casacademiccouncil/aboutcas-ac/by-laws/ |
| Current Members |
105070 |
/casacademiccouncil/aboutcas-ac/currentmembers/ |
| Meeting Schedule |
105071 |
/casacademiccouncil/aboutcas-ac/meetingschedule/ |
| News |
200682 |
/casacademiccouncil/aboutcas-ac/news/ |
| archive |
200683 |
/casacademiccouncil/aboutcas-ac/news/archive/ |
| CAS-AC Curricular Review |
105063 |
/casacademiccouncil/cas-accurricularreview/ |
| About the Platform |
105104 |
/casacademiccouncil/cas-accurricularreview/abouttheplatform/ |
| The CIM System and Portal Instructions |
197154 |
/casacademiccouncil/cas-accurricularreview/thecimsystemandportalinstructions/ |
| Concepts and Terms |
105073 |
/casacademiccouncil/cas-accurricularreview/conceptsandterms/ |
| Instructions for Temporary Tag/Cross-listing Requests |
105076 |
/casacademiccouncil/cas-accurricularreview/instructionsfortemporarytagcross-listingrequests/ |
| University Curriculum |
105064 |
/casacademiccouncil/universitycurriculum/ |
| Academic Affairs Program Development |
110484 |
/casacademiccouncil/universitycurriculum/academicaffairsprogramdevelopment/ |
| University Core Curriculum |
105082 |
http://www.luc.edu/core/ |
| Engaged Learning Requirement |
112525 |
/casacademiccouncil/universitycurriculum/engagedlearningrequirement/ |
| Interdisciplinary Honors Program |
105083 |
http://www.luc.edu/honors/ |
| Writing Program |
105092 |
https://www.luc.edu/english/writing.shtml |
| CAS Academics |
105065 |
/casacademiccouncil/casacademics/ |
| College of Arts & Sciences |
105084 |
http://www.luc.edu/cas/ |
| Departments |
105085 |
http://www.luc.edu/cas/academics_departments.shtml |
| Interdisciplinary Programs |
105086 |
http://www.luc.edu/cas/interdisciplinaryprograms/ |
| Majors |
105087 |
http://www.luc.edu/cas/majors/ |
| Minors |
105088 |
http://www.luc.edu/cas/minors/ |
| Academic Policies |
105066 |
/casacademiccouncil/academicpolicies/ |
| Academic Workload: the Catania Report |
105089 |
/casacademiccouncil/academicpolicies/academicworkloadthecataniareport/ |
| Double-Dipping |
105090 |
http://www.luc.edu/media/lucedu/cas/pdfs/Double%20Dipping%20Policy.pdf |
| Writing Intensive Committee Report |
105091 |
https://luc.edu/media/lucedu/cas/pdfs/Writing%20Intensive%20Committee%20Report.pdf |
| site_logo |
105078 |
/casacademiccouncil/sitelogo/ |
| Footer |
105080 |
/casacademiccouncil/footer/ |
| Document Library |
105098 |
/casacademiccouncil/documentlibrary/ |
| Stories |
105200 |
/casacademiccouncil/stories/ |
| archive |
105201 |
/casacademiccouncil/stories/archive/ |
| modules-programming |
200684 |
/casacademiccouncil/modules-programming/ |
| Commencement |
191085 |
/commencement/ |
| site_logo |
191086 |
/commencement/sitelogo/ |
| Graduate Information |
191088 |
/commencement/graduateinformation/ |
| Registration |
191094 |
/commencement/graduateinformation/registration/ |
| Ceremony Apparel |
191096 |
/commencement/graduateinformation/ceremonyapparel/ |
| data.json |
191238 |
/commencement/graduateinformation/ceremonyapparel/data.json |
| script.js |
191239 |
/commencement/graduateinformation/ceremonyapparel/script.js |
| regaliaSearch.js |
191266 |
/commencement/graduateinformation/ceremonyapparel/regaliaSearch.js |
| filterSelection.js |
191267 |
/commencement/graduateinformation/ceremonyapparel/filterSelection.js |
| regaliaSearchFilterBySchool.js |
191289 |
/commencement/graduateinformation/ceremonyapparel/regaliaSearchFilterBySchool.js |
| regaliaSearchFilterByType.js |
191290 |
/commencement/graduateinformation/ceremonyapparel/regaliaSearchFilterByType.js |
| Celebrations |
202050 |
/commencement/graduateinformation/celebrations/ |
| Commencement Resources |
192311 |
/commencement/graduateinformation/commencementresources/ |
| Plan Your Visit |
191089 |
/commencement/planyourvisit/ |
| Lodging |
191098 |
/commencement/planyourvisit/lodging/ |
| Maps and Directions |
191099 |
/commencement/planyourvisit/mapsanddirections/ |
| Accessibility |
191100 |
/commencement/planyourvisit/accessibility/ |
| Sustainability |
191101 |
/commencement/planyourvisit/sustainability/ |
| Ceremonies |
191090 |
/commencement/ceremonies/ |
| Tickets and Admission |
191103 |
/commencement/ceremonies/ticketsandadmission/ |
| Schools and Colleges |
191104 |
/commencement/ceremonies/schoolsandcolleges/ |
| Arrupe College |
192138 |
/commencement/ceremonies/schoolsandcolleges/arrupe/ |
| Dean's Letter |
192139 |
/commencement/ceremonies/schoolsandcolleges/arrupe/deansletter/ |
| School of Education |
192148 |
/commencement/ceremonies/schoolsandcolleges/soe/ |
| Dean's Letter |
192149 |
/commencement/ceremonies/schoolsandcolleges/soe/deansletter/ |
| School of Environmental Sustainability |
192060 |
/commencement/ceremonies/schoolsandcolleges/ses/ |
| Dean's Letter |
192061 |
/commencement/ceremonies/schoolsandcolleges/ses/deansletter/ |
| The Graduate School |
192150 |
/commencement/ceremonies/schoolsandcolleges/tgs/ |
| Dean's Letter |
192151 |
/commencement/ceremonies/schoolsandcolleges/tgs/deansletter/ |
| Institute of Pastoral Studies |
192160 |
/commencement/ceremonies/schoolsandcolleges/ips/ |
| Dean's Letter |
192161 |
/commencement/ceremonies/schoolsandcolleges/ips/deansletter/ |
| Marcella Niehoff School of Nursing |
191965 |
/commencement/ceremonies/schoolsandcolleges/son/ |
| Dean's Letter |
191966 |
/commencement/ceremonies/schoolsandcolleges/son/deansletter/ |
| Parkinson School of Health Sciences and Public Health |
192152 |
/commencement/ceremonies/schoolsandcolleges/parkinson/ |
| Dean's Letter |
192153 |
/commencement/ceremonies/schoolsandcolleges/parkinson/deansletter/ |
| School of Social Work |
192158 |
/commencement/ceremonies/schoolsandcolleges/ssw/ |
| Dean's Letter |
192159 |
/commencement/ceremonies/schoolsandcolleges/ssw/deansletter/ |
| School of Communication |
192144 |
/commencement/ceremonies/schoolsandcolleges/soc/ |
| Dean's Letter |
192145 |
/commencement/ceremonies/schoolsandcolleges/soc/deansletter/ |
| School of Continuing and Professional Studies |
192146 |
/commencement/ceremonies/schoolsandcolleges/scps/ |
| Dean's Letter |
192147 |
/commencement/ceremonies/schoolsandcolleges/scps/deansletter/ |
| Quinlan School of Business |
192142 |
/commencement/ceremonies/schoolsandcolleges/qsb/ |
| Dean's Letter |
192143 |
/commencement/ceremonies/schoolsandcolleges/qsb/deansletter/ |
| College of Arts and Sciences |
192140 |
/commencement/ceremonies/schoolsandcolleges/cas/ |
| Dean's Letter |
192141 |
/commencement/ceremonies/schoolsandcolleges/cas/deansletter/ |
| School of Law |
192154 |
/commencement/ceremonies/schoolsandcolleges/law/ |
| Dean's Letter |
192155 |
/commencement/ceremonies/schoolsandcolleges/law/deansletter/ |
| Stritch School of Medicine |
192156 |
/commencement/ceremonies/schoolsandcolleges/ssom/ |
| Dean's Letter |
192157 |
/commencement/ceremonies/schoolsandcolleges/ssom/deansletter/ |
| Honorary Degrees |
191105 |
/commencement/ceremonies/honorarydegrees/ |
| Fabio Lievano, MD - Biography |
191243 |
/commencement/ceremonies/honorarydegrees/fabiolievanomd-biography/ |
| Faculty Information |
191091 |
/commencement/facultyinformation/ |
| College of Arts & Sciences |
188785 |
/commencement/facultyinformation/collegeofartssciences/ |
| Commencement Memorabilia |
202468 |
/commencement/commencementmemorabilia/ |
| Modal Content |
202470 |
/commencement/commencementmemorabilia/modalcontent/ |
| FAQs |
191092 |
/commencement/faqs/ |
| Contact |
191093 |
/commencement/contact/ |
| Keynote Speaker Bio - Arrupe |
191190 |
/commencement/keynotespeakerbio-arrupe/ |
| Keynote Speaker Bio - CAS - AM - Jordan |
191199 |
/commencement/keynotespeakerbio-cas-am-jordan/ |
| Keynote Speaker Bio - CAS - AFT - Younger |
191220 |
/commencement/keynotespeakerbio-cas-aft-younger/ |
| Keynote Speaker Bio - CAS - PM - Faustin |
191221 |
/commencement/keynotespeakerbio-cas-pm-faustin/ |
| Keynote Speaker Bio - Quinlan - Pidner-Hsu |
191200 |
/commencement/keynotespeakerbio-quinlan-pidner-hsu/ |
| Keynote Speaker Bio - SOC - Canellis |
191201 |
/commencement/keynotespeakerbio-soc-canellis/ |
| Keynote Speaker Bio - SCPS - Canellis |
191202 |
/commencement/keynotespeakerbio-scps-canellis/ |
| Keynote Speaker Bio - SOE - Graslie |
191203 |
/commencement/keynotespeakerbio-soe-graslie/ |
| Keynote Speaker Bio - SES - Hewitt |
191204 |
/commencement/keynotespeakerbio-ses-hewitt/ |
| Keynote Speaker Bio - Graduate - Miller |
191206 |
/commencement/keynotespeakerbio-graduate-miller/ |
| Keynote Speaker Bio - Parkinson - Layden |
191205 |
/commencement/keynotespeakerbio-parkinson-layden/ |
| Keynote Speaker Bio - Law - Smith |
191207 |
/commencement/keynotespeakerbio-law-smith/ |
| Keynote Speaker Bio - SSOM - Sahloul |
191208 |
/commencement/keynotespeakerbio-ssom-sahloul/ |
| Honorary Degree Recipient Bio - SSOM - Fabio Lievano |
191222 |
/commencement/honorarydegreerecipientbio-ssom-fabiolievano/ |
| Keynote Speaker Bio - MNSON - Ferrio |
191209 |
/commencement/keynotespeakerbio-mnson-ferrio/ |
| Keynote Speaker Bio - SSW - McKay |
191210 |
/commencement/keynotespeakerbio-ssw-mckay/ |
| Keynote Speaker Bio - IPS -Kellman |
191219 |
/commencement/keynotespeakerbio-ips-kellman/ |
| Community Coalition on Gender-Based Violence |
21119 |
/coalition/ |
| social media |
57961 |
/coalition/socialmedia/ |
| site_logo |
21511 |
/coalition/sitelogo/ |
| Footer |
21512 |
/coalition/footer/ |
| cta |
186043 |
/coalition/cta/ |
| About Us |
21128 |
/coalition/about/ |
| Members |
21134 |
/coalition/about/members/ |
| Get Help |
103501 |
/coalition/gethelp/ |
| I Don't Know What To Do |
103508 |
/coalition/gethelp/idontknowwhattodo/ |
| Advocacy Services |
103767 |
/coalition/gethelp/idontknowwhattodo/advocacyservices/ |
| The Wellness Center |
103768 |
/coalition/gethelp/idontknowwhattodo/thewellnesscenter/ |
| I Want Resources for Support and Safety |
103509 |
/coalition/gethelp/iwantresourcesforsupportandsafety/ |
| I Want Help Coping with the Experience |
103771 |
/coalition/gethelp/iwantresourcesforsupportandsafety/iwanthelpcopingwiththeexperience/ |
| I Want Help Exploring Ways to Ensure My Safety |
105966 |
/coalition/gethelp/iwantresourcesforsupportandsafety/iwanthelpexploringwaystoensuremysafety/ |
| I Want to Know My Rights and Resources as a Student |
105968 |
/coalition/gethelp/iwantresourcesforsupportandsafety/iwanttoknowmyrightsandresourcesasastudent/ |
| I Want to Get Medical Treatment |
103775 |
/coalition/gethelp/iwanttogetmedicaltreatment/ |
| It Is Currently Mon-Fri Between 8:30am and 5pm |
103776 |
/coalition/gethelp/iwanttogetmedicaltreatment/itiscurrentlymon-fribetween830amand5pm/ |
| It Is Currently Mon-Fri Between 5pm and 8:30am or the Weekend |
103777 |
/coalition/gethelp/iwanttogetmedicaltreatment/itiscurrentlymon-fribetween5pmand830amortheweekend/ |
| I Want to Preserve Physical Evidence |
103778 |
/coalition/gethelp/iwanttogetmedicaltreatment/iwanttopreservephysicalevidence/ |
| I Want to Seek Legal and/or Disciplinary Action |
103511 |
/coalition/gethelp/iwanttoseeklegalandordisciplinaryaction/ |
| I Want to File A Police Report |
103810 |
/coalition/gethelp/iwanttoseeklegalandordisciplinaryaction/iwanttofileapolicereport/ |
| I Want to Notify the University |
103811 |
/coalition/gethelp/iwanttoseeklegalandordisciplinaryaction/iwanttonotifytheuniversity/ |
| I Want Loyola to Investigate an Incident Involving A Student |
103812 |
/coalition/gethelp/iwanttoseeklegalandordisciplinaryaction/iwantloyolatoinvestigateanincidentinvolvingastudent/ |
| Off-Campus Resources |
21498 |
/coalition/gethelp/offcampus/ |
| Report |
21129 |
/coalition/reporting/ |
| right_column |
57979 |
/coalition/reporting/rightcolumn/ |
| After An Assault |
62227 |
/coalition/reporting/after-an-assualt/ |
| Choosing to Report |
21140 |
/coalition/reporting/choosing-report/ |
| How to Report |
21141 |
/coalition/reporting/how-report/ |
| What to Expect at the Emergency Room |
62230 |
/coalition/reporting/emergency-room/ |
| Laws & Policies |
21142 |
/coalition/reporting/policies/ |
| Fulfilling Your Role as a Responsible Campus Partner |
104222 |
/coalition/reporting/fulfillingyourroleasaresponsiblecampuspartner/ |
| Supporting a Survivor |
103502 |
/coalition/supportingasurvivor/ |
| Survivor Ally Training |
104277 |
/coalition/supportingasurvivor/survivorallytraining/ |
| Become an Advocate |
108925 |
/coalition/supportingasurvivor/becomeanadvocate/ |
| Prevention |
103503 |
/coalition/prevention/ |
| Events |
101090 |
/coalition/prevention/events/ |
| Sparrow: Finding Hope in Healing from Trauma |
101350 |
/coalition/prevention/events/sparrowfindinghopeinhealingfromtrauma/ |
| It's on Us |
98734 |
/coalition/prevention/events/itsonus/ |
| Sexual Assault Awareness Month |
104395 |
/coalition/prevention/events/sexualassaultawarenessmonth/ |
| Sexual Assault Awareness Month 2017 |
104397 |
/coalition/prevention/events/sexualassaultawarenessmonth/sexualassaultawarenessmonth2017/ |
| University Initiatives |
104446 |
/coalition/prevention/universityinitiatives/ |
| Publications |
21136 |
/coalition/prevention/publications/ |
| Culture of Respect |
185426 |
/coalition/cultureofrespect/index.shtml |
| Learn More |
103504 |
/coalition/learnmore/ |
| Types of Misconduct and Consent |
21131 |
/coalition/learnmore/violence/ |
| Sexual Misconduct |
104671 |
/coalition/learnmore/violence/sexualmisconduct/ |
| Dating Violence |
21507 |
/coalition/learnmore/violence/datingviolence/ |
| Stalking |
21510 |
/coalition/learnmore/violence/stalking/ |
| Consent |
86758 |
/coalition/learnmore/violence/consent/ |
| Tips for all members of the Loyola Community |
62228 |
/coalition/learnmore/prevention/ |
| Quick Exit |
188255 |
https://www.google.com |
| DSD Areas |
186545 |
/coalition/dsdareas/ |
| Campus Recreation |
186546 |
/campusrec/ |
| Campus Reservations |
186547 |
/campus_reservations/ |
| Community Coalition on Gender-Based Violence |
186551 |
/coalition/ |
| Conference Services |
186552 |
/conference/index.shtml |
| CTA U-Pass |
186553 |
/upass/ |
| Damen Student Center |
186555 |
/damenstudentcenter/index.shtml |
| Family Weekend |
186557 |
/familyweekend/ |
| Graduate, Professional, and Adult Student Life |
186558 |
/gpasl/ |
| Loyola University Museum of Art |
186559 |
/luma/ |
| Office of Student Conduct and Conflict Resolution |
186560 |
/osccr/ |
| Student Government |
186562 |
/sglc/ |
| Terry Student Center |
186563 |
/tsc/ |
| Wellness Center |
186565 |
/wellness/ |
| Community Relations |
29599 |
/communityrelations/index.shtml |
| About Us |
56399 |
/communityrelations/aboutus/ |
| Our Staff |
29723 |
/communityrelations/our_staff.shtml |
| right_column |
84599 |
/communityrelations/aboutus/rightcolumn/ |
| What We Value |
29645 |
/communityrelations/what_we_value.shtml |
| Community Action Scholarship |
75958 |
/communityrelations/communityactionscholarship/ |
| Equipment Manager Program |
56833 |
/communityrelations/equipmentmanagerprogram/ |
| right_column |
84602 |
/communityrelations/rightcolumn/ |
| News and Events |
202254 |
/communityrelations/aboutus/newsandevents/ |
| archive |
202255 |
/communityrelations/aboutus/newsandevents/archive/ |
| Campuses |
56400 |
/communityrelations/campuses/ |
| Lake Shore Campus (LSC) |
56800 |
/communityrelations/campuses/lakeshorecampuslsc/ |
| Water Tower Campus (WTC) |
56804 |
/communityrelations/campuses/watertowercampuswtc/ |
| Retreat and Ecology Campus (LUREC) |
56805 |
/communityrelations/campuses/retreatandecologycampuslurec/ |
| Health Sciences Campus (HSC) |
56807 |
/communityrelations/campuses/healthsciencescampushsc/ |
| right_column |
84600 |
/communityrelations/campuses/rightcolumn/ |
| Planning & Development |
29609 |
/communityrelations/planning_and_develop.shtml |
| Current Projects |
56811 |
/communityrelations/currentprojects/ |
| Kenmore Vacation |
58915 |
/communityrelations/currentprojects/kenmorevacation/ |
| Campus Plan 2014-2024 |
65588 |
/communityrelations/currentprojects/campusplan2014-2024/ |
| CTA Station and Plaza Updates |
58939 |
/communityrelations/currentprojects/ctastationandplazaupdates/ |
| Construction Updates |
56812 |
/communityrelations/constructionupdates/ |
| Quinlan School of Business |
65589 |
/communityrelations/constructionupdates/quinlanschoolofbusiness/ |
| Economic Development |
56813 |
/communityrelations/economicdevelopment/ |
| right_column |
84601 |
/communityrelations/rightcolumn/ |
| Neighborhood Resources |
29654 |
/communityrelations/whoweare.shtml |
| Center for Experiential Learning |
56801 |
http://www.luc.edu/experiential/ |
| Off-Campus Student Living |
56803 |
http://www.luc.edu/offcampus/ |
| Community Partners |
56815 |
/communityrelations/communitypartners/ |
| Handshake Career Services |
56834 |
/communityrelations/handshake/ |
| Community Events |
56836 |
/communityrelations/communityevents/ |
| Community Parking Program |
59955 |
/communityrelations/communityparkingprogram/ |
| Loyola CTA Plaza Policy |
72000 |
/communityrelations/loyolactaplazapolicy/ |
| right_column |
84603 |
/communityrelations/rightcolumn/ |
| Ramblin Around |
60044 |
/communityrelations/ramblinaround/ |
| Online Guide |
60381 |
https://luc.edu/communityrelations/ramblinaround/ |
| Ramblin Around Map LSC |
60382 |
https://www.google.com/maps/@42.0016811,-87.6652805,14z/data=!4m2!6m1!1szBeVnOxIJPGk.kYHdz9Ky-UU8?hl=en |
| Ramblin Around Map WTC |
60383 |
https://www.google.com/maps/@41.8974793,-87.6246418,16z/data=!4m2!6m1!1szBeVnOxIJPGk.kYHdz9Ky-UU8?hl=en |
| Student Positions |
66299 |
/communityrelations/ramblinaround/studentpositions/ |
| right_column |
84604 |
/communityrelations/ramblinaround/rightcolumn/ |
| Footer |
29688 |
/communityrelations/footer/ |
| site_logo |
29689 |
/communityrelations/sitelogo/ |
| home_left |
54244 |
/communityrelations/homeleft/ |
| home_top |
54239 |
/communityrelations/hometop/ |
| Stories |
84503 |
/communityrelations/stories/ |
| archive |
84504 |
/communityrelations/stories/archive/ |
| News |
202256 |
/communityrelations/news/ |
| Community Service & Action |
24219 |
/serve/ |
| site_logo |
24286 |
/serve/sitelogo/ |
| Footer |
24285 |
/serve/footer/ |
| social media |
200869 |
/serve/socialmedia/ |
| modules-programming |
200861 |
/serve/modules-programming/ |
| About Us |
24222 |
/serve/aboutus/ |
| right_column |
86269 |
/serve/aboutus/rightcolumn/ |
| CSA Stories |
100957 |
/serve/aboutus/csastories/ |
| Staff: Tatiana Cortes |
100991 |
/serve/aboutus/csastories/stafftatianacortes/ |
| Student: Nithia Chowattukunnel |
100992 |
/serve/aboutus/csastories/studentnithiachowattukunnel/ |
| Student: Maranda Archer |
101425 |
/serve/aboutus/csastories/studentmarandaarcher/ |
| Student: Jenna Perryman |
101553 |
/serve/aboutus/csastories/studentjennaperryman/ |
| Staff: Lydia DeWyze |
102213 |
/serve/aboutus/csastories/stafflydiadewyze/ |
| Student: Michael Marino |
102216 |
/serve/aboutus/csastories/studentmichaelmarino/ |
| Staff: Megan Barry |
102455 |
/serve/aboutus/csastories/staffmeganbarry/ |
| Student: Lauren Kunzer |
102457 |
/serve/aboutus/csastories/studentlaurenkunzer/ |
| Student: Emily Tolley |
107436 |
/serve/aboutus/csastories/studentemilytolley/ |
| Student: Salena Ibrahim |
107518 |
/serve/aboutus/csastories/studentsalenaibrahim/ |
| Staff: Hannah Sternig |
107848 |
/serve/aboutus/csastories/staffhannahsternig/ |
| Student: Jacob Vodick |
108831 |
/serve/aboutus/csastories/studentjacobvodick/ |
| Staff: Libby Thronton |
109265 |
/serve/aboutus/csastories/stafflibbythronton/ |
| Student: Elise Anhorn |
109578 |
/serve/aboutus/csastories/studenteliseanhorn/ |
| Student: Amy Paul |
115954 |
/serve/aboutus/csastories/studentamypaul/ |
| Student: Ian Espiritu |
116233 |
/serve/aboutus/csastories/studentianespiritu/ |
| Student: Nathan Petithomme |
118732 |
/serve/aboutus/csastories/studentnathanpetithomme/ |
| Student: Cami Provencher |
119433 |
/serve/aboutus/csastories/studentcamiprovencher/ |
| Student: Benjamin Caceres |
120425 |
/serve/aboutus/csastories/studentbenjamincaceres/ |
| Student: Erin Hawkins |
125921 |
/serve/aboutus/csastories/studenterinhawkins/ |
| Student: Maddie Drescher |
125923 |
/serve/aboutus/csastories/studentmaddiedrescher/ |
| Community Partner: Andrea S. Barrios |
127264 |
/serve/aboutus/csastories/communitypartnerandreasbarrios/ |
| Alumni: Bryn Siberski |
127600 |
/serve/aboutus/csastories/alumnibrynsiberski/ |
| Student: Casey Kazich |
128461 |
/serve/aboutus/csastories/studentcaseykazich/ |
| Student: Gabriella Stec |
147644 |
/serve/aboutus/csastories/studentgabriellastec/ |
| Student: Derek Wagner |
149694 |
/serve/aboutus/csastories/studentderekwagner/ |
| Student: Carlos Martinez |
151736 |
/serve/aboutus/csastories/studentcarlosmartinez/ |
| Student: Allison Wiederin |
154309 |
/serve/aboutus/csastories/studentallisonwiederin/ |
| Student: Jakub Krasewicz |
154642 |
/serve/aboutus/csastories/studentjakubkrasewicz/ |
| Student: Ava Borrego |
154643 |
/serve/aboutus/csastories/studentavaborrego/ |
| Maya Marks-Strauss |
157857 |
/serve/aboutus/csastories/mayamarks-strauss/ |
| Student: Alex Rubin |
159253 |
/serve/aboutus/csastories/studentalexrubin/ |
| Student: Sarah LaVanway |
159444 |
/serve/aboutus/csastories/studentsarahlavanway/ |
| Student: Nhi Duong |
163147 |
/serve/aboutus/csastories/studentnhiduong/ |
| Student: Ashley Goldsmith |
163683 |
/serve/aboutus/csastories/studentashleygoldsmith/ |
| Student: Sumayyah Haider |
166099 |
/serve/aboutus/csastories/studentsumayyahhaider/ |
| Student: Hailey Samples |
167349 |
/serve/aboutus/csastories/studenthaileysamples/ |
| Student: Maria Diaz |
168313 |
/serve/aboutus/csastories/studentmariadiaz/ |
| Student: Brennan McDonald |
168958 |
/serve/aboutus/csastories/studentbrennanmcdonald/ |
| Student: Libbie McNamee |
207444 |
/serve/aboutus/csastories/studentlibbiemcnamee/ |
| Student: Emma Marfia |
207445 |
/serve/aboutus/csastories/studentemmamarfia/ |
| Student: Lilly Sabolay |
207448 |
/serve/aboutus/csastories/studentlillysabolay/ |
| Student: Simbiat Odetola |
207450 |
/serve/aboutus/csastories/studentsimbiatodetola/ |
| Student: Eman Rana |
207453 |
/serve/aboutus/csastories/studentemanrana/ |
| Student: Ailynn Duarte |
207454 |
/serve/aboutus/csastories/studentailynnduarte/ |
| Staff: Skylar Berlin |
207470 |
/serve/aboutus/csastories/staffskylarberlin/ |
| Student: Evelyn Ludwick |
207471 |
/serve/aboutus/csastories/studentevelynludwick/ |
| Student: Ashley Klauck |
207472 |
/serve/aboutus/csastories/studentashleyklauck/ |
| Staff: Claire Erlenborn |
207473 |
/serve/aboutus/csastories/staffclaireerlenborn/ |
| Staff: Emily Heitzman |
207474 |
/serve/aboutus/csastories/staffemilyheitzman/ |
| Staff: Br. Ayub Mwenda, OFM Conv |
207475 |
/serve/aboutus/csastories/staffbrayubmwendaofmconv/ |
| Student: Thomas Crabtree |
207476 |
/serve/aboutus/csastories/studentthomascrabtree/ |
| Student: Winta Girmai |
207477 |
/serve/aboutus/csastories/studentwintagirmai/ |
| Student: Scotty Monteith |
207478 |
/serve/aboutus/csastories/studentscottymonteith/ |
| Student: Elaniz Mojica |
207479 |
/serve/aboutus/csastories/studentelanizmojica/ |
| Student: Paul Kalapala |
207480 |
/serve/aboutus/csastories/studentpaulkalapala/ |
| Staff: Claire Noonan |
207484 |
/serve/aboutus/csastories/staffclairenoonan/ |
| Student: Anthony Maltese |
207485 |
/serve/aboutus/csastories/studentanthonymaltese/ |
| Student: Claire Creighton |
207486 |
/serve/aboutus/csastories/studentclairecreighton/ |
| Student: Josh Arsulowicz |
207488 |
/serve/aboutus/csastories/studentjosharsulowicz/ |
| Student: Mia Silvestros |
207490 |
/serve/aboutus/csastories/studentmiasilvestros/ |
| Staff: Arkhawan Salih |
207492 |
/serve/aboutus/csastories/staffarkhawansalih/ |
| Student: Ade Olu-Ajeigbe |
207493 |
/serve/aboutus/csastories/studentadeolu-ajeigbe/ |
| Student: Bizzy Stephenson |
207494 |
/serve/aboutus/csastories/studentbizzystephenson/ |
| Student: Alexandra Alanis |
207495 |
/serve/aboutus/csastories/studentalexandraalanis/ |
| Director's Welcome |
90403 |
/serve/aboutus/directorswelcome/ |
| Mission and Values |
90404 |
/serve/aboutus/missionandvalues/ |
| Why Serve? |
75824 |
/serve/aboutus/whyserve/ |
| Get Involved |
90406 |
/serve/aboutus/getinvolved/ |
| Meet Our Team |
90405 |
/serve/aboutus/meetourteam/ |
| profiles |
200888 |
/serve/aboutus/meetourteam/profiles/ |
| right_column |
200893 |
/serve/aboutus/meetourteam/profiles/rightcolumn/ |
| Contact Us |
75825 |
/serve/aboutus/contactus/ |
| Local Service |
24274 |
/serve/service/ |
| right_column |
86271 |
/serve/service/rightcolumn/ |
| Loyola4Chicago |
24312 |
/serve/service/l4c/ |
| Saturday of Service |
75826 |
/serve/service/saturdayofservice/ |
| Soup Kitchen |
71405 |
/serve/service/soupkitchen/ |
| Education & Advocacy |
75822 |
/serve/educationadvocacy/ |
| Ignatian Family Teach-In |
75833 |
/serve/educationadvocacy/ignatianfamilyteach-in/ |
| Post-Grad Service |
24276 |
/serve/postgrad/ |
| Discerning Your Options |
75831 |
/serve/postgrad/discerningyouroptions/ |
| Events |
75832 |
/serve/postgrad/events/ |
| Resources |
24248 |
/serve/resources/ |
| More Service Opportunities |
75834 |
/serve/resources/moreserviceopportunities/ |
| Reflection |
24281 |
/serve/resources/reflection/ |
| Service Advising |
154366 |
/serve/resources/serviceadvising/ |
| Conference Services |
25999 |
/conference/index.shtml |
| About Us |
26009 |
/conference/about.shtml |
| Contact Us |
26011 |
/conference/aboutus/contactus/ |
| Request Information |
26012 |
/conference/aboutus/requestinformation/ |
| Thank You |
92547 |
/conference/requestinfo/thankyou/ |
| Testimonials |
26013 |
/conference/aboutus/testimonials/ |
| Guest Survey |
64350 |
https://www.surveymonkey.com/s/LUConServ-CustomerFeedback |
| Policies |
191308 |
/conference/aboutus/policies/ |
| News |
117908 |
/conference/news/ |
| Stories |
117909 |
/conference/stories/ |
| archive |
117910 |
/conference/stories/archive/ |
| Photos |
117913 |
/conference/photos/ |
| right_column |
54453 |
/conference/aboutus/rightcolumn/ |
| Campus Venues |
26038 |
/conference/facilities.shtml |
| Lake Shore Campus |
26017 |
/conference/campusvenues/lakeshorecampus/ |
| Campus Recreation Spaces |
110310 |
/conference/campusvenues/lakeshorecampus/campusrecreationspaces/ |
| Indoor Spaces |
110312 |
/conference/campusvenues/lakeshorecampus/campusrecreationspaces/indoorspaces/ |
| Outdoor Spaces |
110311 |
/conference/campusvenues/lakeshorecampus/campusrecreationspaces/outdoorspaces/ |
| Hoyne Field |
110314 |
/conference/campusvenues/lakeshorecampus/campusrecreationspaces/outdoorspaces/hoynefield/ |
| Sean Earl Field |
110315 |
/conference/campusvenues/lakeshorecampus/campusrecreationspaces/outdoorspaces/seanearlfield/ |
| West Quad |
110316 |
/conference/campusvenues/lakeshorecampus/campusrecreationspaces/outdoorspaces/westquad/ |
| Winthrop Playlot |
110317 |
/conference/campusvenues/lakeshorecampus/campusrecreationspaces/outdoorspaces/winthropplaylot/ |
| Coffey Hall - McCormick Lounge |
26018 |
/conference/campusvenues/lakeshorecampus/coffeyhall-mccormicklounge/ |
| Crown Center |
26067 |
/conference/campusvenues/lakeshorecampus/crowncenter/ |
| Auditorium |
65947 |
/conference/campusvenues/lakeshorecampus/crowncenter/auditorium/ |
| Lobby |
65945 |
/conference/campusvenues/lakeshorecampus/crowncenter/lobby/ |
| Cuneo Hall |
65954 |
/conference/campusvenues/lakeshorecampus/cuneohall/ |
| Damen Student Center |
55076 |
/conference/campusvenues/lakeshorecampus/damenstudentcenter/ |
| Cinema |
65858 |
/conference/campusvenues/lakeshorecampus/damenstudentcenter/cinema/ |
| Conference Rooms |
65869 |
/conference/campusvenues/lakeshorecampus/damenstudentcenter/conferencerooms/ |
| Ireland's |
65859 |
/conference/campusvenues/lakeshorecampus/damenstudentcenter/irelands/ |
| Sister Jean Ballroom |
65857 |
/conference/campusvenues/lakeshorecampus/damenstudentcenter/sisterjeanballroom/ |
| Den |
185875 |
/conference/campusvenues/lakeshorecampus/damenstudentcenter/den/ |
| Flanner Hall Auditorium |
26070 |
/conference/campusvenues/lakeshorecampus/flannerhallauditorium/ |
| Gentile Arena |
107719 |
/conference/campusvenues/lakeshorecampus/gentilearena/ |
| Institute of Environmental Sustainability |
62582 |
/conference/campusvenues/lakeshorecampus/instituteofenvironmentalsustainability/ |
| Classrooms |
65862 |
/conference/campusvenues/lakeshorecampus/instituteofenvironmentalsustainability/classrooms/ |
| IES 123 & 124 |
65860 |
/conference/campusvenues/lakeshorecampus/instituteofenvironmentalsustainability/ies123124/ |
| Mundelein Center for Fine and Performing Arts |
26071 |
/conference/campusvenues/lakeshorecampus/mundeleincenterforfineandperformingarts/ |
| Jo Ann Rooney Hall |
65948 |
/conference/campusvenues/lakeshorecampus/mundeleincenterforfineandperformingarts/joannrooneyhall/ |
| Palm Court |
53170 |
/conference/campusvenues/lakeshorecampus/mundeleincenterforfineandperformingarts/palmcourt/ |
| Quinlan Life Sciences Building |
26073 |
/conference/campusvenues/lakeshorecampus/quinlanlifesciencesbuilding/ |
| Auditorium |
65864 |
/conference/campusvenues/lakeshorecampus/quinlanlifesciencesbuilding/auditorium/ |
| Classrooms |
65865 |
/conference/campusvenues/lakeshorecampus/quinlanlifesciencesbuilding/classrooms/ |
| Sullivan Center - Galvin Auditorium |
26076 |
/conference/campusvenues/lakeshorecampus/sullivan/ |
| right_column |
54434 |
/conference/campusvenues/lakeshorecampus/rightcolumn/ |
| Water Tower Campus |
26209 |
/conference/campusvenues/watertowercampus/ |
| Baumhart Hall |
62586 |
/conference/campusvenues/watertowercampus/baumharthall/ |
| Corboy Law Center |
26216 |
/conference/campusvenues/watertowercampus/corboylawcenter/ |
| Kasbeer Hall |
83006 |
/conference/campusvenues/watertowercampus/corboylawcenter/kasbeerhall/ |
| Corboy Law Classrooms |
83007 |
/conference/campusvenues/watertowercampus/corboylawcenter/corboylawclassrooms/ |
| Lewis Towers |
26217 |
/conference/campusvenues/watertowercampus/lewistowers/ |
| Beane Hall |
65866 |
/conference/campusvenues/watertowercampus/lewistowers/beanehall/ |
| Regents Hall |
65867 |
/conference/campusvenues/watertowercampus/lewistowers/regentshall/ |
| Loyola University Museum of Art |
26218 |
/conference/campusvenues/watertowercampus/loyolauniversitymuseumofart/ |
| right_column |
54463 |
/conference/campusvenues/watertowercampus/rightcolumn/ |
| Schreiber Center |
87587 |
/conference/campusvenues/watertowercampus/schreibercenter/ |
| Board Room |
87588 |
/conference/campusvenues/watertowercampus/schreibercenter/boardroom/ |
| Wintrust Hall |
87589 |
/conference/campusvenues/watertowercampus/schreibercenter/wintrusthall/ |
| Retreat and Ecology Campus |
26061 |
/retreatcampus/ |
| right_column |
54454 |
/conference/campusvenues/rightcolumn/ |
| Health Sciences Campus |
102996 |
http://hsd.luc.edu/conference/ |
| Services |
26039 |
/conference/services/ |
| Audio-Visual Services |
26040 |
/conference/services/audio-visualservices/ |
| Church Services |
26237 |
/conference/services/churchservices/ |
| Catering |
55124 |
http://www.luc.edu/catering/ |
| Campus Maps & Parking |
55125 |
http://www.luc.edu/visit.shtml |
| Make a Payment |
58919 |
https://epay.luc.edu/C20996_ustores/web/store_cat.jsp?STOREID=2&CATID=2&SINGLESTORE=true |
| right_column |
54456 |
/conference/services/rightcolumn/ |
| Housing |
61151 |
/conference/housing/ |
| Baumhart Suites |
61168 |
/conference/housing/baumhartsuites/ |
| Intern Housing |
70558 |
/conference/housing/internhousing/ |
| Short- and Long-term Housing |
89762 |
/conference/housing/short-and-long-term/ |
| Summer Housing |
61170 |
/conference/housing/summerhousing/ |
| Hotels / Accommodations |
61172 |
/conference/housing/hotelsaccommodations/ |
| right_column |
61169 |
/conference/housing/rightcolumn/ |
| Wedding Receptions |
26047 |
/conference/loyolaweddings/ |
| Lake Shore Wedding Reception Venues |
26213 |
/conference/loyolaweddings/lsc-weddings/ |
| Water Tower Wedding Reception Venues |
26221 |
/conference/loyolaweddings/wtc-weddings/ |
| right_column |
54447 |
/conference/loyolaweddings/rightcolumn/ |
| home_top |
54250 |
/conference/hometop/ |
| home_left |
54251 |
/conference/homeleft/ |
| home_right |
54256 |
/conference/homeright/ |
| home_news |
54249 |
/conference/homenews/ |
| Archive |
99408 |
/conference/archive/ |
| brochure |
105643 |
/conference/brochure/index.html |
| site_logo |
26008 |
/conference/sitelogo/ |
| Footer |
26007 |
/conference/footer/ |
| cta |
186044 |
/conference/cta/ |
| social media |
200427 |
/conference/socialmedia/ |
| modules-programming |
200428 |
/conference/modules-programming/ |
| Connect Hub |
177072 |
/connecthub/ |
| site_logo |
177073 |
/connecthub/sitelogo/ |
| Interior Page 1 |
177115 |
/connecthub/interiorpage1/ |
| Interior Page 2 |
177116 |
/connecthub/interiorpage2/ |
| Copyright and Disclaimer |
15229 |
/info/copyright_disclaimer.shtml |
| Copyright at Loyola University Chicago |
12553 |
/copyright/index.shtml |
| Footer |
12653 |
/copyright/footer/ |
| Fair Use Checklist |
58853 |
/copyright/fairusechecklist/ |
| Use of Copyrighted Works by University Faculty |
12560 |
/copyright/use.shtml |
| Video Tutorials |
60805 |
/copyright/videotutorials/ |
| Core |
12188 |
/core/index.shtml |
| site_logo |
12237 |
/core/sitelogo/ |
| Footer |
12234 |
/core/footer/ |
| cta |
198609 |
/core/cta/ |
| social media |
198611 |
/core/socialmedia/ |
| Core Guide |
12198 |
/core/core-guide.shtml |
| Core Areas and Courses |
198690 |
https://catalog.luc.edu/undergraduate/university-requirements/university-core/core-area-and-courses/ |
| Requirements for Students Entering as Freshman |
198692 |
https://catalog.luc.edu/undergraduate/university-requirements/university-core/students-entering-freshmen/ |
| Requirements for Transfer Students |
198693 |
https://catalog.luc.edu/undergraduate/university-requirements/university-core/transfer-students/ |
| Requirements for Arrupe College Students |
198689 |
https://www.luc.edu/arrupe/academics/degrees/ |
| Core and Your Major or Minor |
198691 |
https://catalog.luc.edu/undergraduate/university-requirements/university-core/core-major-minor/ |
| Honors Program and the Core Curriculum |
116835 |
https://catalog.luc.edu/undergraduate/university-requirements/university-core/honors-core/ |
| Diversity and the Core Curriculum |
198694 |
https://catalog.luc.edu/undergraduate/university-requirements/university-core/diversity-core/ |
| Academic Standards and Regulations |
204756 |
https://catalog.luc.edu/academic-standards-regulations/undergraduate/ |
| Criminal Justice & Criminology, Department of |
19004 |
/criminaljustice/index.shtml |
| site_logo |
19081 |
/criminaljustice/sitelogo/ |
| cta |
199495 |
/criminaljustice/cta/ |
| social media |
199496 |
/criminaljustice/socialmedia/ |
| About |
19006 |
/criminaljustice/about/ |
| Stories |
86187 |
/criminaljustice/stories/ |
| archive |
86190 |
/criminaljustice/stories/archive/ |
| 2026 CJC Honors Event |
207151 |
/criminaljustice/stories/2026cjchonorsevent/ |
| Faculty & Staff |
19010 |
/criminaljustice/about/facultystaff/ |
| Aggregate Faculty Page |
202442 |
/criminaljustice/about/faculty/aggregatefacultypage/ |
| Profiles |
199471 |
/criminaljustice/about/faculty/aggregatefacultypage/profiles/ |
| Research |
19012 |
/criminaljustice/Research.shtml |
| News |
86186 |
/criminaljustice/news/ |
| Center for Criminal Justice |
206537 |
https://loyolaccj.org/ |
| right_column |
86216 |
/criminaljustice/about/rightcolumn/ |
| 2026 CJC Graduates and Awards |
97971 |
/criminaljustice/about/2026cjcgraduatesandawards/ |
| Academics |
19015 |
/criminaljustice/academicprograms.shtml |
| BS in Criminal Justice & Criminology |
102246 |
/criminaljustice/bsincriminaljusticecriminology/ |
| Minor in Criminal Justice & Criminology |
102248 |
/criminaljustice/minorincriminaljusticecriminology/ |
| Accelerated Master's Pathway (AMP) |
19032 |
/criminaljustice/Five_year_program.shtml |
| MA in Criminal Justice & Criminology |
19022 |
/criminaljustice/macj.shtml |
| Masters Theses |
100421 |
/criminaljustice/masterstheses/ |
| Certificates |
100825 |
/criminaljustice/certificates/ |
| Internship Program |
19021 |
/criminaljustice/internships.shtml |
| Minor in Sociolegal Studies |
102252 |
http://www.luc.edu/sociolegal/ |
| Minor in Psychology of Crime and Justice |
101789 |
http://luc.edu/psych-cj/ |
| Admission Requirements |
19016 |
/criminaljustice/cjadm.shtml |
| Course Descriptions |
19017 |
/criminaljustice/coursedesc.shtml |
| Graduate Course Descriptions |
19018 |
/criminaljustice/graduatecourses.shtml |
| Graduate Programs |
19019 |
/criminaljustice/gradtest.shtml |
| Undergraduate Course Descriptions |
19023 |
/criminaljustice/undergradcourses.shtml |
| right_column |
86219 |
/criminaljustice/rightcolumn/ |
| Admission |
19026 |
/criminaljustice/admission.shtml |
| Undergraduate |
19030 |
/criminaljustice/undergrad_admission.html |
| Graduate |
19028 |
/criminaljustice/graduate1.html |
| Financial Aid |
19027 |
/criminaljustice/financial_aid.html |
| Request Information |
19029 |
/criminaljustice/requestinformation.shtml |
| right_column |
86223 |
/criminaljustice/rightcolumn/ |
| Resources |
19051 |
/criminaljustice/resources.shtml |
| Student Organizations |
19052 |
/criminaljustice/students.shtml |
| right_column |
52406 |
/criminaljustice/rightcolumn/ |
| Internship/Career Placement |
19050 |
/criminaljustice/agencies.shtml |
| Criminal Justice Links |
19049 |
/criminaljustice/links.shtml |
| right_column |
86224 |
/criminaljustice/rightcolumn/ |
| Contact Us |
19007 |
/criminaljustice/contactus.shtml |
| Combined B.S./M.A. in Criminal Justice and Criminology |
19033 |
/criminaljustice/bsmacj.html |
| Graduate Student Community |
19044 |
/criminaljustice/Graduate_Community.shtml |
| modules-programming |
199409 |
/criminaljustice/modules-programming/ |
| Footer |
19080 |
/criminaljustice/footer/ |
| CSAA Redirect |
180071 |
/csaa/ |
| CTA U-Pass |
182333 |
/upass/ |
| site_logo |
182334 |
/upass/sitelogo/ |
| cta |
182336 |
/upass/cta/ |
| I Links |
182337 |
/upass/ilinks/ |
| About U-Pass |
182721 |
/upass/aboutu-pass/ |
| About CTA |
182722 |
/upass/aboutu-pass/aboutcta/ |
| Contact Information |
182723 |
/upass/aboutu-pass/contactinformation/ |
| How it Works |
182725 |
/upass/aboutu-pass/howitworks/ |
| Policies |
182724 |
/upass/aboutu-pass/policies/ |
| U-Pass Distribution |
182736 |
/upass/u-passdistribution/ |
| U-Pass Activation |
183575 |
/upass/u-passactivation/ |
| Activation Dates |
183577 |
/upass/u-passactivation/activationdates/ |
| Eligibility Requirements |
183576 |
/upass/u-passactivation/eligibilityrequirements/ |
| Opt-In |
187938 |
/upass/u-passactivation/opt-in/ |
| U-Pass Troubleshooting |
183581 |
/upass/u-passtroubleshooting/ |
| Lost/Stolen Card |
183583 |
/upass/u-passtroubleshooting/loststolencard/ |
| Pass Not Working |
183584 |
/upass/u-passtroubleshooting/passnotworking/ |
| U-Pass Opt-Out |
183585 |
/upass/u-passopt-out/ |
| Opt-Out FAQ |
183586 |
/upass/u-passopt-out/opt-outfaq/ |
| FAQs |
194575 |
/upass/faqs/ |
| Culture of Respect |
185164 |
/coalition/cultureofrespect/index.shtml |
| Cuneo Mansion & Gardens |
31283 |
/cuneo/ |
| site_logo |
202249 |
/cuneo/sitelogo/ |
| CURA Network |
185843 |
/cura/ |
| site_logo |
185844 |
/cura/sitelogo/ |
| CTA |
186035 |
/cura/cta/ |
| Footer |
185845 |
/cura/footer/ |
| I Links |
186170 |
/cura/ilinks/ |
| About |
185846 |
/cura/about/ |
| About CURA |
185853 |
/cura/about/aboutcura/ |
| Behavioral Concerns Team (BCT) |
185850 |
/cura/about/behavioralconcernsteambct/ |
| Coordinated Assistance & Resource Education (CARE) |
185854 |
/cura/about/coordinatedassistanceresourceeducationcare/ |
| Equity-Based Services (Discrimination and Sexual Misconduct, including Title IX) |
188151 |
https://www.luc.edu/equity/ |
| Student Academic Services |
185856 |
/sas/ |
| Student Rights, Responsibilities & Conflict Resolution |
185857 |
/osccr/ |
| Other Resources |
185858 |
/cura/about/otherresources/ |
| Basic Needs Support |
187009 |
/cura/basicneedssupport/ |
| Food Assistance |
188083 |
/cura/basicneedssupport/foodassistance/ |
| Housing Assistance |
188084 |
/cura/basicneedssupport/housingassistance/ |
| Financial Assistance and Resources |
188085 |
/cura/basicneedssupport/financialassistanceandresources/ |
| Students |
185847 |
/cura/students/ |
| Student Resources |
185860 |
/cura/students/studentresources/ |
| Academic Resources |
185863 |
/cura/students/academicresources/ |
| Economic Resources |
185865 |
/cura/students/economicresources/ |
| Food and Housing Resources for Students |
188103 |
/cura/basicneedssupport/ |
| Food and Housing Resources for Students - OLD |
185866 |
/cura/students/foodandhousingresourcesforstudents-old/ |
| Wellness Center |
185868 |
/wellness/ |
| Additional Resources |
185869 |
/cura/students/additionalresources/ |
| Faculty and Staff |
185848 |
/cura/facultyandstaff/ |
| Faculty and Staff Resources |
185867 |
/cura/facultyandstaff/facultyandstaffresources/ |
| Red Folder |
186973 |
/cura/facultyandstaff/redfolder/ |
| Parents and Families |
185849 |
/cura/parentsandfamilies/ |
| Parent and Family Resources |
185864 |
/cura/parentsandfamilies/parentandfamilyresources/ |
| Privacy v. Confidentiality |
185877 |
/cura/parentsandfamilies/privacyvconfidentiality/ |
| Community Members and Guests |
185852 |
/cura/communitymembersandguests/ |
| Local Community and Guest Resources |
185879 |
/cura/communitymembersandguests/localcommunityandguestresources/ |
| Damen Student Center |
15364 |
/damenstudentcenter/index.shtml |
| About Us |
15701 |
/damenstudentcenter/about/ |
| Our Mission |
22584 |
/damenstudentcenter/about/mission/ |
| Contact Us |
15706 |
/damenstudentcenter/about/contact/ |
| Hours of Operation |
53744 |
/damenstudentcenter/about/hoursofoperation/ |
| right_column |
53849 |
/damenstudentcenter/about/rightcolumn/ |
| Facility Policies |
64363 |
/damenstudentcenter/about/facilitypolicies/ |
| Sustainability Efforts |
94297 |
/damenstudentcenter/about/sustainabilityefforts/ |
| Location and Directions |
76677 |
/damenstudentcenter/about/locationanddirections/ |
| Floor Plans |
53696 |
/damenstudentcenter/about/floorplans/ |
| Damen Dining |
53740 |
/damenstudentcenter/dining/ |
| Services |
15730 |
/damenstudentcenter/infodesk/ |
| Services |
15732 |
/damenstudentcenter/infodesk/services/ |
| Lost and Found |
15731 |
/damenstudentcenter/infodesk/lostandfound/ |
| U-Pass |
18820 |
http://www.luc.edu/upass/ |
| Student Employment |
15727 |
/damenstudentcenter/infodesk/employment/ |
| right_column |
53865 |
/damenstudentcenter/infodesk/rightcolumn/ |
| Commuter Locker Space |
115610 |
/damenstudentcenter/infodesk/commuterlockerspace/ |
| Programming |
18814 |
/damenstudentcenter/programming/ |
| right_column |
53903 |
/damenstudentcenter/programming/rightcolumn/ |
| Department of Programming |
11510 |
/damenstudentcenter/programming/afterhours/index.shtml |
| Ireland's |
76904 |
/damenstudentcenter/programming/irelands/ |
| Reservations |
53769 |
/damenstudentcenter/space/ |
| Damen Spaces |
53824 |
/damenstudentcenter/space/damen-spaces/ |
| Event Services |
15912 |
/damenstudentcenter/space/eventservices/ |
| Damen Cinema |
73821 |
/damenstudentcenter/space/damencinema/ |
| site_logo |
15916 |
/damenstudentcenter/sitelogo/ |
| Footer |
15917 |
/damenstudentcenter/footer/ |
| cta |
186046 |
/damenstudentcenter/cta/ |
| Archive |
53161 |
/damenstudentcenter/archive/ |
| DSD Areas |
186587 |
/damenstudentcenter/dsdareas/ |
| Campus Recreation |
186588 |
/campusrec/ |
| Campus Reservations |
186589 |
/campus_reservations/ |
| Community Coalition on Gender-Based Violence |
186593 |
/coalition/ |
| Conference Services |
186594 |
/conference/index.shtml |
| CTA U-Pass |
186595 |
/upass/ |
| Damen Student Center |
186597 |
/damenstudentcenter/index.shtml |
| Family Weekend |
186599 |
/familyweekend/ |
| Graduate, Professional, and Adult Student Life |
186600 |
/gpasl/ |
| Loyola University Museum of Art |
186601 |
/luma/ |
| Office of Student Conduct and Conflict Resolution |
186602 |
/osccr/ |
| Student Government |
186604 |
/sglc/ |
| Terry Student Center |
186605 |
/tsc/ |
| Wellness Center |
186607 |
/wellness/ |
| Grand Opening |
54645 |
/damenstudentcenter/grand-opening/ |
| Reimagine 3 Video Contest |
54646 |
/damenstudentcenter/grand-opening/video-contest/ |
| Play the Damen Game |
54647 |
/damenstudentcenter/grand-opening/damen-game/ |
| right_column |
54027 |
/damenstudentcenter/rightcolumn/ |
| social media |
203255 |
/damenstudentcenter/socialmedia/ |
| Data Science |
167720 |
/datascience/ |
| site_logo |
167721 |
/datascience/sitelogo/ |
| Footer |
167722 |
/datascience/footer/ |
| cta |
167724 |
/datascience/cta/ |
| social media |
167725 |
/datascience/socialmedia/ |
| modules-programming |
167726 |
/datascience/modules-programming/ |
| About |
167727 |
/datascience/about/ |
| Welcome |
167732 |
/datascience/about/welcome/ |
| What is Data Science? |
167733 |
/datascience/about/whatisdatascience/ |
| Unlocking the Power of Data at Loyola |
195886 |
/datascience/about/unlockingthepowerofdataatloyola/ |
| Contact Us |
167734 |
/datascience/about/contactus/ |
| People |
167728 |
/datascience/people/ |
| Faculty |
167735 |
/datascience/people/faculty/ |
| Staff |
167736 |
/datascience/people/staff/ |
| Students |
167737 |
/datascience/people/students/ |
| Alumni |
167738 |
/datascience/people/alumni/ |
| Academics |
167729 |
/datascience/academics/ |
| Undergraduate |
167739 |
/datascience/academics/undergraduate/ |
| Major (BS) |
167742 |
/datascience/academics/undergraduate/majorbs/ |
| Minor |
167743 |
/datascience/academics/undergraduate/minor/ |
| Graduate |
167740 |
/datascience/academics/graduate/ |
| 4+1 Program |
167741 |
/datascience/academics/41program/ |
| Graduate Handbook |
191663 |
/datascience/academics/graduatehandbook/ |
| Learning Outcomes |
178499 |
/datascience/academics/learningoutcomes/ |
| Admissions |
167730 |
/datascience/admissions/ |
| Undergraduate |
167744 |
/datascience/admissions/undergraduate/ |
| Graduate |
167745 |
/datascience/admissions/graduate/ |
| Events |
167731 |
/datascience/events/ |
| Data Fest |
167746 |
/datascience/events/datafest/ |
| Data Science Seminar |
180699 |
/datascience/events/datascienceseminar/ |
| Department of Computer Science |
178952 |
/cs/ |
| site_logo |
179122 |
/cs/sitelogo/ |
| Footer |
179123 |
/cs/footer/ |
| cta |
179124 |
/cs/cta/ |
| social media |
179127 |
/cs/socialmedia/ |
| modules-programming |
179126 |
/cs/modules-programming/ |
| About us |
178953 |
/cs/aboutus/ |
| People |
178954 |
/cs/aboutus/people/ |
| Profiles |
182161 |
/cs/aboutus/people/profiles/ |
| Full-Time Faculty |
182162 |
/cs/aboutus/people/full-timefaculty/ |
| Part-Time Faculty |
182163 |
/cs/aboutus/people/part-timefaculty/ |
| Staff |
182164 |
/cs/aboutus/people/staff/ |
| Tutors |
182165 |
/cs/aboutus/people/tutors/ |
| Emeritus, Affiliate Faculty, and Visiting Scholars |
182166 |
/cs/aboutus/people/emeritusaffiliatefacultyandvisitingscholars/ |
| PHD Students |
191117 |
/cs/aboutus/people/phdstudents/ |
| Program Advisory Committee |
182167 |
/cs/aboutus/people/programadvisorycommittee/ |
| Contact Us |
178962 |
/cs/aboutus/contactus/ |
| Student Activities |
191515 |
/cs/aboutus/studentactivities/ |
| Loyola Center for Cybersecurity |
195824 |
/ccpc/ |
| Technology Living-Learning Community |
207176 |
/cs/aboutus/technologyliving-learningcommunity/ |
| Academics |
189016 |
/cs/academics/ |
| Majors |
188817 |
/cs/academics/majors/ |
| Minors |
188818 |
/cs/academics/minors/ |
| Certificates |
188819 |
/cs/academics/certificates/ |
| Masters |
188820 |
/cs/academics/masters/ |
| Doctoral (PhD) |
189004 |
/cs/academics/doctoralphd/ |
| Combined (BS/MS) |
189003 |
/cs/academics/combinedbsms/ |
| Course Catalog |
189013 |
https://catalog.luc.edu/course-descriptions/comp/ |
| STEM Designation |
179014 |
/cs/academics/stemdesignation/ |
| Resources |
190697 |
/cs/resources/ |
| Tutoring |
179000 |
/cs/resources/tutoring/ |
| Schedules |
178956 |
/cs/resources/schedules/ |
| Advising |
178998 |
/cs/resources/advising/ |
| Undergraduate Awards |
178999 |
/cs/resources/undergraduateawards/ |
| "Double-Dipping" Rules |
185253 |
/cs/resources/double-dippingrules/ |
| Graduate Handbook |
185155 |
/cs/resources/graduatehandbook/ |
| Admissions |
185156 |
/cs/resources/graduatehandbook/admissions/ |
| Financial Assistance |
185158 |
/cs/resources/graduatehandbook/financialassistance/ |
| Graduate Program Personnel |
185157 |
/cs/resources/graduatehandbook/graduateprogrampersonnel/ |
| Regulations and Procedures |
185159 |
/cs/resources/graduatehandbook/regulationsandprocedures/ |
| Career Development |
185161 |
/cs/resources/graduatehandbook/careerdevelopment/ |
| Loyola Services |
185162 |
/cs/resources/graduatehandbook/loyolaservices/ |
| Visit |
185163 |
/cs/resources/graduatehandbook/visit/ |
| Undergraduate Practicum Requirement |
200739 |
/cs/resources/undergraduatepracticumrequirement/ |
| Research |
178958 |
/cs/research/ |
| Opportunities |
185516 |
/cs/research/opportunities/ |
| Faculty Research |
185517 |
/cs/research/facultyresearch/ |
| Publications |
185518 |
https://ecommons.luc.edu/cs_facpubs/ |
| CS Research Symposium |
185523 |
/cs/research/csresearchsymposium/ |
| Free and Open Source Software |
185521 |
/cs/research/freeandopensourcesoftware/ |
| Research Groups |
202263 |
/cs/research/researchgroups/ |
| Funding |
185522 |
/cs/research/funding/ |
| Faculty Research - in progress |
202472 |
/cs/research/facultyresearch-inprogress/ |
| Research Groups In Progress |
202473 |
/cs/research/researchgroupsinprogress/ |
| Admission |
178957 |
/cs/admission/ |
| Prospective Undergrads & Transfer Students |
178961 |
/cs/admission/prospectiveundergradstransferstudents/ |
| Job Placement |
178991 |
/cs/admission/prospectiveundergradstransferstudents/jobplacement/ |
| Transfer Guides |
178987 |
/cs/admission/prospectiveundergradstransferstudents/transferguides/ |
| Computer Science and Other Disciplines |
178988 |
/cs/admission/prospectiveundergradstransferstudents/computerscienceandotherdisciplines/ |
| Job Growth Projections |
178989 |
/cs/admission/prospectiveundergradstransferstudents/jobgrowthprojections/ |
| Student Activities |
191516 |
/cs/aboutus/studentactivities/ |
| Financial Aid |
185552 |
/cs/admission/financialaid/ |
| Financial Aid Office |
185555 |
https://www.luc.edu/finaid/index.shtml?utm_medium=redirect&utm_campaign=finaid-redirects&utm_source=finaid/index-html |
| Stories |
181691 |
/cs/stories/ |
| archive |
181692 |
/cs/stories/archive/ |
| Department of Fine and Performing Arts |
30074 |
/dfpa/ |
| Footer |
199327 |
/dfpa/footer/ |
| site_logo |
30343 |
/dfpa/sitelogo/ |
| cta |
199329 |
/dfpa/cta/ |
| social media |
199333 |
/dfpa/socialmedia/ |
| modules-programming |
199334 |
/dfpa/modules-programming/ |
| About Us |
30076 |
/dfpa/about.shtml |
| Message from the Chair |
147935 |
/dfpa/messagefromthechair/ |
| Faculty and Staff Directory |
57335 |
/dfpa/facultyandstaffdirectory/ |
| Profiles |
199515 |
/dfpa/facultyandstaffdirectory/profiles/ |
| In Memoriam |
196102 |
/dfpa/inmemoriam/ |
| Jonathan Wilson |
196106 |
/dfpa/inmemoriam/jonathanwilson/ |
| Juliet Rago McNamara |
196107 |
/dfpa/inmemoriam/julietragomcnamara/ |
| Artist-in-Residence Program |
184745 |
/dfpa/artist-in-residenceprogram/ |
| Jessica Lanay |
195753 |
/dfpa/artist-in-residenceprogram/jessicalanay/ |
| Rohina Malik |
186978 |
/dfpa/artist-in-residenceprogram/rohinamalik/ |
| Kaoru Watanabe |
184569 |
/dfpa/artist-in-residenceprogram/kaoruwatanabe/ |
| Aram Han Sifuentes |
184590 |
/dfpa/artist-in-residenceprogram/aramhansifuentes/ |
| Blakeley White McGuire |
184570 |
/dfpa/artist-in-residenceprogram/blakeleywhitemcguire/ |
| Sandra Delgado |
184571 |
/dfpa/artist-in-residenceprogram/sandradelgado/ |
| Wendel Patrick |
184572 |
/dfpa/artist-in-residenceprogram/wendelpatrick/ |
| Matthew Rose |
185331 |
/dfpa/artist-in-residenceprogram/matthewrose/ |
| Rick Valicenti |
185332 |
/dfpa/artist-in-residenceprogram/rickvalicenti/ |
| Ross Lehman |
185333 |
/dfpa/artist-in-residenceprogram/rosslehman/ |
| DEI Committee |
166182 |
/dfpa/deicommittee/ |
| Contact Us |
30078 |
/dfpa/contact.shtml |
| Our Spaces |
114308 |
/dfpa/ourspaces/ |
| History of the Mundelein Center |
103345 |
/dfpa/ourspaces/historyofthemundeleincenter/ |
| Academics |
30088 |
/dfpa/Academics_1.shtml |
| Dance |
30091 |
/dfpa/dance/index.shtml |
| Dance Major |
30116 |
/dfpa/DanceMajor.shtml |
| Dance Minor |
30117 |
/dfpa/DanceMinor.shtml |
| Fine Arts |
30093 |
/dfpa/a_fnar_main.shtml |
| Music |
30095 |
/dfpa/music/index.shtml |
| Applied Music |
30378 |
/dfpa/music/appliedmusic/ |
| Applied Music: New Student Guidelines |
30382 |
/dfpa/music/appliedmusic/appliedmusicnewstudentguidelines/ |
| Applied Music: Re-enrolling Students |
30383 |
/dfpa/music/appliedmusic/appliedmusicre-enrollingstudents/ |
| Music - Ensembles |
30524 |
/dfpa/ensembles/index.shtml |
| Chamber Choir |
30525 |
/dfpa/music/chamberchoir/ |
| Chorus |
30526 |
/dfpa/music/chorus/ |
| Jazz Ensemble |
30527 |
/dfpa/music/jazzensemble/ |
| Liturgical Choir |
30528 |
/dfpa/music/liturgicalchoir/ |
| Wind Ensemble |
30531 |
/dfpa/music/windensemble/ |
| Jazz Studies |
64509 |
/dfpa/music/jazzstudies/ |
| Liturgical Music |
64510 |
/dfpa/music/liturgicalmusic/ |
| Theatre |
30097 |
/dfpa/a_thth_mainpage.shtml |
| J. Pat Miller scholarship recipients |
30334 |
/dfpa/jpatmillerscholarshiprecipients/ |
| Raoul "Doc" johnson scholarship recipients |
30177 |
/dfpa/RaoulJohnsonRecipien1.shtml |
| James wesley white, jr. scholarship recipients |
30143 |
/dfpa/JamesWWhiteRecipient1.shtml |
| Scene Shop Safety Videos |
65302 |
/dfpa/sceneshopsafetyvideos/ |
| Teaching Artist Minor |
200701 |
/dfpa/teachingartistminor/ |
| DFPA Courses |
30090 |
/dfpa/Courses.shtml |
| Advising |
30089 |
/dfpa/Advising.shtml |
| Admissions |
30100 |
/dfpa/admission.shtml |
| Auditions |
70315 |
/dfpa/auditions/ |
| Financial Assistance |
30104 |
/dfpa/Financial_Assistance.html |
| Events |
30126 |
/dfpa/Arts_Alive_Blog.html |
| Online Events Archive |
147937 |
/dfpa/onlineeventsarchive/ |
| Resources |
82993 |
/dfpa/resources/ |
| Student Employment |
83659 |
/dfpa/resources/studentemployment/ |
| Resources for Supervisors |
163500 |
/dfpa/resources/studentemployment/resourcesforsupervisors/ |
| Resources for Students |
163501 |
/dfpa/resources/studentemployment/resourcesforstudents/ |
| DFPA Admin Job Descriptions |
178044 |
/dfpa/resources/studentemployment/resourcesforstudents/dfpaadminjobdescriptions/ |
| Dance Job Descriptions |
178045 |
/dfpa/resources/studentemployment/resourcesforstudents/dancejobdescriptions/ |
| Fine Arts Job Descriptions |
178046 |
/dfpa/resources/studentemployment/resourcesforstudents/fineartsjobdescriptions/ |
| Music Job Descriptions |
178047 |
/dfpa/resources/studentemployment/resourcesforstudents/musicjobdescriptions/ |
| Student Resources |
103118 |
/dfpa/resources/studentresources/ |
| Technology Support for Online Teaching |
154118 |
/dfpa/resources/technologysupportforonlineteaching/ |
| Faculty and Staff Resources |
93495 |
/dfpa/resources/facultyandstaffresources/ |
| Faculty and Staff Newsletters |
151810 |
/dfpa/resources/facultyandstaffnewsletters/ |
| Request Forms |
117977 |
/dfpa/resources/requestforms/ |
| Footer |
30342 |
/dfpa/footer/ |
| archive |
30339 |
/dfpa/archive/ |
| Dramatists Materials |
30124 |
/dfpa/Dramaturgical_Materials.shtml |
| dfpa security operations as of fall term 2011 |
30122 |
/dfpa/DFPA_Security_Operat.shtml |
| Dress codes for dance technique classes |
30125 |
/dfpa/Dress_Codes_for_Dance_Technique_Classes_.shtml |
| Faculty Biennial: Secret Lives Revealed |
30133 |
/dfpa/Secret_Lives_Reveale.shtml |
| Italian Cultural Center |
30142 |
/dfpa/Italian_Cultural_Center.shtml |
| Join Our Mailing List |
30146 |
/dfpa/Join_Our_Mailing_List.shtml |
| Lar Lubovitch dance company sUMMER DANCE PROGRAM |
30148 |
/dfpa/Lar_Lubovitch_Dance_.shtml |
| Scheduling auditions/interviews |
30181 |
/dfpa/theatrescholarshipop.shtml |
| Stories |
46945 |
/dfpa/stories/index.html |
| archive |
65175 |
/dfpa/stories/archive/ |
| Photo Minor Responds to Family Life in Quarantine |
146875 |
/dfpa/photominorrespondstofamilylifeinquarantine/ |
| Return to Campus |
162176 |
/dfpa/returntocampus/ |
| Production staff job descriptions |
30173 |
/dfpa/ProductionStaffDescr.shtml |
| Safety information sheets for musical theatre and theatre |
30179 |
/dfpa/safety_info_sheets_m.shtml |
| Department of Military Science |
16670 |
/militaryscience/index.shtml |
| right_column |
55196 |
/militaryscience/rightcolumn/ |
| About Us |
55030 |
/militaryscience/aboutus/ |
| History of Army ROTC at Loyola |
16671 |
/militaryscience/aboutus/history.shtml |
| Participating Schools |
201354 |
/militaryscience/aboutus/participatingschools/ |
| Faculty and Staff |
155365 |
/militaryscience/aboutus/facultyandstaff/ |
| Lieutenant Colonel Zachary Novitske, Chair & Professor of Military Science |
179340 |
/militaryscience/aboutus/facultyandstaff/lieutenantcolonelzacharynovitskechairprofessorofmilitaryscience/ |
| Captain Edward Sooy, Assistant Professor of Military Science |
196151 |
/militaryscience/aboutus/facultyandstaff/captainedwardsooyassistantprofessorofmilitaryscience/ |
| Sergeant First Class Joseph Holmes, Assistant Professor of Military Science |
199905 |
/militaryscience/aboutus/facultyandstaff/sergeantfirstclassjosephholmesassistantprofessorofmilitaryscience/ |
| Mr. Jason Black, Human Resources Administrator |
155374 |
/militaryscience/aboutus/facultyandstaff/mrjasonblackhumanresourcesadministrator/ |
| Mr. Jason Nation, Supply Technician |
199082 |
/militaryscience/aboutus/facultyandstaff/mrjasonnationsupplytechnician/ |
| Professors of Military Science |
123017 |
/militaryscience/aboutus/professorsofmilitaryscience/ |
| Contact Information |
55102 |
/militaryscience/aboutus/contactinformation/ |
| Academics |
16676 |
/militaryscience/fall-courses.shtml |
| Scholarships |
55051 |
/militaryscience/scholarships/ |
| Army Nursing Program |
55048 |
/militaryscience/scholarships/armynursingprogram/ |
| SMP Scholarship Option |
84940 |
/militaryscience/scholarships/smpscholarshipoption/ |
| Request More Information |
56883 |
/militaryscience/requestmoreinformation/ |
| Thank You |
56884 |
/militaryscience/requestmoreinformation/thankyou/ |
| Cadet Life |
57142 |
/militaryscience/cadetlife/ |
| Additional Opportunities |
55050 |
/militaryscience/cadetlife/additionalopportunities/ |
| Extracurriculars |
201326 |
/militaryscience/cadetlife/extracurriculars/ |
| Old Pages |
55045 |
/militaryscience/oldpages/ |
| Active Duty Soldiers and Veterans |
16664 |
/militaryscience/oldpages/activeandvets.shtml |
| Commissions per School Year |
16667 |
/militaryscience/oldpages/commisions.shtml |
| Spring Courses in Military Science and Leadership |
16680 |
/militaryscience/oldpages/spring-courses.shtml |
| Loyola Armed Forces Club |
16672 |
/militaryscience/oldpages/loyolaafc.shtml |
| Loyola Army ROTC Alumni |
16673 |
/militaryscience/oldpages/alumni.shtml |
| Rambler Battalion Memorial Page |
103670 |
/militaryscience/oldpages/ramblerbattalionmemorialpage/ |
| Footer |
16679 |
/militaryscience/footer/ |
| site_logo |
56637 |
/militaryscience/sitelogo/ |
| Color Guard Request |
104944 |
/militaryscience/colorguardrequest/ |
| cta |
198745 |
/militaryscience/cta/ |
| social media |
198746 |
/militaryscience/socialmedia/ |
| Department of Physics |
28379 |
/physics/index.shtml |
| site_logo |
28416 |
/physics/sitelogo/ |
| Footer |
28415 |
/physics/footer/ |
| social media |
198265 |
/physics/socialmedia/ |
| About Us |
28285 |
/physics/about.shtml |
| About the Department |
178328 |
/physics/about.shtml |
| Faculty & Staff |
28288 |
/physics/faculty.shtml |
| Loyola Physics Newsletter |
182350 |
/physics/loyolaphysicsnewsletter/ |
| Seminar Schedule |
182716 |
/physics/seminarschedule/ |
| FA24 Physics Seminar: Andrew Ducharme |
198731 |
/physics/seminarschedule/fa24physicsseminarandrewducharme/ |
| FA24 Physics Seminar: Kasia Pomian |
198732 |
/physics/seminarschedule/fa24physicsseminarkasiapomian/ |
| FA24 Physics Seminar: Akhil Premkumar |
198733 |
/physics/seminarschedule/fa24physicsseminarakhilpremkumar/ |
| FA24 Physics Seminar: Mary Wojciechowski |
199279 |
/physics/seminarschedule/fa24physicsseminarmarywojciechowski/ |
| FA24 Physics Seminar: Jax Sanders |
199402 |
/physics/seminarschedule/fa24physicsseminarjaxsanders/ |
| FA24 Physics Seminar: Meenakshi Wadhwa |
200014 |
/physics/seminarschedule/fa24physicsseminarmeenakshiwadhwa/ |
| Facilities |
28287 |
/physics/facilities.shtml |
| Cudahy Science Hall |
28286 |
/physics/cudahy_science.shtml |
| Contact Us |
28352 |
/physics/Contact_Us.shtml |
| right_column |
87240 |
/physics/rightcolumn/ |
| Academics |
28291 |
/physics/academics.shtml |
| Overview of Degree Plans |
178325 |
/physics/academics.shtml |
| BS in Physics |
28292 |
/physics/bs_physics.shtml |
| BS in Theoretical Physics/Applied Mathematics |
28294 |
/physics/bs_theoreticalphys.shtml |
| BS in Biophysics |
28351 |
/physics/bs_biophysics.shtml |
| Biophysics |
48071 |
/physics/biophysics/ |
| Contact Us |
17535 |
/physics/biophysics/contactus/ |
| right_column |
87069 |
/physics/biophysics/contactus/rightcolumn/ |
| Degree Program |
17536 |
/physics/biophysics/degreeprogram/ |
| right_column |
87070 |
/physics/biophysics/degreeprogram/rightcolumn/ |
| Sequence of Courses |
17537 |
/physics/biophysics/sequenceofcourses/ |
| right_column |
87071 |
/physics/biophysics/sequenceofcourses/rightcolumn/ |
| home_left |
87068 |
/physics/biophysics/homeleft/ |
| BS in Physics with Computer Science |
28293 |
/physics/bs_csphysics.shtml |
| Dual Degree Programs |
28299 |
/physics/dualdegree.shtml |
| Physics (BS) + Engineering (BS) |
28354 |
/physics/engineering/index.shtml |
| right_column |
87241 |
/physics/rightcolumn/ |
| Physics (BS) + Secondary Education (MEd) |
28300 |
/physics/dualdegree_education.shtml |
| Minor in Physics |
28302 |
/physics/minor_physics.shtml |
| Course Catalog |
191480 |
https://catalog.luc.edu/course-descriptions/phys/ |
| Research |
83666 |
/physics/research/ |
| Research Areas |
159359 |
/physics/research/researchareas/ |
| Faculty Publications |
128150 |
/physics/research/facultypublications/ |
| right_column |
87244 |
/physics/research/rightcolumn/ |
| Summer Research -- Related Fields |
28305 |
/physics/our_summer_related.shtml |
| Undergraduate Experiences |
159356 |
/physics/undergraduateexperiences/ |
| Being a Loyola Physics Student |
178323 |
/physics/undergraduateexperiences/ |
| Research Poster Symposium |
178061 |
/physics/undergraduateexperiences/researchpostersymposium/ |
| Department Awards |
159357 |
/physics/undergraduateexperiences/departmentawards/ |
| Research Fellowships |
127963 |
/physics/undergraduateexperiences/researchfellowships/ |
| Student Peer-Mentoring Program |
207066 |
/physics/undergraduateexperiences/studentpeer-mentoringprogram/ |
| Clubs |
28289 |
/physics/physics_club.shtml |
| Freshman Project |
28383 |
/physics/freshman_project.shtml |
| Resources |
28385 |
/physics/resources.shtml |
| Helpful Links |
178345 |
/physics/resources.shtml |
| Careers in Physics and REUs |
127361 |
/physics/careersinphysicsandreus/ |
| Physics Club Tutoring Schedule |
127489 |
/physics/physicsclubtutoringschedule/ |
| Professional Societies in Physics |
127909 |
/physics/professionalsocietiesinphysics/ |
| Pre-health Advising |
28384 |
/physics/prehealth.shtml |
| Department Academic Policies |
28381 |
/physics/regulations.shtml |
| American Association of Physics teachers |
28382 |
/physics/aapt.shtml |
| Faculty Tenure and Promotion Guidelines |
159633 |
/physics/facultytenureandpromotionguidelines/ |
| Change of Major to Physics |
178346 |
/physics/changeofmajortophysics/ |
| Admission |
28309 |
/physics/admission.shtml |
| Apply Now |
28310 |
/physics/apply.html |
| Request Information |
28311 |
/physics/requestinformation.html |
| Undergraduate Admission |
28312 |
/physics/undergrad.html |
| right_column |
87242 |
/physics/rightcolumn/ |
| modules-programming |
198203 |
/physics/modules-programming/ |
| Archives |
62735 |
/physics/archive/ |
| Past Recipients of Department Awards |
161495 |
/physics/archive/pastrecipientsofdepartmentawards/ |
| Congratulations to 2020 Graduates |
178294 |
/physics/archive/congratulationsto2020graduates/ |
| Congratulatons to 2019 Graduates |
178295 |
/physics/archive/congratulatonsto2019graduates/ |
| Gordon Ramsey VP AAPT |
178298 |
/physics/archive/gordonramseyvpaapt/ |
| Enrollment ranking |
178319 |
/physics/archive/enrollmentranking/ |
| Faculty & Staff |
28361 |
/physics/facultystaff/ |
| Jon Bougie, Ph.D. |
28358 |
/physics/faculty/bougie.shtml |
| Asim Gangopadhyaya, Ph.D. |
28364 |
/physics/faculty/gangopadhyaya.shtml |
| Aleksandr Goltsiker |
28363 |
/physics/faculty/goltsiker.shtml |
| Willetta Greene-Johnson, Ph.D. |
28377 |
/physics/faculty/greene-johnson.shtml |
| Nelda Hislop, Ph.D. |
28372 |
/physics/faculty/hislop-lawrence.shtml |
| Robert McNees, Ph.D. |
28360 |
/physics/faculty/mcnees.shtml |
| Gordon P. Ramsey, Ph.D. |
28368 |
/physics/faculty/ramsey.shtml |
| Thomas T. Ruubel, M.S. |
28376 |
/physics/faculty/ruubel.shtml |
| David B. Slavsky |
28366 |
/physics/faculty/slavsky.shtml |
| Maria Keiko Udo, Ph.D. |
28371 |
/physics/faculty/udo.shtml |
| Charles Brodbeck, Ph.D. |
28365 |
/physics/faculty/brodbeck.shtml |
| Richard R. Bukrey, Ph.D. |
28374 |
/physics/faculty/bukrey.shtml |
| Albert C. Claus, Ph.D. |
28362 |
/physics/faculty/claus.shtml |
| Jeffry V. Mallow, Ph.D. |
28369 |
/physics/faculty/mallow.shtml |
| David B. Tribble, Ph.D. |
28367 |
/physics/faculty/tribble.shtml |
| Brian L. Cannon, Ph.D. |
71739 |
/physics/facultystaff/brianlcannonphd/ |
| Lamya Saleh, Ph.D. |
83664 |
/physics/facultystaff/lamyasalehphd/ |
| Veronika Walkosz, Ph.D. |
83665 |
/physics/facultystaff/veronikawalkoszphd/ |
| Sherita Moses, Ph.D. |
99311 |
/physics/facultystaff/sheritamosesphd/ |
| Constantin N. Rasinariu, Ph.D. |
103754 |
/physics/facultystaff/constantinnrasinariuphd/ |
| David Klinger, Ph.D. |
104965 |
/physics/facultystaff/davidklingerphd/ |
| Walter Tangarife, Ph.D. |
114481 |
/physics/facultystaff/waltertangarifephd/ |
| Rasha Abbasi, Ph.D. |
124548 |
/physics/faculty/abbasi.shtml |
| Mahvand Khamesian, Ph.D. |
124549 |
/physics/faculty/khamesian.shtml |
| Tareq Abuzayyad, Ph.D. |
124795 |
/physics/faculty/Abuzayyad.shtml |
| Victor Henner, Ph.D. |
151808 |
/physics/facultystaff/victorhennerphd/ |
| Binod Rizal, Ph.D. |
163151 |
/physics/facultystaff/binodrizalphd/ |
| Izzy Moore, M.S. |
163712 |
/physics/facultystaff/izzymoorems/ |
| Ny Kieu, Ph.D. |
168078 |
/physics/facultystaff/nykieuphd/ |
| Samar Khan, M.D. |
180097 |
/physics/facultystaff/samarkhanmd/ |
| Martin Winslow, Ph.D. |
180098 |
/physics/facultystaff/martinwinslowphd/ |
| Irina Craita, Ph.D. |
182448 |
/physics/facultystaff/irinacraitaphd/ |
| Paulette Poulton, M.A.T |
182450 |
/physics/facultystaff/paulettepoultonmat/ |
| Brian Campbell-Deem, Ph.D. |
187974 |
/physics/facultystaff/briancampbell-deemphd/ |
| Sabyasachi Rath, M.S. |
187975 |
/physics/facultystaff/sabyasachirathms/ |
| Matthew C. Orvin |
190998 |
/physics/facultystaff/matthewcorvin/ |
| Joe Summers, M.S. |
199243 |
/physics/facultystaff/joesummersms/ |
| Timothy McCaskey, Ph.D. |
204089 |
/physics/facultystaff/timothymccaskeyphd/ |
| Luis Nasser |
204226 |
/physics/facultystaff/luisnasser/ |
| Mahmoud Khalili, Ph.D. |
205804 |
/physics/facultystaff/mahmoudkhaliliphd/ |
| Stories and News |
198197 |
/physics/storiesandnews/ |
| archive |
198198 |
/physics/storiesandnews/archive/ |
| American Association of Physics |
28313 |
/physics/aapt/annrep05.shtml |
| 1996 Annual Report of the Committee on International Education |
28314 |
/physics/aapt/annrep96.shtml |
| 1997 Annual Report of the Committee on International Education |
28315 |
/physics/aapt/annrep97.shtml |
| Annual Report 2005 |
28319 |
/physics/aapt/annrep05.shtml |
| LMFK Report - Iceland 2005 |
28324 |
/physics/aapt/lmfk.shtml |
| Minutes for Anchorage - Jan 2006 |
28326 |
/physics/aapt/ciemin06-01.shtml |
| Minutes for Syracuse - Jul 2006 |
28327 |
/physics/aapt/ciemin06-02.shtml |
| Minutes for the Anaheim meeting of the Committee on International Education |
28328 |
/physics/aapt/ciemin99-01.shtml |
| Minutes for the Austin meeting of the Committee on International Education |
28329 |
/physics/aapt/ciemin03-08.shtml |
| Minutes for the Boise meeting of the Committee on International Education |
28330 |
/physics/aapt/ciemin02-08.shtml |
| Minutes for the Denver meeting of the Committee on International Education |
28331 |
/physics/aapt/ciemin97-08.shtml |
| Minutes for the Kissimmee meeting of the Committee on International Education |
28332 |
/physics/aapt/ciemin00-01.shtml |
| Minutes for the Madison meeting of the Committee on International Education |
28333 |
/physics/aapt/ciemin03-01.shtml |
| Minutes for the Miami meeting of the Committee on International Education |
28334 |
/physics/aapt/ciemin04-01.shtml |
| Minutes for the New Orleans meeting of the Committee on International Education |
28335 |
/physics/aapt/ciemin98-01.shtml |
| Minutes for the Philadelphia meeting of the Committee on International Education |
28336 |
/physics/aapt/ciemin02-01.shtml |
| Minutes for the Phoenix meeting of the Committee on International Education |
28337 |
/physics/aapt/ciemin97-01.shtml |
| Minutes for the Reno meeting of the Committee on International Education |
28338 |
/physics/aapt/ciemin96-01.shtml |
| Minutes for the Rochester meeting of the Committee on International Education |
28339 |
/physics/aapt/ciemin01-07.shtml |
| Minutes for the Sacramento meeting of the Committee on International Education |
28340 |
/physics/aapt/ciemin04-08.shtml |
| Minutes for the San Antonio meeting of the Committee on International Education |
28341 |
/physics/aapt/ciemin-99-08.shtml |
| Minutes for the San Diego meeting of the Committee on International Education |
28342 |
/physics/aapt/ciemin01-01.shtml |
| Minutes From the Spokane Meeting of the Committee on International Education |
28346 |
/physics/aapt/ciemin95-08.shtml |
| Minutes of the CIE Albuquerque meeting |
28347 |
/physics/aapt/ciemin05-01.shtml |
| Minutes of the CIE Salt Lake City Meeting |
28348 |
/physics/aapt/ciemin05-08.shtml |
| American Physical society |
28350 |
/physics/American_Physical_So.shtml |
| DFPA: Dance |
59046 |
/dance/ |
| site_logo |
68251 |
/dance/sitelogo/ |
| social media |
200592 |
/dance/socialmedia/ |
| cta |
200593 |
/dance/cta/ |
| DFPA Home |
94766 |
http://www.luc.edu/dfpa/ |
| About Us |
61222 |
/dance/about/ |
| Faculty |
61739 |
/dance/about/faculty/ |
| Contact Us |
61696 |
/dance/about/contactus/ |
| FAQ |
103149 |
/dance/about/faq/ |
| Academics |
61710 |
/dance/academics/ |
| Major in Dance |
61711 |
/dance/academics/dance-major/ |
| Overview |
68404 |
/dance/academics/dance-major/ |
| Curriculum |
68402 |
/dance/academics/dance-major/curriculum/ |
| Admission |
68403 |
/dance/academics/dance-major/admission/ |
| Tuition |
68405 |
/dance/academics/dance-major/tuition/ |
| Minor in Dance |
61712 |
/dance/academics/minor/ |
| Curriculum |
110322 |
/dance/academics/minor/curriculum/ |
| Teaching Artist Minor |
200707 |
/dfpa/teachingartistminor/ |
| Advising |
61722 |
/dance/academics/advising/ |
| Minor in Musical Theatre |
200598 |
/dance/academics/minorinmusicaltheatre/ |
| Courses |
103088 |
/dance/academics/courses/ |
| DANC 394: Internship in Dance |
61727 |
/dance/academics/courses/dance-394-internship/ |
| Dance Course Rotation |
72476 |
/dance/academics/courses/dancecourserotation/ |
| Dance Course Catalog |
30113 |
/dance/academics/courses/dancecoursecatalog/ |
| Admissions |
61728 |
/dance/admissions/ |
| Financial Aid and Scholarships |
61732 |
/dance/admissions/financialaidandscholarships/ |
| Placement for Non-Majors |
61718 |
/dance/admissions/placement-non-majors/ |
| Auditions |
70267 |
/dance/admissions/auditions/ |
| Dance Major FAQ |
87405 |
/dance/admissions/auditions/dancemajorfaq/ |
| Incoming Students |
121618 |
/dance/admissions/incomingstudents/ |
| Opportunities |
61729 |
/dance/resources/ |
| Performance Opportunities |
61730 |
/dance/resources/performanceopportunities/ |
| Student Dance Organizations |
61748 |
/dance/resources/studentdanceorganizations/ |
| Careers in Dance |
79390 |
/dance/resources/careersindance/ |
| Chicago as an Extended Classroom |
110467 |
/dance/resources/chicagoasanextendedclassroom/ |
| Loyola Dance Honor Society |
110486 |
/dance/resources/loyoladancehonorsociety/ |
| Past Productions |
122161 |
/dance/pastproductions/ |
| News and Stories |
59055 |
/dance/newsandstories/ |
| archive |
59056 |
/dance/newsandstories/archive/ |
| Faculty Spotlight - Sandra Kaufmann |
200570 |
/dance/newsandstories/facultyspotlight-sandrakaufmann/ |
| Academics - Dance Minor |
200582 |
/dance/newsandstories/academics-danceminor/ |
| Videos |
82307 |
/dance/videos/ |
| Photos |
90314 |
/dance/photos/ |
| archive |
90315 |
/dance/photos/archive/ |
| Footer |
98909 |
/dance/footer/ |
| modules-programming |
200561 |
/dance/modules-programming/ |
| right_column |
68421 |
/dance/rightcolumn/ |
| DFPA: Fine Arts |
57300 |
/finearts/ |
| site_logo |
57328 |
/finearts/sitelogo/ |
| Footer |
57327 |
/finearts/footer/ |
| cta |
200680 |
/finearts/cta/ |
| social media |
200681 |
/finearts/socialmedia/ |
| modules-programming |
200664 |
/finearts/modules-programming/ |
| DFPA Home |
94765 |
http://www.luc.edu/dfpa/ |
| About Us |
57326 |
/finearts/aboutus/ |
| Faculty |
57557 |
/finearts/aboutus/faculty/ |
| FAQ |
57399 |
/finearts/aboutus/faq/ |
| Contact Us |
57340 |
/finearts/aboutus/contactus/ |
| Academics |
57416 |
/finearts/academics/ |
| Major in Art History |
57314 |
/finearts/academics/majorinarthistory/ |
| Curriculum |
68539 |
/finearts/academics/majorinarthistory/curriculum/ |
| Admission |
68541 |
/finearts/academics/majorinarthistory/admission/ |
| Tuition |
68542 |
/finearts/academics/majorinarthistory/tuition/ |
| Suggested Course Sequence |
86483 |
/finearts/academics/majorinarthistory/suggestedcoursesequence/ |
| Careers in Art History |
104670 |
/finearts/academics/majorinarthistory/careersinarthistory/ |
| Major in Sculpture and Ceramics |
57313 |
/finearts/academics/majorinsculptureandceramics/ |
| Curriculum |
68544 |
/finearts/academics/majorinsculptureandceramics/curriculum/ |
| Admission |
68545 |
/finearts/academics/majorinsculptureandceramics/admission/ |
| Tuition |
68546 |
/finearts/academics/majorinsculptureandceramics/tuition/ |
| Suggested Course Sequence |
86493 |
/finearts/academics/majorinsculptureandceramics/suggestedcoursesequence/ |
| Major in Studio Arts |
57312 |
/finearts/academics/majorinstudioarts/ |
| Curriculum |
68549 |
/finearts/academics/majorindrawingpaintingandprintmaking/curriculum/ |
| Admission |
68550 |
/finearts/academics/majorindrawingpaintingandprintmaking/admission/ |
| Tuition |
68551 |
/finearts/academics/majorindrawingpaintingandprintmaking/tuition/ |
| Suggested Course Sequence |
86487 |
/finearts/academics/majorindrawingpaintingandprintmaking/suggestedcoursesequence/ |
| Major in Photography |
57310 |
/finearts/academics/majorinphotography/ |
| Curriculum |
68553 |
/finearts/academics/majorinphotography/curriculum/ |
| Admission |
68554 |
/finearts/academics/majorinphotography/admission/ |
| Tuition |
68555 |
/finearts/academics/majorinphotography/tuition/ |
| Suggested Course Sequence |
93082 |
/finearts/academics/majorinphotography/suggestedcoursesequence/ |
| Major in Visual Communication |
57308 |
/finearts/academics/majorinvisualcommunication/ |
| Curriculum |
68557 |
/finearts/academics/majorinvisualcommunication/curriculum/ |
| Admission |
68558 |
/finearts/academics/majorinvisualcommunication/admission/ |
| Tuition |
68559 |
/finearts/academics/majorinvisualcommunication/tuition/ |
| Suggested Course Sequence |
86529 |
/finearts/academics/majorinvisualcommunication/suggestedcoursesequence/ |
| Careers in Visual Communication |
108918 |
/finearts/academics/majorinvisualcommunication/careersinvisualcommunication/ |
| Teaching Artist Minor |
200706 |
/dfpa/teachingartistminor/ |
| Minor in Art History |
57421 |
/finearts/academics/minorinarthistory/ |
| Minor in Sculpture and Ceramics |
57418 |
/finearts/academics/minorinsculptureandceramics/ |
| Minor in Drawing, Painting and Printmaking |
57420 |
/finearts/academics/minorindrawingpaintingandprintmaking/ |
| Minor in Photography |
57417 |
/finearts/academics/minorinphotography/ |
| Minor in Visual Communication |
57422 |
/finearts/academics/minorinvisualcommunication/ |
| Minor in Studio Art |
64182 |
/finearts/academics/minorinstudioart/ |
| Internships |
57304 |
/finearts/academics/internships/ |
| FNAR 368: Gallery Internship |
57424 |
/finearts/academics/internships/fnar368galleryinternship/ |
| FNAR 380: Visual Communication Internship |
57423 |
/finearts/academics/internships/fnar380visualcommunicationinternship/ |
| Advising |
69596 |
/finearts/academics/advising/ |
| Courses |
57306 |
/finearts/academics/courses/ |
| Fine Arts Course Rotation |
72478 |
/finearts/academics/courses/fineartscourserotation/ |
| Fine Arts Course Catalog |
103098 |
/finearts/academics/courses/fineartscoursecatalog/ |
| Admissions |
57426 |
/finearts/admissions/ |
| Financial Aid and Scholarships |
57430 |
/finearts/admissions/financialaidandscholarships/ |
| Tuition |
57429 |
/finearts/admissions/tuition/ |
| Financial Aid |
57428 |
/finearts/admissions/financialaid/ |
| Undergraduate Admissions |
57427 |
/finearts/admissions/undergraduateadmissions/ |
| Portfolio Day |
163693 |
/finearts/admissions/portfolioday/ |
| Incoming Students |
122371 |
/finearts/admissions/incomingstudents/ |
| Opportunities |
156053 |
/finearts/opportunities/ |
| Exhibition Opportunities |
57437 |
/finearts/opportunities/exhibitionopportunities/ |
| AIGA Student Chapter |
156055 |
/finearts/opportunities/aigastudentchapter/ |
| Resources |
57435 |
/finearts/resources/ |
| Art Stores |
57440 |
/finearts/resources/artstores/ |
| Art Support |
86997 |
/finearts/resources/artsupport/ |
| Photography Lab |
76080 |
/finearts/resources/photographylab/ |
| Required Supplies and Equipment |
95873 |
/finearts/resources/requiredsuppliesandequipment/ |
| Vis Com Requirements |
95948 |
/finearts/resources/requiredsuppliesandequipment/viscomrequirements/ |
| Frequently Asked Questions |
96059 |
/finearts/resources/requiredsuppliesandequipment/viscomrequirements/frequentlyaskedquestions/ |
| Camera Requirements |
96170 |
/finearts/resources/requiredsuppliesandequipment/camerarequirements/ |
| Career Resources |
106239 |
/finearts/resources/careerresources/ |
| News and Stories |
82309 |
/finearts/stories/ |
| Videos |
82310 |
/finearts/videos/ |
| Exhibitions |
103128 |
/finearts/exhibitions/ |
| DFPA: Music |
57965 |
/music/ |
| site_logo |
200607 |
/music/sitelogo/ |
| social media |
200608 |
/music/socialmedia/ |
| cta |
200609 |
/music/cta/ |
| DFPA Home |
94763 |
http://www.luc.edu/dfpa/ |
| About Us |
58090 |
/music/about/ |
| Contact Us |
58092 |
/music/about/contact/ |
| Faculty |
61245 |
/music/about/faculty/ |
| FAQ |
58095 |
/music/about/faq/ |
| Academics |
58109 |
/music/academics/ |
| Major in Music |
58110 |
/music/academics/majorinmusic/ |
| Curriculum |
68776 |
/music/academics/majorinmusic/curriculum/ |
| Admission |
68777 |
/music/academics/majorinmusic/admission/ |
| Tuition |
68778 |
/music/academics/majorinmusic/tuition/ |
| Minor in Music |
58111 |
/music/academics/minor/ |
| Jazz Studies Concentration |
58112 |
/music/academics/jazzstudiesconcentration/ |
| Vocal Performance Concentration |
103115 |
/music/academics/vocalperformanceconcentration/ |
| Liturgical Music Concentration |
58113 |
/music/academics/liturgicalmusicconcentration/ |
| Teaching Artist Minor |
200708 |
/dfpa/teachingartistminor/ |
| Minor in Musical Theatre |
200628 |
/music/academics/minorinmusicaltheatre/ |
| Ensembles |
58093 |
/music/academics/ensembles/ |
| Choral Ensembles |
188353 |
/music/academics/ensembles/choralensembles/ |
| Instrumental Ensembles |
188354 |
/music/academics/ensembles/instrumentalensembles/ |
| Chamber Choir |
70565 |
/music/academics/ensembles/chamberchoir/ |
| Chamber Ensemble |
58107 |
/music/academics/ensembles/chamberensemble/ |
| Jazz Combo |
86207 |
/music/academics/ensembles/jazzcombo/ |
| Jazz Ensemble |
58100 |
/music/academics/ensembles/jazz-ensemble/ |
| Symphony Orchestra |
58105 |
/music/academics/ensembles/symphonyorchestra/ |
| Percussion Ensemble |
85699 |
/music/academics/ensembles/percussionensemble/ |
| Liturgical Choir |
70566 |
/music/academics/ensembles/liturgicalchoir/ |
| University Chorale |
70564 |
/music/academics/ensembles/universitychorale/ |
| University Singers |
70563 |
/music/academics/ensembles/universitysingers/ |
| Women's Chamber |
160725 |
/music/academics/ensembles/womenschamber/ |
| Wind Ensemble |
58106 |
/music/academics/ensembles/windensemble/ |
| Ensemble Directors |
70750 |
/music/academics/ensembles/ensembledirectors/ |
| Ensemble FAQ |
70402 |
/music/academics/ensembles/ensemblefaq/ |
| Applied Lessons |
70271 |
/music/academics/appliedlessons/ |
| Applied Lessons Instruments |
71032 |
/music/academics/appliedlessons/appliedlessonsinstruments/ |
| Advising |
69597 |
/music/academics/advising/ |
| Courses |
61233 |
/music/academics/courses/ |
| Music Course Rotation |
72434 |
/music/academics/courses/musiccourserotation/ |
| Summer Courses |
76468 |
/music/academics/courses/summercourses/ |
| Admissions |
61237 |
/music/admissions/ |
| Financial Aid and Scholarships |
61241 |
/music/admissions/scholarships/ |
| Tuition |
61240 |
/music/admissions/tuition/ |
| Financial Aid |
61239 |
/music/admissions/financial-aid/ |
| Undergraduate Admission |
61238 |
/music/admissions/undergrad/ |
| Auditions |
70268 |
/music/admissions/auditions/ |
| Applied Auditions |
70406 |
/music/admissions/auditions/appliedauditions/ |
| Ensemble Auditions |
70407 |
/music/admissions/auditions/ensembleauditions/ |
| Wind Ensemble Auditions |
70746 |
/music/admissions/auditions/ensembleauditions/windensembleauditions/ |
| Symphony Orchestra Auditions |
70747 |
/music/admissions/auditions/ensembleauditions/symphonyorchestraauditions/ |
| Jazz Ensemble Auditions |
70748 |
/music/admissions/auditions/ensembleauditions/jazzensembleauditions/ |
| Chorus Auditions |
70749 |
/music/admissions/auditions/ensembleauditions/chorusauditions/ |
| Jazz Combo Auditions |
205333 |
/music/admissions/auditions/ensembleauditions/jazzcomboauditions/ |
| Major Auditions |
87445 |
/music/admissions/auditions/majorauditions/ |
| Concerto/Aria Competition |
124301 |
/music/admissions/auditions/concertoariacompetition/ |
| Incoming Students |
122367 |
/music/admissions/incomingstudents/ |
| Resources |
111045 |
/music/resources/ |
| Instrument Rental and Storage |
61262 |
/music/resources/instrumentrentalandstorage/ |
| Student Resources |
103114 |
/music/resources/studentresources/ |
| Faculty Resources |
111046 |
/music/resources/facultyresources/ |
| Practice Room Access |
114371 |
/music/resources/practiceroomaccess/ |
| Opportunities |
61251 |
/music/opportunities/ |
| Student Organizations |
88156 |
/music/opportunities/studentorganizations/ |
| News and Stories |
82314 |
/music/newsandstories/ |
| archive |
82315 |
/music/newsandstories/archive/ |
| Photos |
90316 |
/music/photos/ |
| Videos |
82316 |
/music/videos/ |
| modules-programming |
200619 |
/music/modules-programming/ |
| right_column |
68927 |
/music/rightcolumn/ |
| Footer |
94227 |
/music/footer/ |
| DFPA: Theatre |
59057 |
/theatre/ |
| DFPA Home |
94764 |
http://www.luc.edu/dfpa/ |
| Footer |
98911 |
/theatre/footer/ |
| About Us |
61221 |
/theatre/aboutus/ |
| Contact Us |
61582 |
/theatre/aboutus/contactus/ |
| Faculty and Production Staff |
61622 |
/theatre/aboutus/facultyandproductionstaff/ |
| Profiles |
202950 |
/theatre/aboutus/facultyandproductionstaff/profiles/ |
| FAQ |
61589 |
/theatre/aboutus/faq/ |
| Equity, Diversity, and Inclusion |
126681 |
/theatre/aboutus/equitydiversityandinclusion/ |
| Transparency |
149913 |
/theatre/aboutus/transparency/ |
| Loyola Theatre Anti-Racism Action Plan |
151829 |
/theatre/aboutus/transparency/loyolatheatreanti-racismactionplan/ |
| Open Governance |
151820 |
/theatre/aboutus/transparency/opengovernance/ |
| Season Selection Process |
151821 |
/theatre/aboutus/transparency/seasonselectionprocess/ |
| Academics |
61594 |
/theatre/academics/ |
| Major in Theatre |
61602 |
/theatre/academics/majorintheatre/ |
| Curriculum |
68829 |
/theatre/academics/majorintheatre/curriculum/ |
| Admission |
68830 |
/theatre/academics/majorintheatre/admission/ |
| Tuition |
68831 |
/theatre/academics/majorintheatre/tuition/ |
| Minor in Theatre |
61685 |
/theatre/academics/minorintheatre/ |
| Minor in Shakespeare Studies |
67941 |
/shakespeare/ |
| Curriculum |
67943 |
/shakespeare/curriculum/ |
| Participating Departments and Faculty |
67945 |
/shakespeare/participatingdepartmentsandfaculty/ |
| Elementary Education MEd: Theatre Concentration |
190734 |
/theatre/academics/elementaryeducationmedtheatreconcentration/ |
| Minor in Musical Theater |
200710 |
/music/academics/minorinmusicaltheatre/ |
| New Design Curriculum |
99129 |
/theatre/academics/newdesigncurriculum/ |
| Courses |
61605 |
/theatre/academics/courses/ |
| Course Rotation |
61610 |
/theatre/academics/courses/courserotation/ |
| Summer Courses |
76469 |
/theatre/academics/courses/summercourses/ |
| Theatre Course Catalog |
200421 |
https://catalog.luc.edu/undergraduate/arts-sciences/fine-performing-arts/#coursestext |
| Advising |
69598 |
/theatre/academics/advising/ |
| Theatre Library |
178468 |
/theatre/academics/theatrelibrary/ |
| Admissions |
61596 |
/theatre/admissions/ |
| Financial Aid & Scholarships |
61619 |
/theatre/admissions/financialaidscholarships/ |
| J. Pat Miller Scholarship Recipients |
69084 |
/theatre/admissions/financialaidscholarships/jpatmillerscholarshiprecipients/ |
| Theatre Major Auditions |
82643 |
/theatre/admissions/theatremajorauditions/ |
| Scholarship Auditions |
87444 |
/theatre/admissions/theatremajorauditions/scholarshipauditions/ |
| Incoming Students |
121551 |
/theatre/admissions/incomingstudents/ |
| Opportunities |
61598 |
/theatre/opportunities/ |
| Production Auditions |
94834 |
/theatre/opportunities/productionauditions/ |
| Student Production Opportunities |
72964 |
/theatre/opportunities/studentproductionopportunities/ |
| Production Policies |
61625 |
/theatre/opportunities/studentproductionopportunities/productionpolicies/ |
| Health and Safety |
61668 |
/theatre/opportunities/studentproductionopportunities/productionpolicies/healthandsafety/ |
| Lockers and Space Reservations |
61669 |
/theatre/opportunities/studentproductionopportunities/productionpolicies/lockersandspacereservations/ |
| Second Stage Lab |
118535 |
/theatre/opportunities/studentproductionopportunities/secondstagelab/ |
| Project Models |
118553 |
/theatre/opportunities/studentproductionopportunities/secondstagelab/projectmodels/ |
| Production Staff Job Descriptions |
61630 |
/theatre/opportunities/productionstaffjobdescriptions/ |
| Student Employment |
177938 |
/theatre/opportunities/studentemployment/ |
| Student Job Descriptions |
177939 |
/theatre/opportunities/studentemployment/studentjobdescriptions/ |
| Production Models |
87864 |
/theatre/opportunities/productionmodels/ |
| Theatre & Social Justice Working Group |
161232 |
/theatre/opportunities/theatresocialjusticeworkinggroup/ |
| The Loyola Theatre Diversity, Equity, and Inclusion (DEI) Committee |
161272 |
/theatre/opportunities/theloyolatheatrediversityequityandinclusiondeicommittee/ |
| Internships |
61615 |
/theatre/opportunities/internships/ |
| site_logo |
68986 |
/theatre/sitelogo/ |
| News and Events |
82320 |
/theatre/stories/ |
| archive |
82321 |
/theatre/stories/archive/ |
| Alumni Feature: John Drea |
204646 |
/theatre/stories/alumnifeaturejohndrea/ |
| Photos |
91292 |
/theatre/photos/ |
| Musical Theatre |
30096 |
/dfpa/a_mthe_main.shtml |
| Musical Theatre Courses for Dance Major |
30150 |
/dfpa/musicaltheatrecoursesfordancemajor/ |
| Contact Us |
30151 |
/dfpa/musical_theatre_contact.shtml |
| Musical Theatre - FAQ |
30373 |
/dfpa/musicaltheatre-faq/ |
| Musical Theatre Courses for Music Major |
71180 |
/dfpa/musicaltheatrecoursesformusicmajor/ |
| Musical Theatre Courses for Theatre Major |
71182 |
/dfpa/musicaltheatrecoursesfortheatremajor/ |
| Productions |
163530 |
/theatre/productions/ |
| Main Stage Season |
163528 |
/theatre/productions/mainstageseason/ |
| Second Stage Laboratory Projects |
163536 |
/theatre/productions/secondstagelaboratoryprojects/ |
| Dramaturgy |
188344 |
/theatre/productions/dramaturgy/ |
| Season Discussion Guides |
163529 |
/theatre/productions/seasondiscussionguides/ |
| Past Productions |
122152 |
/theatre/productions/pastproductions/ |
| Directories |
15259 |
/directories/ |
| Diversity, Equity, and Inclusion (OIDEI) |
188169 |
/diversityandinclusion/ |
| About Us |
188213 |
/diversityandinclusion/aboutus/ |
| Mission, Vision, and READI Framework |
188181 |
/diversityandinclusion/aboutus/missionvisionandreadiframework/ |
| Meet Our Team |
188216 |
/diversityandinclusion/aboutus/meetourteam/ |
| Profiles |
189785 |
/diversityandinclusion/aboutus/meetourteam/profiles/ |
| right_column |
205591 |
/diversityandinclusion/aboutus/meetourteam/profiles/rightcolumn/ |
| Strategic Plan and Priorities |
188217 |
/diversityandinclusion/aboutus/strategicplanandpriorities/ |
| READI Newsletters |
188218 |
/diversityandinclusion/aboutus/readinewsletters/ |
| READI Newsletters Archive |
197515 |
/diversityandinclusion/aboutus/readinewsletters/readinewslettersarchive/ |
| Holidays and Heritage Days |
198246 |
/diversityandinclusion/aboutus/readinewsletters/holidaysandheritagedays/ |
| Contact Us |
188219 |
/diversityandinclusion/aboutus/contactus/ |
| Engage |
188214 |
/diversityandinclusion/engage/ |
| READI Professional Development Series |
188237 |
/diversityandinclusion/engage/readiprofessionaldevelopmentseries/ |
| Affinity Groups |
188221 |
/diversityandinclusion/engage/affinitygroups/ |
| Events and Experiences |
188222 |
/diversityandinclusion/engage/eventsandexperiences/ |
| DEI Kickoff Events Archive |
190471 |
/diversityandinclusion/engage/eventsandexperiences/deikickoffeventsarchive/ |
| DEI Winter Summit Events Archive |
190472 |
/diversityandinclusion/engage/eventsandexperiences/deiwintersummiteventsarchive/ |
| Year-End Celebration Events Archive |
190473 |
/diversityandinclusion/engage/eventsandexperiences/year-endcelebrationeventsarchive/ |
| Mission in Action |
188174 |
/diversityandinclusion/missioninaction/ |
| On Campus |
188177 |
/diversityandinclusion/missioninaction/oncampus/ |
| Resources Cards |
188240 |
/diversityandinclusion/missioninaction/oncampus/resourcescards/ |
| In the Classroom |
188175 |
/diversityandinclusion/missioninaction/intheclassroom/ |
| Resources Cards |
188242 |
/diversityandinclusion/missioninaction/intheclassroom/resourcescards/ |
| In the Community |
188176 |
/diversityandinclusion/missioninaction/inthecommunity/ |
| Resources Cards |
188243 |
/diversityandinclusion/missioninaction/inthecommunity/resourcescards/ |
| Policies and Statements |
188223 |
/diversityandinclusion/missioninaction/policiesandstatements/ |
| READI Innovation Fund |
188224 |
/diversityandinclusion/missioninaction/readiinnovationfund/ |
| READI Impact Awards |
191287 |
/diversityandinclusion/missioninaction/readiimpactawards/ |
| Resources |
188206 |
/diversityandinclusion/resources/ |
| Reports |
188215 |
/diversityandinclusion/reports/ |
| Roundtable Report |
188228 |
/diversityandinclusion/reports/roundtablereport/ |
| modules-programming |
188208 |
/diversityandinclusion/modules-programming/ |
| site_logo |
188170 |
/diversityandinclusion/sitelogo/ |
| CTA |
188172 |
/diversityandinclusion/cta/ |
| social media |
188173 |
/diversityandinclusion/socialmedia/ |
| Footer |
188171 |
/diversityandinclusion/footer/ |
| Division of Student Development |
194810 |
/studentdevelopment/ |
| site_logo |
194814 |
/studentdevelopment/sitelogo/ |
| footer |
194816 |
/studentdevelopment/footer/ |
| modules-programming |
194815 |
/studentdevelopment/modules-programming/ |
| cta |
195898 |
/studentdevelopment/cta/ |
| I Links |
195101 |
/studentdevelopment/ilinks/ |
| social media |
195102 |
/studentdevelopment/socialmedia/ |
| About |
194840 |
/studentdevelopment/about/ |
| Welcome from VP Champagne |
194855 |
/studentdevelopment/about/welcomefromvpchampagne/ |
| Mission, Vision, Pledge |
194856 |
/studentdevelopment/about/mission/ |
| Jesuit Values |
198252 |
/studentdevelopment/about/jesuitvalues/ |
| Diversity Statement |
194857 |
/studentdevelopment/about/diversitystatement/ |
| Assessment |
194858 |
/studentdevelopment/about/assessment/ |
| Assessment Cycle |
194862 |
/studentdevelopment/about/assessment/cycle/ |
| Assessment Planning |
194864 |
/studentdevelopment/about/assessment/assessmentplanning/ |
| Guidelines |
194865 |
/studentdevelopment/about/assessment/guidelines/ |
| Resources |
194866 |
/studentdevelopment/about/assessment/resources/ |
| Glossary |
194867 |
/studentdevelopment/about/assessment/glossary/ |
| DSD Annual Reports |
201940 |
/studentdevelopment/about/assessment/dsdannualreports/ |
| Divisional Learning Outcomes |
194868 |
/studentdevelopment/about/divisionallearningoutcomes/ |
| Jesuit Student Affairs |
194869 |
/studentdevelopment/about/jesuitstudentaffairs/ |
| Student Development Fee |
194870 |
/studentdevelopment/about/studentdevelopmentfee/ |
| DSD Org Chart |
194871 |
/studentdevelopment/about/dsdorgchart/ |
| Senior Leadership Team |
194872 |
/studentdevelopment/about/seniorleadershipteam/ |
| Profiles |
195542 |
/studentdevelopment/about/seniorleadershipteam/profiles/ |
| News |
194839 |
/studentdevelopment/about/news/ |
| archive |
194838 |
/studentdevelopment/about/news/archive/ |
| Stories |
194873 |
/studentdevelopment/about/stories/ |
| Martin Luther King Jr. Day 2024: "I Have a Dream" Imagining Session |
194939 |
/studentdevelopment/about/stories/martinlutherkingjrday2024ihaveadreamimaginingsession/ |
| Black History Month Events, 2024 |
194940 |
/studentdevelopment/about/stories/blackhistorymonthevents2024/ |
| MLK Day of Service |
200910 |
/studentdevelopment/about/stories/mlkdayofservice/ |
| MLK Day of Service |
200910 |
/studentdevelopment/about/stories/mlkdayofservice/ |
| DSD Signature Commencement Celebrations |
194942 |
/studentdevelopment/about/stories/dsdsignaturecommencementcelebrations/ |
| Loyola Celebrates Latine Heritage Month |
198455 |
/studentdevelopment/about/stories/loyolacelebrateslatineheritagemonth/ |
| WTC Block Party: A Loyola Tradition |
198734 |
/studentdevelopment/about/stories/wtcblockpartyaloyolatradition/ |
| Empowering Sisterhood in Action |
199866 |
/studentdevelopment/about/stories/empoweringsisterhoodinaction/ |
| Message about the Center for Student Inclusion and Belonging |
202665 |
/studentdevelopment/about/stories/messageaboutthecenterforstudentinclusionandbelonging/ |
| Harold Ellis Clark 2025 |
204092 |
/studentdevelopment/about/stories/haroldellisclark2025/ |
| Loyola University Chicago to Partner with Encanto Arts |
204093 |
/studentdevelopment/about/stories/loyolauniversitychicagotopartnerwithencantoarts/ |
| Meet Sullivan, Loyola’s New Therapy Dog |
204094 |
/studentdevelopment/about/stories/meetsullivanloyolasnewtherapydog/ |
| Update on the Center for Student Inclusion and Belonging |
204351 |
/studentdevelopment/about/stories/updateonthecenterforstudentinclusionandbelonging/ |
| Power of Storytelling |
205033 |
/studentdevelopment/about/stories/powerofstorytelling/ |
| Support and Utilize Campus Food Pantries |
205040 |
/studentdevelopment/about/stories/supportandutilizecampusfoodpantries/ |
| Lincoln Laureate 2025 |
205199 |
/studentdevelopment/about/stories/lincolnlaureate2025/ |
| RBP AmFam Partnership |
205210 |
/studentdevelopment/about/stories/rbpamfampartnership/ |
| Discover Campus Recreation at Loyola |
206775 |
/studentdevelopment/about/stories/discovercampusrecreationatloyola/ |
| Find Your Community at the CSIB |
206899 |
/studentdevelopment/about/stories/findyourcommunityatthecsib/ |
| Get Involved through the Center for Student Engagement |
206989 |
/studentdevelopment/about/stories/getinvolvedthroughthecenterforstudentengagement/ |
| Rambler Brotherhood Project Attends Student Leadership Conference |
207236 |
/studentdevelopment/about/stories/ramblerbrotherhoodprojectattendsstudentleadershipconference/ |
| DSD Communications |
195106 |
/studentdevelopment/about/dsdcommunications/ |
| Student Response Team |
195108 |
/studentdevelopment/about/studentresponseteam/ |
| Signature Events |
198891 |
/studentdevelopment/about/signatureevents/ |
| Opportunities |
194960 |
/studentdevelopment/opportunities/ |
| Excellence Awards |
194961 |
/studentdevelopment/opportunities/excellenceawards/ |
| Nomination Criteria |
194968 |
/studentdevelopment/opportunities/excellenceawards/nominationcriteria/ |
| Award Recipients |
194969 |
/studentdevelopment/opportunities/excellenceawards/awardrecipients/ |
| Damen Awards |
194970 |
/studentdevelopment/opportunities/excellenceawards/awardrecipients/damenawards/ |
| right_column |
194971 |
/studentdevelopment/opportunities/excellenceawards/awardrecipients/damenawards/rightcolumn/ |
| 1870 Awards |
194972 |
/studentdevelopment/opportunities/excellenceawards/awardrecipients/1870awards/ |
| right_column |
194973 |
/studentdevelopment/opportunities/excellenceawards/awardrecipients/1870awards/rightcolumn/ |
| Unity of Heart & Mind Awards |
194974 |
/studentdevelopment/opportunities/excellenceawards/awardrecipients/unityofheartmindawards/ |
| right_column |
194975 |
/studentdevelopment/opportunities/excellenceawards/awardrecipients/unityofheartmindawards/rightcolumn/ |
| Student Employment Awards |
194980 |
/studentdevelopment/opportunities/excellenceawards/awardrecipients/studentemploymentawards/ |
| right_column |
194981 |
/studentdevelopment/opportunities/excellenceawards/awardrecipients/studentemploymentawards/rightcolumn/ |
| Residence Life Awards |
194982 |
/studentdevelopment/opportunities/excellenceawards/awardrecipients/residencelifeawards/ |
| right_column |
194983 |
/studentdevelopment/opportunities/excellenceawards/awardrecipients/residencelifeawards/rightcolumn/ |
| Graduate, Professional, & Adult Student Awards |
194984 |
/studentdevelopment/opportunities/excellenceawards/awardrecipients/graduateprofessionaladultstudentawards/ |
| right_column |
194985 |
/studentdevelopment/opportunities/excellenceawards/awardrecipients/graduateprofessionaladultstudentawards/rightcolumn/ |
| Arrupe College Awards |
194987 |
/studentdevelopment/opportunities/excellenceawards/awardrecipients/arrupecollegeawards/ |
| Spirit of Laudato Si' Sustainability Awards |
194988 |
/studentdevelopment/opportunities/excellenceawards/awardrecipients/spiritoflaudatosisustainabilityawards/ |
| Student-Athlete Awards |
194989 |
/studentdevelopment/opportunities/excellenceawards/awardrecipients/student-athleteawards/ |
| Diversity Awards |
194990 |
/studentdevelopment/opportunities/excellenceawards/awardrecipients/diversityawards/ |
| Student Veteran of the Year |
194991 |
/studentdevelopment/opportunities/excellenceawards/awardrecipients/studentveteranoftheyear/ |
| The Student Promise Award |
202594 |
/studentdevelopment/opportunities/excellenceawards/awardrecipients/thestudentpromiseaward/ |
| Timeline & Important Dates |
194992 |
/studentdevelopment/opportunities/excellenceawards/timelineimportantdates/ |
| Student Employment |
195022 |
/studentdevelopment/opportunities/studentemployment/ |
| Maroon & Gold Society |
195025 |
/studentdevelopment/opportunities/maroongoldsociety/ |
| Previous Members |
195026 |
/studentdevelopment/opportunities/maroongoldsociety/previousmembers/ |
| VP's Student Advisory Council |
195033 |
/studentdevelopment/opportunities/vpsstudentadvisorycouncil/ |
| Halloween Events |
195028 |
/studentdevelopment/opportunities/halloweenevents/ |
| Rambler Brotherhood Project |
195035 |
/studentdevelopment/opportunities/ramblerbrotherhoodproject/ |
| Engage with Empathy |
197886 |
/studentdevelopment/opportunities/engagewithempathy/ |
| Jesuit Jam |
205835 |
/studentdevelopment/opportunities/jesuitjam/ |
| For DSD Staff |
195072 |
/studentdevelopment/fordsdstaff/ |
| Leadership Institute |
195074 |
/studentdevelopment/fordsdstaff/leadershipinstitute/ |
| DSD DEIA Committee |
195075 |
/studentdevelopment/fordsdstaff/dsddeiacommittee/ |
| Professional Development |
195076 |
/studentdevelopment/fordsdstaff/professionaldevelopment/ |
| Rambler Families |
195065 |
/studentdevelopment/ramblerfamilies/ |
| Recorded Information Sessions |
195071 |
/studentdevelopment/ramblerfamilies/recordedinformationsessions/ |
| Parent and Family Advisory Council |
195066 |
/studentdevelopment/ramblerfamilies/parentandfamilyadvisorycouncil/ |
| Newsletters |
195067 |
/studentdevelopment/ramblerfamilies/newsletters/ |
| Important Dates |
195068 |
/studentdevelopment/ramblerfamilies/importantdates/ |
| Contact Information |
195069 |
/studentdevelopment/ramblerfamilies/contactinformation/ |
| FAQs |
195070 |
/studentdevelopment/ramblerfamilies/faqs/ |
| DEIB Resources |
201065 |
/studentdevelopment/deibresources/ |
| DSD Communications |
201938 |
/studentdevelopment/dsdcommunications/ |
| The Kettle Newsletter |
201939 |
/studentdevelopment/dsdcommunications/thekettlenewsletter/ |
| GIVE |
195113 |
/studentdevelopment/give/ |
| Documents |
204012 |
/studentdevelopment/documents/ |
| Resources |
206437 |
/studentdevelopment/resources/ |
| Guidance for Non-LUC Law Enforcement on Campus |
206438 |
/studentdevelopment/resources/guidancefornon-luclawenforcementoncampus/ |
| Dual Credit Program |
66434 |
/dualcredit/ |
| site_logo |
66548 |
/dualcredit/sitelogo/ |
| Footer |
66553 |
/dualcredit/footer/ |
| right_column |
66368 |
/dualcredit/rightcolumn/ |
| About |
198921 |
/dualcredit/about/ |
| Benefits |
198922 |
/dualcredit/about/benefits/ |
| Application |
198923 |
/dualcredit/about/application/ |
| Key Dates |
203057 |
/dualcredit/keydates/ |
| Students |
198927 |
/dualcredit/students/ |
| Information for Applicants |
203061 |
/dualcredit/students/informationforapplicants/ |
| Information for Admitted Students |
203062 |
/dualcredit/students/informationforadmittedstudents/ |
| Parents |
66367 |
/dualcredit/parents/ |
| FERPA |
68908 |
/dualcredit/informationforparents/ferpa/ |
| High Schools |
66360 |
/dualcredit/highschools/ |
| Grading |
66583 |
/dualcredit/informationforhighschools/grading/ |
| Key Dates |
125677 |
/dualcredit/keydates/ |
| Dual Credit Classes |
198928 |
/dualcredit/students/dualcreditclasses/ |
| Emergency Communications |
184720 |
/emergencycommunications/ |
| site_logo |
184723 |
/emergencycommunications/sitelogo/ |
| Footer |
184724 |
/emergencycommunications/footer/ |
| Emergency Communications Update |
185472 |
/emergencycommunications/emergencycommunicationsupdate/ |
| right_column |
185473 |
/emergencycommunications/emergencycommunicationsupdate/rightcolumn/ |
| Loyola Alert FAQs |
184731 |
/emergencycommunications/loyolaalertfaqs/ |
| right_column |
184732 |
/emergencycommunications/loyolaalertfaqs/rightcolumn/ |
| Loyola Advisory FAQs |
185358 |
/emergencycommunications/loyolaadvisoryfaqs/ |
| right_column |
185359 |
/emergencycommunications/loyolaadvisoryfaqs/rightcolumn/ |
| Emergency Medical Services Program |
15592 |
/ems/ |
| About Us |
15584 |
/ems/about.shtml |
| Contact Us |
15581 |
/ems/contact_us.shtml |
| Meet Our Staff |
15582 |
/ems/staff.shtml |
| Mission Statement |
15583 |
/ems/mission.html |
| Submit Requests |
15598 |
/ems/submitrequests.shtml |
| Request Loyola EMS at your Event |
15599 |
/ems/emsatyourevent.shtml |
| right_column |
55928 |
/ems/rightcolumn/ |
| Certification |
15587 |
/ems/certification.shtml |
| CPR Certification Course |
15588 |
/ems/CPR.shtml |
| EMT-B Certification Course |
15589 |
/ems/course.shtml |
| Responder Program |
15591 |
/ems/responder_program.shtml |
| right_column |
55932 |
/ems/rightcolumn/ |
| Photo Gallery |
15585 |
/ems/photos.shtml |
| Resources |
15596 |
/ems/resources.shtml |
| Become an Illinois Responder |
15594 |
/ems/become_an_ilresponder.shtml |
| What to do in case of an emergency |
15595 |
/ems/incaseofemergency.shtml |
| Useful Links |
15597 |
/ems/links.shtml |
| right_column |
55933 |
/ems/rightcolumn/ |
| Footer |
15687 |
/ems/footer/ |
| site_logo |
15684 |
/ems/sitelogo/ |
| Empowering Leaders |
191061 |
/empoweringleaders/ |
| site_logo |
191080 |
/empoweringleaders/sitelogo/ |
| Stories & News |
193942 |
/empoweringleaders/storiesnews/ |
| archive |
193943 |
/empoweringleaders/storiesnews/archive/ |
| Story - Hero - The Pursuit of Purpose |
191066 |
/empoweringleaders/story-hero-thepursuitofpurpose/ |
| Story - Quinlan - NIL Expertise |
202044 |
/empoweringleaders/story-quinlan-nilexpertise/ |
| Story - Experiential Learning in Rural Italy |
202045 |
/empoweringleaders/story-experientiallearninginruralitaly/ |
| Story - Ricci Scholars Program |
202043 |
/empoweringleaders/story-riccischolarsprogram/ |
| Story - SES - Accessible Science |
191076 |
/empoweringleaders/story-ses-accessiblescience/ |
| Story - Quinlan - Ethics In the Wild |
191077 |
/empoweringleaders/story-quinlan-ethicsinthewild/ |
| Story - Parkinson - Forged in Crisis |
191078 |
/empoweringleaders/story-parkinson-forgedincrisis/ |
| Story - SES - Team Typha |
192294 |
/empoweringleaders/story-ses-teamtypha/ |
| Story - Quinlan - From Chicago to Southeast Asia |
192299 |
/empoweringleaders/story-quinlan-fromchicagotosoutheastasia/ |
| Story - Parkinson - Long-term study on African diaspora |
192305 |
/empoweringleaders/story-parkinson-long-termstudyonafricandiaspora/ |
| Story - Quinlan - Federal grant supports minority-owned businesses |
194817 |
/empoweringleaders/story-quinlan-federalgrantsupportsminority-ownedbusinesses/ |
| Story - Parkinson - Transforming veteran health care |
194833 |
/empoweringleaders/story-parkinson-transformingveteranhealthcare/ |
| Story - SES - Trash Talk |
195725 |
/empoweringleaders/story-ses-trashtalk/ |
| Story - CAS - Science and Religion |
200871 |
/empoweringleaders/story-cas-scienceandreligion/ |
| Story - SES - Food Fighters |
200872 |
/empoweringleaders/story-ses-foodfighters/ |
| Story - Stritch - AI and Cell Migration |
200873 |
/empoweringleaders/story-stritch-aiandcellmigration/ |
| Story - Quinlan - Innovative AI Curriculum |
204634 |
/empoweringleaders-dev/story-higheredai/ |
| Story - Parkinson - GLP-1 Research Benefits Society |
204635 |
/empoweringleaders-dev/story-glpandaddiction/ |
| Story - Quinlan - Rooted in sustainability |
204636 |
/empoweringleaders-dev/story-sustainability/ |
| Story - Nursing - Better Patient Care |
206098 |
/empoweringleaders/story-patientcare/ |
| Story - Sustainability - Green, Clean Power |
206099 |
/empoweringleaders/story-greencleanpower/ |
| Story - Social Work - Mental health on campus |
206100 |
/empoweringleaders/story-campusmentalhealth/ |
| Story - SES - LUREC Immersive Learning |
206693 |
/empoweringleaders/story-ses-lurecimmersivelearning/ |
| Story - Social Work - Simulating opportunities for care |
206694 |
/empoweringleaders/story-socialwork-simulatingopportunitiesforcare/ |
| Story - Nursing - Stay SAFE Research |
206711 |
/empoweringleaders/story-nursing-staysaferesearch/ |
| empowering-leaders-flight-04-dev |
205910 |
/empoweringleaders/empowering-leaders-flight-03-dev/ |
| Story - Nursing - Better Patient Care |
205852 |
/empoweringleaders/empowering-leaders-flight-02-dev/story-patientcare/ |
| Story - Sustainability - Green, Clean Power |
205853 |
/empoweringleaders/story-greencleanpower/ |
| Story - Social Work - Mental health on campus |
205854 |
/empoweringleaders/story-campusmentalhealth/ |
| site_logo |
205926 |
/empoweringleaders/empowering-leaders-flight-02-dev/sitelogo/ |
| Engineering |
69028 |
/engineering/ |
| site_logo |
69169 |
/engineering/sitelogo/ |
| cta |
199396 |
/engineering/cta/ |
| social media |
199399 |
/engineering/socialmedia/ |
| About Us |
71592 |
/engineering/aboutus/ |
| Overview |
89775 |
/engineering/overview/ |
| right_column |
199343 |
/engineering/overview/rightcolumn/ |
| Our Faculty |
85323 |
/engineering/aboutus/ourfaculty/ |
| Profiles |
202480 |
/engineering/aboutus/ourfaculty/aggregateprofilepage/profiles/ |
| Our Staff |
71600 |
/engineering/aboutus/ourstaff/ |
| Profiles |
202482 |
/engineering/aboutus/ourstaff/aggregateprofilepage/profiles/ |
| Our Students |
87963 |
/engineering/aboutus/ourstudents/ |
| Our Facilities |
98018 |
/engineering/aboutus/ourfacilities/ |
| Our Alumni |
124251 |
/engineering/aboutus/ouralumni/ |
| Scholarships |
179665 |
/engineering/aboutus/scholarships/ |
| Industrial Advisory Board |
69092 |
/engineering/industrialadvisoryboard/ |
| TESTING - Miscellaneous Content Types |
199657 |
/engineering/aboutus/testing-miscellaneouscontenttypes/ |
| Profiles |
207568 |
/engineering/aboutus/testing-miscellaneouscontenttypes/profiles/ |
| Faculty Gallery |
199991 |
/engineering/aboutus/facultygallery/ |
| Student Photo Gallery |
200100 |
/engineering/aboutus/studentphotogallery/ |
| Curriculum |
69087 |
/engineering/curriculum/ |
| Capstone Design Projects |
121249 |
/engineering/curriculum/capstonedesignprojects/ |
| Course Descriptions |
81743 |
/engineering/curriculum/coursedescriptions/ |
| Social Justice Focus |
109591 |
/engineering/curriculum/socialjusticefocus/ |
| Specializations |
69091 |
/engineering/curriculum/specializations/ |
| Biomedical Engineering |
103721 |
/engineering/curriculum/specializations/biomedicalengineering/ |
| Computer Engineering |
103722 |
/engineering/curriculum/specializations/computerengineering/ |
| Environmental Engineering |
103723 |
/engineering/curriculum/specializations/environmentalengineering/ |
| Student Engagement |
86262 |
/engineering/curriculum/studentengagement/ |
| Student Projects |
107399 |
/engineering/curriculum/studentprojects/ |
| Study Abroad |
121248 |
/engineering/curriculum/studyabroad/ |
| Engineering and Honors |
97712 |
/engineering/curriculum/engineeringandhonors/ |
| Engineering and Pre-Med |
92242 |
/engineering/curriculum/engineeringandpre-med/ |
| Program Details |
69090 |
/engineering/programdetails/ |
| Academic Regulations |
121588 |
/engineering/programdetails/academicregulations/ |
| Academic Misconduct |
203487 |
/engineering/programdetails/academicmisconduct/ |
| Program Educational Objectives |
81767 |
/engineering/programdetails/programeducationalobjectives/ |
| Student Outcomes |
81768 |
/engineering/programdetails/studentoutcomes/ |
| Transfer Students |
100595 |
/engineering/transferstudents/ |
| ABET Accreditation |
114486 |
/engineering/programdetails/abetaccreditation/ |
| FAQS |
89709 |
/engineering/faqs/ |
| Welcome |
71593 |
/engineering/welcome/ |
| Stories |
78003 |
/engineering/stories/ |
| archive |
109269 |
/engineering/ |
| Engineering 101 |
78324 |
/engineering/stories/engineering101/ |
| Biomedical Engineering Students |
120476 |
/engineering/stories/biomedicalengineeringstudents/ |
| Flex Lab Engineering on Display |
120479 |
/engineering/stories/flexlabengineeringondisplay/ |
| Industry Experience and Why It Matters |
167833 |
/engineering/stories/industryexperienceandwhyitmatters/ |
| Pacemaker Project |
78325 |
/engineering/stories/pacemakerproject/ |
| Environmental Engineering Capstone Team Wins State Design Competition |
168080 |
/engineering/stories/environmentalengineeringcapstoneteamwinsstatedesigncompetition/ |
| Alumnus Spotlight: Jack Brouillette |
168585 |
/engineering/stories/alumnusspotlightjackbrouillette/ |
| Research Spotlight: Dr. Muna Aryal |
168635 |
/engineering/stories/researchspotlightdrmunaaryal/ |
| Research Spotlight: Dr. Vincent Chen |
168411 |
/engineering/stories/researchspotlightdrvincentchen/ |
| Biomedical Engineering Team wins NIH DEBUT Challenge $15,000 HIV/AIDS Prize |
198632 |
/engineering/stories/biomedicalengineeringteamwinsnihdebutchallenge15000hivaidsprize/ |
| modules-programming |
199326 |
/engineering/modules-programming/ |
| Photo Galleries |
201721 |
/engineering/photogalleries/ |
| English Language Learning Program |
12891 |
/esl/index.shtml |
| About Us |
12892 |
/esl/about.shtml |
| Mission and Goals |
12898 |
/esl/purposes_and_goals.shtml |
| Contact Us |
12896 |
/esl/contactus.shtml |
| Visit Us |
116371 |
/esl/visitus/ |
| Callback Request |
12893 |
/esl/callback_request.shtml |
| Map and Chicago |
12897 |
/esl/chicago.shtml |
| Programs and Services |
12899 |
/esl/academics.shtml |
| Intensive English Program (IEP) |
12907 |
/esl/course_descriptions.shtml |
| Loyola Global Bridge Pathways |
67638 |
/esl/loyolaglobalbridgepathways/ |
| Customized Programs |
67645 |
/esl/loyolaglobalbridgepathways/customizedprograms/ |
| right_column |
117748 |
/esl/loyolaglobalbridgepathways/customizedprograms/rightcolumn/ |
| Conditional Admission |
12908 |
/esl/conditional_admissio.shtml |
| right_column |
68324 |
/esl/rightcolumn/ |
| Ask a Question |
12905 |
/esl/ask_a_question.shtml |
| Resources for Prospective Students |
12918 |
/esl/resourcesforprospectivestudents/ |
| Student Perspectives |
206346 |
/esl/resourcesforprospectivestudents/studentperspectives/ |
| Student Success Stories |
206349 |
/esl/resourcesforprospectivestudents/studentperspectives/studentsuccessstories/ |
| Language Is No Barrier |
206351 |
/esl/resourcesforprospectivestudents/studentperspectives/studentsuccessstories/languageisnobarrier/ |
| profiles |
206347 |
/esl/resourcesforprospectivestudents/studentperspectives/profiles/ |
| Immigration and Visa Info |
12943 |
/esl/visa_info.shtml |
| Applying for Visa |
12937 |
/esl/applying_for_visa.html |
| Changing Status |
12938 |
/esl/changing_status.html |
| F-1 Students |
12939 |
/esl/f1_students.html |
| FAQ |
12940 |
/esl/visa_faqs.html |
| J-1 Students |
12941 |
/esl/j1_students.html |
| Resources |
12942 |
/esl/visa_resources.html |
| Loyola Global Bridge Pathways |
206299 |
/esl/loyolaglobalbridgepathways/ |
| Calendar |
12906 |
/esl/ |
| Application Procedure |
12903 |
/esl/application_procedur.shtml |
| right_column |
206343 |
/esl/rightcolumn/ |
| Resources for Current Students |
67681 |
/esl/resourcesforcurrentstudents/ |
| Recommended Reading List |
67712 |
/esl/resourcesforcurrentstudents/recommendedreadinglist/ |
| Writing Center Support |
67703 |
/esl/resourcesforcurrentstudents/writingcentersupport/ |
| ELLP Websites |
67702 |
/esl/resourcesforcurrentstudents/ellpwebsites/ |
| Beyond the Classroom |
67683 |
/esl/beyondtheclassroom/ |
| Global Mentorship Program |
67704 |
/esl/beyondtheclassroom/globalmentorshipprogram/ |
| Thank You |
66478 |
/esl/supportforloyoladepartments/conversationpartnerprogram/thankyou/ |
| Service Learning |
67682 |
/esl/beyondtheclassroom/servicelearning/ |
| Footer |
13182 |
/esl/footer/ |
| site_logo |
13184 |
/esl/sitelogo/ |
| social media |
202240 |
/esl/socialmedia/ |
| cta |
202241 |
/esl/cta/ |
| modules-programming |
202242 |
/esl/modules-programming/ |
| English Tutoring at the Literacy Center |
15268 |
/literacy/ |
| site_logo |
15290 |
/literacy/site_logo/ |
| Footer |
15291 |
/literacy/footer/ |
| modules-programming |
202080 |
/literacy/modules-programming/ |
| About Us |
15269 |
/literacy/aboutus/ |
| Contact Us |
15270 |
/literacy/aboutus/contactus/ |
| Hours of Operation |
202098 |
/literacy/aboutus/contactus/ |
| Meet Our Staff |
15271 |
/literacy/aboutus/meetourstaff/ |
| Mission and History |
15272 |
/literacy/aboutus/missionandhistory/ |
| News and Announcements |
202095 |
/literacy/aboutus/newsandannouncements/ |
| Frequently Asked Questions |
15276 |
/literacy/frequentlyaskedquestions/ |
| Learner's FAQs |
15277 |
/literacy/frequentlyaskedquestions/learnersfaqs/ |
| Tutor's FAQs |
15278 |
/literacy/frequentlyaskedquestions/tutorsfaqs/ |
| Orientation for New Tutors |
15280 |
/literacy/orientationfornewtutors/ |
| Tutoring |
15287 |
/literacy/tutoring/ |
| Basic Grammar Terms |
15273 |
/literacy/tutoring/basicgrammarterms/ |
| Common Writing Problems & How to Fix Them |
15282 |
/literacy/tutoring/commonwritingproblemshowtofixthem/ |
| Course Credit Tutoring |
15283 |
/literacy/tutoring/coursecredittutoring/ |
| Course Syllabus |
15284 |
/literacy/tutoring/coursesyllabus/ |
| The Literacy Center Founder |
15289 |
/literacy/theliteracycenterfounder/ |
| Information for Adult Learners |
202093 |
/literacy/informationforadultlearners/ |
| Information for Tutors |
202094 |
/literacy/informationfortutors/ |
| English, Department of |
19695 |
/english/index.shtml |
| About |
19772 |
/english/about.shtml |
| Department Profile |
19822 |
/english/dept_profile.shtml |
| News |
52664 |
/english/stories/ |
| archive |
52665 |
/english/stories/archive/ |
| People |
125824 |
/english/people/ |
| Faculty |
128462 |
/english/people/faculty/ |
| Part-time Faculty |
180777 |
/english/people/faculty/part-timefaculty/ |
| Profiles |
198910 |
/english/people/faculty/profiles/ |
| right_column |
203336 |
/english/people/faculty/profiles/rightcolumn/ |
| Graduate Students |
116667 |
/english/people/graduatestudents/ |
| Profiles |
199104 |
/english/people/graduatestudents/profiles/ |
| English Department Librarian |
125825 |
/english/people/englishdepartmentlibrarian/ |
| Statement on Critical Race Theory |
180253 |
/english/statementoncriticalracetheory/ |
| Faculty Awards |
127349 |
/english/facultyawards/ |
| Events |
117839 |
/english/events/ |
| The Edward L. Surtz, S.J. Lecture in the Humanities |
117840 |
/english/events/theedwardlsurtzsjlectureinthehumanities/ |
| Edward L. Surtz |
127169 |
/english/surtz.shtml |
| The McElroy Shakespeare Celebration |
79845 |
/english/events/themcelroyshakespearecelebration/ |
| The Martin J. Svaglic Symposium |
125667 |
/english/events/themartinjsvaglicsymposium/ |
| Affiliated Programs |
116225 |
/english/affiliatedprograms/ |
| Center for Textual Studies and Digital Humanities |
198809 |
/ctsdh/ |
| Medieval Studies |
198810 |
/medieval/index.shtml |
| Shakespeare Studies |
198811 |
/theatre/ |
| Women's Studies and Gender Studies |
198812 |
/wsgs/index.shtml |
| The Writing Program |
198813 |
/writingprogram/ |
| Writing Center |
198814 |
/writing/index.shtml |
| Contact Us |
127196 |
/english/contactus/ |
| Department Newsletter |
159286 |
https://acrobat.adobe.com/link/review?uri=urn:aaid:scds:US:2c81d1b7-bc74-3689-b00b-d1b8a353d8cc |
| Archive of Past Newsletters |
183549 |
/english/archiveofpastnewsletters/ |
| Undergraduate |
125760 |
/english/undergraduate/ |
| Hear from our Graduates |
167143 |
/english/undergraduate/hearfromourgraduates/ |
| Programs |
19760 |
/english/undergraduate.shtml |
| Teaching Licensure |
194052 |
https://catalog.luc.edu/undergraduate/arts-sciences/english/english-babsed/ |
| Creative Writing Concentration |
194051 |
https://catalog.luc.edu/undergraduate/arts-sciences/english/creative-writing-concentration/ |
| The English Honors Program |
127126 |
/english/theenglishhonorsprogram/ |
| The Writing Program |
154040 |
/writingprogram/ |
| English Catalog |
192173 |
https://catalog.luc.edu/undergraduate/arts-sciences/english/ |
| BA/MA Program |
194053 |
https://catalog.luc.edu/undergraduate/accelerated-bachelors-masters-program/english-ba-ma/ |
| Guide to the English Major |
180249 |
/english/undergraduate/guidetotheenglishmajor/ |
| Resources |
125829 |
/english/undergraduate/resources/ |
| Scholarships, Awards, and Prizes |
125830 |
/english/undergraduate/scholarshipsawardsandprizes/ |
| Newberry Library Seminar |
125762 |
/english/undergraduate/newberrylibraryseminar/ |
| Apply Now! |
198815 |
http://www.luc.edu/undergrad |
| Why Choose Loyola English? |
201436 |
/english/undergraduate/whychooseloyolaenglish/ |
| Fall 2026 Courses |
202257 |
/english/undergraduate/fall2026courses/ |
| Course Catalog |
198817 |
https://catalog.luc.edu/undergraduate/arts-sciences/english/ |
| Graduate |
125761 |
/english/graduate/ |
| MA Program |
198816 |
https://gpem.luc.edu/portal/program?name=englishma |
| Fall 2026 Graduate Courses |
202246 |
/english/graduate/fall2026graduatecourses/ |
| MA Alumni Placements |
197637 |
/english/graduate/maalumniplacements/ |
| PhD Program |
127155 |
/english/graduate/phdprogram/ |
| Alumni Placements |
127156 |
/english/graduate/phdprogram/alumniplacements/ |
| PhD Alumni Testimonials |
127575 |
/english/graduate/phdprogram/phdalumnitestimonials/ |
| How to Apply |
127347 |
/english/graduate/phdprogram/howtoapply/ |
| Faculty |
200711 |
https://www.luc.edu/english/people/faculty/ |
| Medieval and Renaissance Literature |
206895 |
/english/graduate/phdprogram/medievalandrenaissanceliterature/ |
| Nineteenth-Century Studies |
206896 |
/english/graduate/phdprogram/nineteenth-centurystudies/ |
| Modern Literature and Culture |
206897 |
/english/graduate/phdprogram/modernliteratureandculture/ |
| Textual Studies and Digital Humanities |
206898 |
/english/graduate/phdprogram/textualstudiesanddigitalhumanities/ |
| Resources and Policies |
127165 |
/english/graduate/resourcesandpolicies/ |
| English Graduate Student Association |
116652 |
/english/graduate/resourcesandpolicies/englishgraduatestudentassociation/ |
| Research and Writing |
116644 |
/english/graduate/resourcesandpolicies/researchandwriting/ |
| Conference Presentations |
116643 |
/english/graduate/resourcesandpolicies/conferencepresentations/ |
| Revision and Publication |
116647 |
/english/graduate/resourcesandpolicies/revisionandpublication/ |
| Graduate Student Assistantships |
116663 |
/english/graduate/resourcesandpolicies/graduatestudentassistantships/ |
| Teaching Assistantship Guidelines |
19826 |
/english/graduate_TAGuideline.shtml |
| Graduate Student Teaching |
116660 |
/english/graduate/resourcesandpolicies/graduatestudentteaching/ |
| Student Activities |
116648 |
/english/graduate/resourcesandpolicies/studentactivities/ |
| Internships and Community Outreach |
116646 |
/english/graduate/resourcesandpolicies/internshipsandcommunityoutreach/ |
| Health and Wellness |
116645 |
/english/graduate/resourcesandpolicies/healthandwellness/ |
| The Academic Job Search |
116653 |
/english/graduate/resourcesandpolicies/theacademicjobsearch/ |
| Professionalism |
116928 |
/english/graduate/resourcesandpolicies/professionalism/ |
| Links & Forms |
19732 |
/english/links.shtml |
| Departmental Awards |
127354 |
/english/graduate/departmentalawards/ |
| Stanley A. Clayes Essay Prize |
127166 |
/english/clayes.shtml |
| Graduate Program Outcomes |
127356 |
/english/graduate/graduateprogramoutcomes/ |
| right_column |
87306 |
/english/graduate/rightcolumn/ |
| Course Catalog |
198818 |
https://catalog.luc.edu/graduate-professional/graduate-school/arts-sciences/english/ |
| Creative Writing |
127693 |
/english/creativewriting/ |
| About |
128842 |
/english/creativewriting/about/ |
| Course Schedules |
198819 |
https://catalog.luc.edu/undergraduate/arts-sciences/english/creative-writing-concentration/ |
| Writing Program |
166553 |
https://www.luc.edu/writingprogram/ |
| Faculty Resources |
19703 |
/english/resources.shtml |
| Faculty Forms |
116659 |
/english/facultyforms/ |
| Convention Travel Request Form |
19737 |
/english/travel_request.shtml |
| Thank You |
116274 |
/english/thankyou/ |
| Faculty Development |
116658 |
/english/facultydevelopment/ |
| Department Guidelines for Promotion and Tenure |
19734 |
/english/tenure.shtml |
| Department Bylaws |
19735 |
/english/bylaws.shtml |
| Recent Awards |
36115 |
/english/facultydevelopment/recentawards/ |
| Department Policies |
129543 |
/english/departmentpolicies/ |
| Request Information Links |
62259 |
/english/requestinformationlinks/ |
| Apply Now Links |
62302 |
/english/applynowlinks/ |
| UCLR 100-E Guidelines |
154448 |
/english/uclr100-eguidelines/ |
| site_logo |
198801 |
/english/sitelogo/ |
| Footer |
198802 |
/english/footer/ |
| cta |
198803 |
/english/cta/ |
| I Links |
198804 |
/english/ilinks/ |
| social media |
198805 |
/english/socialmedia/ |
| Enrollment Marketing Communication |
192491 |
/enrollmentmarketingcommunication/ |
| site_logo |
192492 |
/enrollmentmarketingcommunication/sitelogo/ |
| Footer |
192493 |
/enrollmentmarketingcommunication/footer/ |
| Messaging Briefs |
197601 |
/enrollmentmarketingcommunication/messagingbriefs/ |
| Assets |
192497 |
/enrollmentmarketingcommunication/assets/ |
| Contact |
192498 |
/enrollmentmarketingcommunication/contact/ |
| Publications |
204956 |
/enrollmentmarketingcommunication/publications/ |
| Environment Landing Page |
183818 |
/environment/ |
| footer |
183820 |
/environment/footer/ |
| custom_css |
183821 |
/environment/customcss/ |
| Environmental Services |
27966 |
/environmentalservices/index.shtml |
| site_logo |
28000 |
/environmentalservices/sitelogo/ |
| Footer |
27999 |
/environmentalservices/footer/ |
| About Us |
27967 |
/environmentalservices/about.shtml |
| Occupational Health and Safety |
27973 |
/environmentalservices/occupational_health_and_safety.shtml |
| Asbestos |
194056 |
/environmentalservices/occupationalhealthandsafety/asbestos/ |
| Automated External Defibrillator (AED) |
201558 |
/environmentalservices/occupationalhealthandsafety/automatedexternaldefibrillatoraed/ |
| Bloodborne Pathogens |
27982 |
/environmentalservices/occupationalhealthandsafety/bloodborne_pathogens.shtml |
| Confined Space |
194057 |
/environmentalservices/occupationalhealthandsafety/confinedspace/ |
| Eyewash and Safety Shower |
194058 |
/environmentalservices/occupationalhealthandsafety/eyewashandsafetyshower/ |
| Fire Safety |
27984 |
/environmentalservices/occupationalhealthandsafety/fire_safety.shtml |
| Hazard Communication |
27985 |
/environmentalservices/occupationalhealthandsafety/hazmat.shtml |
| Hot Work |
201407 |
/environmentalservices/occupationalhealthandsafety/hotwork/ |
| Ladder Safety |
27983 |
/environmentalservices/occupationalhealthandsafety/ladder_safety.shtml |
| Lead-Based Paint |
27986 |
/environmentalservices/occupationalhealthandsafety/lab_office_safety.shtml |
| Lockout Tagout |
27987 |
/environmentalservices/occupationalhealthandsafety/lockout_tagout.shtml |
| Mold |
27988 |
/environmentalservices/occupationalhealthandsafety/mold.shtml |
| Office Ergonomics |
27989 |
/environmentalservices/occupationalhealthandsafety/office_ergonomics.shtml |
| Personal Protective Equipment (PPE) |
27990 |
/environmentalservices/occupationalhealthandsafety/ppe.shtml |
| Respiratory Protection |
27991 |
/environmentalservices/occupationalhealthandsafety/respiratory_equipment.shtml |
| Safe Lifting Techniques |
27992 |
/environmentalservices/occupationalhealthandsafety/safe_lifting_techniques.shtml |
| Slips, Trips, and Falls |
194059 |
/environmentalservices/occupationalhealthandsafety/slipstripsandfalls/ |
| Weather Facts |
194060 |
/environmentalservices/occupationalhealthandsafety/weatherfacts/ |
| Training |
27975 |
/environmentalservices/training.shtml |
| Registration Confirmation |
194525 |
/environmentalservices/training/registrationconfirmation/ |
| ERP |
30890 |
/erp/ |
| General Information |
30892 |
/erp/about.shtml |
| Purpose |
55615 |
/erp/generalinformation/purpose/ |
| Policy |
55616 |
/erp/about_erpolicy.html |
| Organization |
55617 |
/erp/generalinformation/organization/ |
| Concept of Operations |
55618 |
/erp/generalinformation/conceptofoperations/ |
| Media Relations |
55620 |
/erp/generalinformation/mediarelations/ |
| Priority Objectives |
30897 |
/erp/about_erppriorityobj.shtml |
| Recovery and Planning |
55621 |
/erp/generalinformation/recoveryandplanning/ |
| Responsibility and Control |
30898 |
/erp/about_erpresponsibility.shtml |
| Contact Information |
30893 |
/erp/contactinfo.shtml |
| Procedures |
30901 |
/erp/campuses.shtml |
| Lakeside Campuses |
55785 |
/erp/about.shtml |
| Rome Center |
30904 |
/erp/romectr_emergencies.shtml |
| Situation Information |
30928 |
/erp/esi.shtml |
| Avian Flu Outbreak |
30911 |
/erp/avianflu.html |
| Influenza H1N1 Update (Swine Flu) |
30921 |
/erp/swineflu.html |
| Novel H1N1 Influenza FAQs |
30925 |
/erp/h1n1_faqs.shtml |
| Resources |
30909 |
/erp/resources.shtml |
| Emergency Notification |
30906 |
/erp/emergency_notification.shtml |
| Emergency Operations Plan |
67955 |
/erp/emergencyoperationsplan/ |
| News and Updates |
69568 |
/erp/newsandupdates/ |
| Influenza H1N1 (Swine Flu) |
31241 |
/erp/h1n1-082009.shtml |
| site_logo |
30942 |
/erp/sitelogo/ |
| social media |
201846 |
/erp/socialmedia/ |
| right_column |
30895 |
/erp/rightcolumn/ |
| Footer |
30941 |
/erp/footer/ |
| Error |
17697 |
/error/ |
| File Not Found |
17694 |
/error/notfound.shtml |
| 404 - File Not Found |
17695 |
/error/404.shtml |
| Server Error |
17696 |
/error/intserverr.shtml |
| File Not Viewable |
17693 |
/error/forbidden.shtml |
| Footer |
17702 |
/error/footer/ |
| ESRR |
61526 |
/esrr/index.shtml |
| site_logo |
69102 |
/esrr/sitelogo/ |
| modules-programming |
200639 |
/esrr/modules-programming/ |
| Footer |
61312 |
/esrr/footer/ |
| About Us |
61547 |
/esrr/aboutus/ |
| Directory |
205216 |
/esrr/aboutus/directory/ |
| News & Stories |
205217 |
/esrr/aboutus/newsstories/ |
| Research and Analytics |
66131 |
/esrr/researchandanalytics/ |
| Enrollment Systems |
66598 |
/esrr/enrollmentsystems/ |
| Funnel Reports |
205288 |
/esrr/funnelreports/ |
| Steppingblocks |
205185 |
/esrr/steppingblocks/ |
| Gray DI |
205193 |
/esrr/graydi/ |
| European Studies Minor |
84434 |
/europeanstudies/ |
| Overview of the Minor |
86830 |
/europeanstudies/overviewoftheminor/ |
| Faculty |
89073 |
/europeanstudies/overviewoftheminor/faculty/ |
| Academics |
192005 |
/europeanstudies/academics/ |
| Declaring a Minor |
192006 |
/europeanstudies/academics/declaringaminor/ |
| Double-Dipping |
192007 |
/europeanstudies/academics/double-dipping/ |
| Searching for Classes |
192008 |
/europeanstudies/academics/searchingforclasses/ |
| Resources |
86832 |
/europeanstudies/resources/ |
| Executive and Professional Education Center |
118764 |
/executiveeducation/ |
| About |
118938 |
/executiveeducation/about/ |
| Directions and Accommodations |
182671 |
/executiveeducation/about/directionsandaccommodations/ |
| Financing Options |
118945 |
/executiveeducation/about/financingoptions/ |
| Request Information |
118940 |
/executiveeducation/about/requestinformation.shtml |
| Board of Advisors |
206885 |
/executiveeducation/about/boardofadvisors/ |
| For Individuals |
118946 |
/executiveeducation/forindividuals/ |
| archive |
167360 |
/executiveeducation/forindividuals/archive/ |
| Business Leadership Essentials |
118952 |
/executiveeducation/forindividuals/businessleadershipessentials/ |
| Project Management |
118949 |
/executiveeducation/forindividuals/projectmanagement/ |
| Curriculum |
118950 |
/executiveeducation/forindividuals/projectmanagement/curriculum/ |
| Testimonial Video: Project Management |
122255 |
/executiveeducation/forindividuals/projectmanagement/testimonialvideoprojectmanagement/ |
| Lean Six Sigma Green Belt |
118964 |
/executiveeducation/forindividuals/leansixsigmagreenbelt/ |
| Lean Six Sigma Black Belt |
197912 |
/executiveeducation/forindividuals/leansixsigmablackbelt/ |
| Lean and Artificial Intelligence |
206888 |
/executiveeducation/forindividuals/leanandartificialintelligence/ |
| Feedback and Coaching for Performance Management |
204231 |
/executiveeducation/forindividuals/feedbackandcoachingforperformancemanagement/ |
| Change Management |
204189 |
/executiveeducation/forindividuals/changemanagement/ |
| AI Made Simple |
185638 |
/executiveeducation/forindividuals/aimadesimple/ |
| Beyond Government Grants |
203894 |
/executiveeducation/forindividuals/beyondgovernmentgrants/ |
| Impact Storytelling for Data Leaders |
188349 |
/executiveeducation/forindividuals/impactstorytellingfordataleaders/ |
| Pharmacovigilance: A Practical Approach |
156404 |
/executiveeducation/forindividuals/pharmacovigilanceapracticalapproach/ |
| For Groups |
119479 |
/executiveeducation/forgroups/ |
| right_column |
126205 |
/executiveeducation/forgroups/rightcolumn/ |
| International Partnerships |
119480 |
/executiveeducation/internationalpartnerships/ |
| Events |
119481 |
/executiveeducation/events/ |
| right_column |
119083 |
/executiveeducation/events/rightcolumn/ |
| Past events |
123420 |
/executiveeducation/events/pastevents/ |
| archive |
123421 |
/executiveeducation/events/pastevents/archive/ |
| Women's Leadership Forum 2022 |
177008 |
/executiveeducation/events/womensleadershipforum2022/ |
| Videos and Presentations |
177009 |
/executiveeducation/events/womensleadershipforum2022/videosandpresentations/ |
| Registration Form |
119002 |
/executiveeducation/registration.shtml |
| Thank You |
119005 |
/executiveeducation/thankyou/ |
| site_logo |
119652 |
/executiveeducation/sitelogo/ |
| Footer |
119654 |
/executiveeducation/footer/ |
| modules-programming |
197216 |
/executiveeducation/modules-programming/ |
| cta |
197488 |
/executiveeducation/cta/ |
| Landing Pages |
120196 |
/executiveeducation/landingpages/ |
| Sample Landing Page |
124306 |
/executiveeducation/landingpages/samplelandingpage/ |
| right_column |
197585 |
/executiveeducation/landingpages/samplelandingpage/rightcolumn/ |
| General |
127525 |
/executiveeducation/landingpages/general/ |
| right_column |
197586 |
/executiveeducation/landingpages/general/rightcolumn/ |
| Cultivating Your Leadership Style and Presence |
120203 |
/executiveeducation/landingpages/cultivatingyourleadershipstyleandpresence/ |
| right_column |
197587 |
/executiveeducation/landingpages/cultivatingyourleadershipstyleandpresence/rightcolumn/ |
| Mini-MBA |
120204 |
/executiveeducation/landingpages/mini-mba/ |
| Project Management |
120205 |
/executiveeducation/landingpages/projectmanagement/ |
| Practical Finance and Accounting for Family Business |
120206 |
/executiveeducation/landingpages/practicalfinanceandaccountingforfamilybusiness/ |
| right_column |
197590 |
/executiveeducation/landingpages/practicalfinanceandaccountingforfamilybusiness/rightcolumn/ |
| Strategic Business Communications |
120207 |
/executiveeducation/landingpages/strategicbusinesscommunications/ |
| right_column |
197591 |
/executiveeducation/landingpages/strategicbusinesscommunications/rightcolumn/ |
| Leadership Innovation in the Workforce |
120208 |
/executiveeducation/landingpages/leadershipinnovationintheworkforce/ |
| right_column |
197592 |
/executiveeducation/landingpages/leadershipinnovationintheworkforce/rightcolumn/ |
| Global Immersion |
120209 |
/executiveeducation/landingpages/globalimmersion/ |
| right_column |
197593 |
/executiveeducation/landingpages/globalimmersion/rightcolumn/ |
| Lean Training |
120210 |
/executiveeducation/landingpages/leantraining/ |
| right_column |
197594 |
/executiveeducation/landingpages/leantraining/rightcolumn/ |
| Six Sigma |
120211 |
/executiveeducation/landingpages/sixsigma/ |
| right_column |
197595 |
/executiveeducation/landingpages/sixsigma/rightcolumn/ |
| Technology Workshop Series |
126624 |
/executiveeducation/landingpages/technologyworkshopseries/ |
| right_column |
197596 |
/executiveeducation/landingpages/technologyworkshopseries/rightcolumn/ |
| Supply Chain and Sustainability |
149846 |
/executiveeducation/landingpages/supplychainandsustainability/ |
| right_column |
197597 |
/executiveeducation/landingpages/supplychainandsustainability/rightcolumn/ |
| Values-Based Leadership |
149856 |
/executiveeducation/landingpages/values-basedleadership/ |
| right_column |
197598 |
/executiveeducation/landingpages/values-basedleadership/rightcolumn/ |
| Announcing the Executive and Professional Education Center |
120302 |
/executiveeducation/announcingtheexecutiveandprofessionaleducationcenter/ |
| Supply Chain Strategy |
120395 |
/executiveeducation/supplychainstrategy/ |
| Videos |
126208 |
/executiveeducation/videos/ |
| Box Studios |
147334 |
/executiveeducation/videos/boxstudios/ |
| Bios |
126464 |
/executiveeducation/bios/ |
| Dwetri Addy |
158873 |
/executiveeducation/bios/dwetriaddy/ |
| Tina Agustiady |
142506 |
/executiveeducation/bios/tinaagustiady/ |
| Bob Akers |
147101 |
/executiveeducation/bios/bobakers/ |
| Peter Alle |
147100 |
/executiveeducation/bios/peteralle/ |
| Amy Augustine |
126695 |
/executiveeducation/bios/amyaugustine/ |
| Jeffrey Berk |
142502 |
/executiveeducation/bios/jeffreyberk/ |
| Mira Brancu |
126696 |
/executiveeducation/bios/mirabrancu/ |
| Sara Carlson |
126697 |
/executiveeducation/bios/saracarlson/ |
| Antonio Castillo |
142586 |
/executiveeducation/bios/antoniocastillo/ |
| Sarita Connelly |
126698 |
/executiveeducation/bios/saritaconnelly/ |
| Erin Coupe |
126699 |
/executiveeducation/bios/erincoupe/ |
| Debbie Davis |
126700 |
/executiveeducation/bios/debbiedavis/ |
| Dianne Dawson Daniels |
154070 |
/executiveeducation/bios/diannedawsondaniels/ |
| Tom Drake |
149868 |
/executiveeducation/bios/tomdrake/ |
| Sue Eaglebarger |
126701 |
/executiveeducation/bios/sueeaglebarger/ |
| Nicole Emerick |
126702 |
/executiveeducation/bios/nicoleemerick/ |
| Carol Fitzgibbons |
147107 |
/executiveeducation/bios/carolfitzgibbons/ |
| Michael Freire |
147511 |
/executiveeducation/bios/michaelfreire/ |
| Matt Fulle |
142504 |
/executiveeducation/bios/mattfulle/ |
| Meg Goodman |
126703 |
/executiveeducation/bios/meggoodman/ |
| Rachel Gregoire |
126704 |
/executiveeducation/bios/rachelgregoire/ |
| Dr. Sharonda Hagans-Jones |
158876 |
/executiveeducation/bios/drsharondahagans-jones/ |
| Katherine Jeffery |
126705 |
/executiveeducation/bios/katherinejeffery/ |
| Dao Jensen |
126706 |
/executiveeducation/bios/daojensen/ |
| Julia Kalish |
142503 |
/executiveeducation/bios/juliakalish/ |
| Alexandra Kassel |
126707 |
/executiveeducation/bios/alexandrakassel/ |
| Darrell Katz |
147102 |
/executiveeducation/bios/darrellkatz/ |
| Andy Kaufman |
142587 |
/executiveeducation/bios/andykaufman/ |
| Vicki Klopsch |
158875 |
/executiveeducation/bios/vickiklopsch/ |
| Carolyn Kmet |
126708 |
/executiveeducation/bios/carolynkmet/ |
| Mike Loughrin |
147516 |
/executiveeducation/bios/mikeloughrin/ |
| Tracie Morris |
126709 |
/executiveeducation/bios/traciemorris/ |
| Rajiv Nathan |
126710 |
/executiveeducation/bios/rajivnathan/ |
| Betsey Nohe |
126711 |
/executiveeducation/bios/betseynohe/ |
| Kellie O'Connell |
126712 |
/executiveeducation/bios/kellieoconnell/ |
| Melissa Lagowski |
159065 |
/executiveeducation/bios/melissalagowski/ |
| Laura Ortega Lamela |
126713 |
/executiveeducation/bios/lauraortegalamela/ |
| Brandon Pendleton |
126714 |
/executiveeducation/bios/brandonpendleton/ |
| Darren Pierre |
142589 |
/executiveeducation/bios/darrenpierre/ |
| Patricia Pippert |
142588 |
/executiveeducation/bios/patriciapippert/ |
| Stacey Pitts Caldwell |
126715 |
/executiveeducation/bios/staceypittscaldwell/ |
| Dawn Reiss |
126716 |
/executiveeducation/bios/dawnreiss/ |
| Christy Rutherford |
126717 |
/executiveeducation/bios/christyrutherford/ |
| Jane Scudder |
126718 |
/executiveeducation/bios/janescudder/ |
| Heather Terry |
158874 |
/executiveeducation/bios/heatherterry/ |
| Dr. Eileen Timmins |
158877 |
/executiveeducation/bios/dreileentimmins/ |
| Charles Tocci |
147104 |
/executiveeducation/bios/charlestocci/ |
| Marie Trzupek Lynch |
126719 |
/executiveeducation/bios/marietrzupeklynch/ |
| Rafael Vasquez |
126720 |
/executiveeducation/bios/rafaelvasquez/ |
| George Vukotich |
147491 |
/executiveeducation/bios/georgevukotich/ |
| Tiara Wheatley |
126721 |
/executiveeducation/bios/tiarawheatley/ |
| Lauren Wilson Lee |
158910 |
/executiveeducation/bios/laurenwilsonlee/ |
| Alan Zayer |
147103 |
/executiveeducation/bios/alanzayer/ |
| Peter Wojcik |
159158 |
/executiveeducation/bios/peterwojcik/ |
| Daniela Hendricks |
159283 |
/executiveeducation/bios/danielahendricks/ |
| Brittani Shaw |
159522 |
/executiveeducation/bios/brittanishaw/ |
| Dr. Shelette Stewart |
161078 |
/executiveeducation/bios/drshelettestewart/ |
| Jacki Davidoff |
168271 |
/executiveeducation/bios/jackidavidoff/ |
| Bridget Albert |
168272 |
/executiveeducation/bios/bridgetalbert/ |
| Regina Armour |
168273 |
/executiveeducation/bios/reginaarmour/ |
| Heather Brod |
168274 |
/executiveeducation/bios/heatherbrod/ |
| Laura Demke-Calixte |
168275 |
/executiveeducation/bios/laurademke-calixte/ |
| Nancy Fox |
168276 |
/executiveeducation/bios/nancyfox/ |
| Gail Golden |
168277 |
/executiveeducation/bios/gailgolden/ |
| Julie Milroy |
168278 |
/executiveeducation/bios/juliemilroy/ |
| Nanette Miner |
168279 |
/executiveeducation/bios/nanetteminer/ |
| Shelby Mitchell |
168280 |
/executiveeducation/bios/shelbymitchell/ |
| Aileen Miziolek |
168281 |
/executiveeducation/bios/aileenmiziolek/ |
| Lisa Morel |
168282 |
/executiveeducation/bios/lisamorel/ |
| Karyn Pettigrew |
168283 |
/executiveeducation/bios/karynpettigrew/ |
| Ashley Richardson |
168284 |
/executiveeducation/bios/ashleyrichardson/ |
| Amy Wirtz |
168285 |
/executiveeducation/bios/amywirtz/ |
| Dr. Gertrude Lyons |
168286 |
/executiveeducation/bios/drgertrudelyons/ |
| Laura Flanagan |
168666 |
/executiveeducation/bios/lauraflanagan/ |
| Sadzi Olivia |
168667 |
/executiveeducation/bios/sadziolivia/ |
| Paula Faris |
168820 |
/executiveeducation/bios/paulafaris/ |
| Scott Stribrny |
178467 |
/executiveeducation/bios/scottstribrny/ |
| Erik Heuser |
180291 |
/executiveeducation/bios/erikheuser/ |
| Facebook Business Domain Verification |
112690 |
/xcplmrjsv8cuddetzwz869tav8sn6z.html |
| Facilities |
178211 |
/facilities/ |
| About Us |
178212 |
/facilities/aboutus/ |
| Our Team |
178216 |
/facilities/aboutus/ourteam/ |
| Campus Plan |
206858 |
https://www.luc.edu/campusplan/ |
| Contact Us |
178217 |
/facilities/aboutus/contactus/ |
| Departments |
206843 |
/facilities/departments/ |
| Campus Planning |
206855 |
/facilities/departments/campusplanning/ |
| Environmental Services |
207154 |
/environmentalservices/index.shtml |
| Operations and Maintenance |
206854 |
/facilities/departments/operationsandmaintenance/ |
| Office of Community Relations |
206856 |
https://www.luc.edu/neighborhood/ |
| Current and Recent Projects |
206844 |
/facilities/aboutus/currentandrecentprojects/ |
| Make a Request |
179738 |
/facilities/makearequest/ |
| Request a Work Order |
179739 |
/facilities/requestaworkorder/ |
| Request a Project |
179740 |
/facilities/requestaproject/ |
| Resources |
184735 |
/facilities/resources/ |
| Bike Racks Map |
189140 |
/facilities/resources/bikeracksmap/ |
| Campus Planning Invoicing Guidelines and Forms |
200705 |
/facilities/resources/campusplanninginvoicingguidelinesandforms/ |
| Campus Posters Guidelines |
189539 |
/facilities/resources/campuspostersguidelines/ |
| Employee Resources |
193371 |
/facilities/resources/employeeresources/ |
| LUC Facilities Attendance Policy |
205289 |
/facilities/resources/employeeresources/lucfacilitiesattendancepolicy/ |
| LUC Facilities Uniform Policy |
205295 |
/facilities/resources/employeeresources/lucfacilitiesuniformpolicy/ |
| LUC Golf Cart Policy |
205300 |
/facilities/resources/employeeresources/lucgolfcartpolicy/ |
| Gender Neutral Bathrooms/ Personal Wellness Facilities |
189139 |
/facilities/resources/genderneutralbathroomspersonalwellnessfacilities/ |
| Green Cleaning Policy |
206708 |
/facilities/resources/greencleaningpolicy/ |
| Guide for Residence Hall Living |
207153 |
/facilities/resources/guideforresidencehallliving/ |
| Menstrual Equity Project |
189924 |
/facilities/resources/menstrualequityproject/ |
| Office Side Lite and Window Coverings |
197895 |
/facilities/resources/officesideliteandwindowcoverings/ |
| Protecting Buildings and Facilities from Sub-Zero Temperatures |
190373 |
/facilities/resources/protectingbuildingsandfacilitiesfromsub-zerotemperatures/ |
| Triple Clear Water Filters |
190013 |
/facilities/resources/tripleclearwaterfilters/ |
| Workplace Strategy - Future State Playbook |
206167 |
/facilities/resources/workplacestrategy-futurestateplaybook/ |
| Request a Work Order |
178218 |
/facilities/requestaworkorder/ |
| Request a Project |
178220 |
/facilities/requestaproject/ |
| site_logo |
178228 |
/facilities/sitelogo/ |
| Footer |
178229 |
/facilities/footer/ |
| I Links |
178231 |
/facilities/ilinks/ |
| modules-programming |
178232 |
/facilities/modules-programming/ |
| social media |
178233 |
/facilities/socialmedia/ |
| Faculty Authors |
8617 |
/facultyauthors/ |
| site_logo |
182364 |
/facultyauthors/sitelogo/ |
| Footer |
89415 |
/facultyauthors/footer/ |
| List of Faculty Authors |
57388 |
/facultyauthors/listoffacultyauthors/ |
| Submit An Entry |
57413 |
mailto:lwheeler@luc.edu?subject=Faculty Authored Library Submission |
| Kathleen M. Adams, PhD |
8620 |
/facultyauthors/adams_kathleen_m.shtml |
| Samuel A. Attoh, PhD |
8828 |
/facultyauthors/attoh_samuel_a._.shtml |
| Emmanuel N. Barron, PhD |
8829 |
/facultyauthors/barron_emmanuel.shtml |
| Dina Berger, PhD |
8830 |
/facultyauthors/berger_dina.shtml |
| John Boatright, PhD |
8627 |
/facultyauthors/archive_jboatright.shtml |
| Dr. Mark G. Bosco, S.J. |
8832 |
/facultyauthors/bosco_mark_g.shtml |
| John Bronsteen, JD |
8833 |
/facultyauthors/bronsteen_john.html |
| Fred B. Bryant, PhD |
8834 |
/facultyauthors/bryant_fred_b.shtml |
| Robert Bucholz, PhD |
8835 |
/facultyauthors/bucholz_robert.shtml |
| Mary M. Burns, MBA |
8836 |
/facultyauthors/burns_mary_m.shtml |
| Laura Caldwell, JD |
8624 |
/facultyauthors/lauracaldwelljd/ |
| David E Chinitz, PhD |
9935 |
/facultyauthors/chinitz_david_e.shtml |
| Ellen M. Chiocca, MSN, CPNP |
9936 |
/facultyauthors/chiocca_ellen_m.shtml |
| Mine E. Cinar, PhD |
9937 |
/facultyauthors/cinar_mine_e.shtml |
| Lewis Erenberg, PhD |
9939 |
/facultyauthors/erenberg_lewis.shtml |
| Suzy Fox, PhD |
9940 |
/facultyauthors/fox_suzy.shtml |
| Timothy J. Gilfoyle, PhD |
9941 |
/facultyauthors/gilfoyle_timothy_j_.shtml |
| Al Gini, PhD |
8622 |
/facultyauthors/agini.shtml |
| David Ingram, PhD |
9944 |
/facultyauthors/ingram_david.shtml |
| Christian A. Johnson, JD |
9968 |
/facultyauthors/johnson_christian_a.shtml |
| Homer Johnson, PhD |
9972 |
/facultyauthors/johnson_homer.shtml |
| Patricia Beattie Jung, PhD |
9974 |
/facultyauthors/jung_patricia_beatti.shtml |
| Theodore J. Karamanski, PhD |
9975 |
/facultyauthors/karamanski_theodore_.shtml |
| George G. Kaufman, PhD |
8626 |
/facultyauthors/archive_gkaufman.shtml |
| James R. Larson, Jr., PhD |
9976 |
/facultyauthors/larson_james.shtml |
| Nicholas Lash, PhD |
8823 |
/facultyauthors/archive_nlash.shtml |
| Brian Lavelle, PhD |
9978 |
/facultyauthors/lavelle_brian.shtml |
| Robert M. Lombardo, PhD |
9980 |
/facultyauthors/lombardo_robert_m.shtml |
| A.G. Malliaris, PhD |
8625 |
/facultyauthors/archive_amalliaris.shtml |
| Jeffry V. Mallow, PhD |
9982 |
/facultyauthors/mallow_jeffry.shtml |
| Eli Maor, PhD |
9983 |
/facultyauthors/maor_eli.shtml |
| Anne Leggett McDonald, PhD |
9979 |
/facultyauthors/leggett_mcdonald_ann.shtml |
| Susan Mezey, PhD |
9984 |
/facultyauthors/mezey_susan.shtml |
| Laura Miller, PhD |
8628 |
/facultyauthors/archive_lmiller.shtml |
| Margaret L. Moses, PHD, JD |
9986 |
/facultyauthors/moses_margaret.shtml |
| John Nicholas, PhD |
9987 |
/facultyauthors/nicholas_john.shtml |
| Jon Nilson, PhD |
9988 |
/facultyauthors/nilson_jon.shtml |
| Robert T. O'Gorman, PhD |
9943 |
/facultyauthors/gorman_robert_t1.shtml |
| Kayhan Parsi, JD, PhD |
9989 |
/facultyauthors/parsi_kayhan.shtml |
| James F. Pastor, PhD, JD |
9990 |
/facultyauthors/pastor_james_f.shtml |
| John P. Pelissero, PhD |
9991 |
/facultyauthors/pelissero_john_p.shtml |
| Adriaan Theodoor Peperzak, PhD |
8623 |
/facultyauthors/archive_2001_docteur.shtml |
| Tracy Pintchman, PhD |
8825 |
/facultyauthors/tracypintchmanphd/ |
| Barbara H. Rosenwein, PhD |
9994 |
/facultyauthors/barbarahrosenweinphd/ |
| Susan A. Ross, PhD |
9995 |
/facultyauthors/ross_susan_a.shtml |
| Peter M. Sanchez, PhD |
9997 |
/facultyauthors/sanchez_peter_m.shtml |
| David Schweickart, PhD |
9998 |
/facultyauthors/schweickart_david.shtml |
| Paul Setlak, PhD |
9999 |
/facultyauthors/setlak_paul.shtml |
| David Shriberg, PhD |
10000 |
/facultyauthors/shriberg_david.shtml |
| Paul Alan Smulson, DDS |
10002 |
/facultyauthors/smulson_paul_alan.shtml |
| Phyllis Ann Solari-Twadell, PhD |
10003 |
/facultyauthors/solari_twadell_phyll.shtml |
| Douglas T. Story |
10004 |
/facultyauthors/story_douglas.shtml |
| Stanley Stasch, PhD |
8826 |
/facultyauthors/archive_sstasch.shtml |
| Linda Stroh, PhD |
8822 |
/facultyauthors/archive_lstroh.shtml |
| Alexander Tsesis, JD |
10006 |
/facultyauthors/tsesis_alexander.shtml |
| Steven J. Venturino, PhD |
10007 |
/facultyauthors/venturino_steven_j.shtml |
| Aana Marie Vigen, PhD |
10008 |
/facultyauthors/vigen_aana_marie.shtml |
| Spencer Weber Waller, JD |
10009 |
/facultyauthors/waller_spencer_weber.shtml |
| Carolyn Hope Smeltzer, Frances R. Vlasses, Connie R. Robinson |
8824 |
/facultyauthors/archive_nursesparade.shtml |
| Loyola Authored Library Entry Confirmation |
9938 |
/umc/newsroom/facultyauthors/tyconfirm.shtml |
| Jennifer Lucas, RN, MSN, FNP-BC |
65465 |
/facultyauthors/jenniferlucas.shtml |
| R. Ben Penglase, PhD |
70206 |
/facultyauthors/rbenpenglasephd/ |
| Faculty Center for Ignatian Pedagogy (FCIP) |
3943 |
/fcip/ |
| site_logo |
3949 |
/fcip/sitelogo/ |
| Footer |
3950 |
/fcip/footer/ |
| social media |
198603 |
/fcip/socialmedia/ |
| modules-programming |
198605 |
/fcip/modules-programming/ |
| Ignatian Pedagogy |
162120 |
/fcip/ignatianpedagogy/ |
| What is Ignatian Pedagogy? |
107422 |
/fcip/ignatianpedagogy/whatisignatianpedagogy/ |
| Introduction to Ignatian Pedagogy |
183504 |
/fcip/ignatianpedagogy/whatisignatianpedagogy/introductiontoignatianpedagogy/ |
| Ignatian Pedagogy Resources |
180941 |
/fcip/ignatianpedagogy/ignatianpedagogyresources/ |
| Sustainability Resources |
195925 |
/fcip/ignatianpedagogy/ignatianpedagogyresources/sustainabilityresources/ |
| Educator Wellness Programs & Resources |
196314 |
/fcip/ignatianpedagogy/ignatianpedagogyresources/educatorwellnessprogramsresources/ |
| Trauma-Informed Teaching and Learning |
196316 |
/fcip/ignatianpedagogy/ignatianpedagogyresources/trauma-informedteachingandlearning/ |
| Pedagogy of Justice |
117176 |
/fcip/pedagogyofjustice/ |
| What is the Pedagogy of Justice? |
195854 |
/fcip/pedagogyofjustice/whatisthepedagogyofjustice/ |
| Pedagogy of Justice Resources |
180968 |
/fcip/pedagogyofjustice/pedagogyofjusticeresources/ |
| Faculty Center for Ignatian Pedagogy Land Acknowledgement |
154364 |
/fcip/pedagogyofjustice/pedagogyofjusticeresources/facultycenterforignatianpedagogylandacknowledgement/ |
| Chosen Modes of Address Resources |
183494 |
/fcip/pedagogyofjustice/pedagogyofjusticeresources/chosenmodesofaddressresources/ |
| Decolonizing Your Syllabus |
147979 |
/fcip/pedagogyofjustice/pedagogyofjusticeresources/decolonizingyoursyllabus/ |
| Preparing to Decolonize My Syllabus |
147980 |
/fcip/pedagogyofjustice/pedagogyofjusticeresources/decolonizingyoursyllabus/preparingtodecolonizemysyllabus/ |
| Designing the Outline of My Syllabus |
147981 |
/fcip/pedagogyofjustice/pedagogyofjusticeresources/decolonizingyoursyllabus/designingtheoutlineofmysyllabus/ |
| Positionality Statement |
181036 |
/fcip/pedagogyofjustice/pedagogyofjusticeresources/positionalitystatement/ |
| Anti-Racist Pedagogy Annotated Bibliography |
157577 |
/fcip/pedagogyofjustice/pedagogyofjusticeresources/anti-racistpedagogyannotatedbibliography/ |
| Ignatian Pedagogy Selected Readings and Resources |
3952 |
/fcip/pedagogyofjustice/ignatianpedagogyselectedreadingsandresources/ |
| Pedagogy Presentations |
61835 |
/fcip/pedagogyofjustice/ignatianpedagogyselectedreadingsandresources/pedagogypresentations/ |
| Educational Resources and Bibliography |
112790 |
/fcip/pedagogyofjustice/ignatianpedagogyselectedreadingsandresources/educationalresourcesandbibliography/ |
| What is Anti-Racist Pedagogy? |
157575 |
/fcip/pedagogyofjustice/whatisanti-racistpedagogy/ |
| Teaching Spotlight |
68247 |
/fcip/pedagogyofjustice/teachingspotlight/ |
| archive |
72566 |
/fcip/pedagogyofjustice/teachingspotlight/archive/ |
| Ignatian Pedagogy Research Grant |
105125 |
/fcip/pedagogyofjustice/ignatianpedagogyresearchgrant/ |
| IP Research Grant Application |
96198 |
/fcip/pedagogyofjustice/ipresearchgrantapplication/ |
| What is Critical Disability (Dis-Crit)/Accessibility/Anti-ableist Pedagogy? |
196308 |
/fcip/pedagogyofjustice/whatiscriticaldisabilitydis-critaccessibilityanti-ableistpedagogy/ |
| What is Decolonial Pedagogy? |
196309 |
/fcip/pedagogyofjustice/whatisdecolonialpedagogy/ |
| What is Environmental Justice Pedagogy? |
196310 |
/fcip/pedagogyofjustice/whatisenvironmentaljusticepedagogy/ |
| What is Feminist Pedagogy? |
196311 |
/fcip/pedagogyofjustice/whatisfeministpedagogy/ |
| What is Queer Pedagogy? |
196312 |
/fcip/pedagogyofjustice/whatisqueerpedagogy/ |
| Teaching with Love, Justice, & Magis: FCIP 2024 Programming Series |
200528 |
/fcip/pedagogyofjustice/teachingwithlovejusticemagisfcip2024programmingseries/ |
| Student-Centered Design |
129442 |
/fcip/student-centereddesign/ |
| What is Student-Centered Design? |
195875 |
/fcip/student-centereddesign/whatisstudent-centereddesign/ |
| Student-Centered Design Programs |
181019 |
/fcip/student-centereddesign/student-centereddesignprograms/ |
| Student-Centered Design Resources |
181020 |
/fcip/student-centereddesign/student-centereddesignresources/ |
| Course Design |
55763 |
/fcip/student-centereddesign/student-centereddesignresources/coursedesign/ |
| Academic Integrity and Artificial Intelligence |
181216 |
/fcip/student-centereddesign/student-centereddesignresources/coursedesign/academicintegrityandartificialintelligence/ |
| Course Mapping: Backward Design |
117075 |
/fcip/student-centereddesign/student-centereddesignresources/coursedesign/coursemappingbackwarddesign/ |
| Universal Design for Learning |
117074 |
/fcip/student-centereddesign/student-centereddesignresources/coursedesign/universaldesignforlearning/ |
| Flexibility |
117080 |
/fcip/student-centereddesign/student-centereddesignresources/coursedesign/flexibility/ |
| Establishing Learning Outcomes |
117076 |
/fcip/student-centereddesign/student-centereddesignresources/coursedesign/establishinglearningoutcomes/ |
| Selecting and Designing Resources |
181060 |
/fcip/student-centereddesign/student-centereddesignresources/coursedesign/selectinganddesigningresources/ |
| Selecting and Designing Activities Resources |
117079 |
/fcip/student-centereddesign/student-centereddesignresources/coursedesign/selectinganddesigningresources/selectinganddesigningactivitiesresources/ |
| Gaining and Providing a Diverse Perspective through Assignments |
181061 |
/fcip/student-centereddesign/student-centereddesignresources/coursedesign/selectinganddesigningresources/gainingandprovidingadiverseperspectivethroughassignments/ |
| Designing Classroom Assessment and Assignment Strategies |
166791 |
/fcip/student-centereddesign/student-centereddesignresources/coursedesign/designingclassroomassessmentandassignmentstrategies/ |
| Determining Acceptable Evidence |
181218 |
/fcip/student-centereddesign/student-centereddesignresources/coursedesign/designingclassroomassessmentandassignmentstrategies/determiningacceptableevidence/ |
| Ungrading |
181219 |
/fcip/student-centereddesign/student-centereddesignresources/coursedesign/designingclassroomassessmentandassignmentstrategies/ungrading/ |
| Exploring Learning Preferences |
181220 |
/fcip/student-centereddesign/student-centereddesignresources/coursedesign/designingclassroomassessmentandassignmentstrategies/exploringlearningpreferences/ |
| Giving Students Feedback |
117078 |
/fcip/student-centereddesign/student-centereddesignresources/coursedesign/givingstudentsfeedback/ |
| Giving Students Feedback |
181221 |
/fcip/student-centereddesign/student-centereddesignresources/coursedesign/givingstudentsfeedback/givingstudentsfeedback/ |
| Recursive Feedback Loops |
181223 |
/fcip/student-centereddesign/student-centereddesignresources/coursedesign/givingstudentsfeedback/recursivefeedbackloops/ |
| Evaluating A Course |
116975 |
/fcip/student-centereddesign/student-centereddesignresources/coursedesign/evaluatingacourse/ |
| Evaluating a Course |
181260 |
/fcip/student-centereddesign/student-centereddesignresources/coursedesign/evaluatingacourse/evaluatingacourse/ |
| Mid-Semester Evaluations |
195931 |
/fcip/student-centereddesign/student-centereddesignresources/coursedesign/evaluatingacourse/evaluatingacourse/mid-semesterevaluations/ |
| Flexibility in the New Normal |
181261 |
/fcip/student-centereddesign/student-centereddesignresources/coursedesign/evaluatingacourse/flexibilityinthenewnormal/ |
| Student-Centered Practice: Flexible Deadlines |
181262 |
/fcip/student-centereddesign/student-centereddesignresources/coursedesign/evaluatingacourse/student-centeredpracticeflexibledeadlines/ |
| Course Facilitation |
166634 |
/fcip/student-centereddesign/student-centereddesignresources/coursefacilitation/ |
| Building Community |
181263 |
/fcip/student-centereddesign/student-centereddesignresources/coursefacilitation/buildingcommunity/ |
| Bringing Classroom Community Guidelines to Life |
181479 |
/fcip/student-centereddesign/student-centereddesignresources/coursefacilitation/bringingclassroomcommunityguidelinestolife/ |
| Breaking the Ice Online |
181264 |
/fcip/student-centereddesign/student-centereddesignresources/coursefacilitation/breakingtheiceonline/ |
| Starting off on the Right Foot |
181265 |
/fcip/student-centereddesign/student-centereddesignresources/coursefacilitation/startingoffontherightfoot/ |
| Active Learning |
181266 |
/fcip/student-centereddesign/student-centereddesignresources/coursefacilitation/activelearning/ |
| How to Bring Your Class to Life Through Active-Learning |
181270 |
/fcip/student-centereddesign/student-centereddesignresources/coursefacilitation/activelearning/howtobringyourclasstolifethroughactive-learning/ |
| Creating Video Case Studies |
181269 |
/fcip/student-centereddesign/student-centereddesignresources/coursefacilitation/activelearning/creatingvideocasestudies/ |
| Enhanced Student and Peer-to-Peer Engagement |
181268 |
/fcip/student-centereddesign/student-centereddesignresources/coursefacilitation/activelearning/enhancedstudentandpeer-to-peerengagement/ |
| A Game to Engage Students |
181271 |
/fcip/student-centereddesign/student-centereddesignresources/coursefacilitation/activelearning/agametoengagestudents/ |
| Classroom Disengagement: Strategies and Supports for Instructors |
180550 |
/fcip/student-centereddesign/student-centereddesignresources/classroomdisengagementstrategiesandsupportsforinstructors/ |
| Syllabus Design |
154005 |
/fcip/student-centereddesign/student-centereddesignresources/syllabusdesign/ |
| Creating a Student-Centered Syllabus |
166796 |
/fcip/student-centereddesign/student-centereddesignresources/syllabusdesign/creatingastudent-centeredsyllabus/ |
| Syllabus Design Workshop Materials |
166797 |
/fcip/student-centereddesign/student-centereddesignresources/syllabusdesign/syllabusdesignworkshopmaterials/ |
| Decolonizing Your Syllabus and Making Your Syllabus More Inclusive |
154007 |
/fcip/student-centereddesign/student-centereddesignresources/syllabusdesign/decolonizingyoursyllabusandmakingyoursyllabusmoreinclusive/ |
| Accessibility Guidelines |
110822 |
/fcip/student-centereddesign/student-centereddesignresources/accessibilityguidelines/ |
| Panopto Accessibility |
110829 |
/fcip/student-centereddesign/student-centereddesignresources/accessibilityguidelines/panoptoaccessibility/ |
| PowerPoint Accessibility |
110828 |
/fcip/student-centereddesign/student-centereddesignresources/accessibilityguidelines/powerpointaccessibility/ |
| Sakai Accessibility |
110827 |
/fcip/student-centereddesign/student-centereddesignresources/accessibilityguidelines/sakaiaccessibility/ |
| VoiceThread Accessibility |
110826 |
/fcip/student-centereddesign/student-centereddesignresources/accessibilityguidelines/voicethreadaccessibility/ |
| Word Accessibility |
110825 |
/fcip/student-centereddesign/student-centereddesignresources/accessibilityguidelines/wordaccessibility/ |
| Glossary |
110823 |
/fcip/student-centereddesign/student-centereddesignresources/accessibilityguidelines/glossary/ |
| Past Sessions |
146877 |
/fcip/student-centereddesign/student-centereddesignresources/pastsessions/ |
| Anti-Racist Pedagogy and Student Centered Design Resources |
179570 |
/fcip/student-centereddesign/student-centereddesignresources/anti-racistpedagogyandstudentcentereddesignresources/ |
| Awards, Research, & Opportunities |
3951 |
/fcip/awardsresearchopportunities/ |
| Faculty Teaching Awards |
181273 |
/fcip/awardsresearchopportunities/facultyteachingawards/ |
| Teaching Award Descriptions |
18072 |
/fcip/awardsresearchopportunities/facultyteachingawards/teachingawarddescriptions/ |
| 2012 |
71531 |
/fcip/awardsresearchopportunities/facultyteachingawards/teachingawarddescriptions/2012/ |
| FacultyAwardsPhotos |
107654 |
/fcip/awardsresearchopportunities/facultyteachingawards/teachingawarddescriptions/facultyawardsphotos/ |
| Faculty Teaching Awards Ceremony |
159827 |
/fcip/awardsresearchopportunities/facultyteachingawards/facultyteachingawardsceremony/ |
| FTA Ceremony Recordings |
160700 |
/fcip/awardsresearchopportunities/facultyteachingawards/facultyteachingawardsceremony/ftaceremonyrecordings/ |
| Faculty Teaching Awards Nominations and Prior Winners |
181277 |
/fcip/awardsresearchopportunities/facultyteachingawards/facultyteachingawardsnominationsandpriorwinners/ |
| Teaching Awards Nomination Process |
127235 |
/fcip/awardsresearchopportunities/facultyteachingawards/facultyteachingawardsnominationsandpriorwinners/teachingawardsnominationprocess/ |
| Eligibility Requirements |
163526 |
/fcip/awardsresearchopportunities/facultyteachingawards/facultyteachingawardsnominationsandpriorwinners/teachingawardsnominationprocess/eligibilityrequirements/ |
| Required Materials if Nominated |
163527 |
/fcip/awardsresearchopportunities/facultyteachingawards/facultyteachingawardsnominationsandpriorwinners/teachingawardsnominationprocess/requiredmaterialsifnominated/ |
| Teaching Award Winner Profiles |
126204 |
/fcip/awardsresearchopportunities/facultyteachingawards/facultyteachingawardsnominationsandpriorwinners/teachingawardwinnerprofiles/ |
| 2021-2022 Winners |
180365 |
/fcip/awardsresearchopportunities/facultyteachingawards/facultyteachingawardsnominationsandpriorwinners/teachingawardwinnerprofiles/2021-2022winners/ |
| 2020-2021 Winners |
160706 |
/fcip/awardsresearchopportunities/facultyteachingawards/facultyteachingawardsnominationsandpriorwinners/teachingawardwinnerprofiles/2020-2021winners/ |
| 2022-2023 Winners |
185688 |
/fcip/awardsresearchopportunities/facultyteachingawards/facultyteachingawardsnominationsandpriorwinners/teachingawardwinnerprofiles/2022-2023winners/ |
| 2023-2024 Winners |
194047 |
/fcip/awardsresearchopportunities/facultyteachingawards/facultyteachingawardsnominationsandpriorwinners/teachingawardwinnerprofiles/2023-2024winners/ |
| 2024-2025 Winners |
202344 |
/fcip/awardsresearchopportunities/facultyteachingawards/facultyteachingawardsnominationsandpriorwinners/teachingawardwinnerprofiles/2024-2025winners/ |
| Past Teaching Award Winners & Finalists |
124801 |
/fcip/awardsresearchopportunities/facultyteachingawards/facultyteachingawardsnominationsandpriorwinners/pastteachingawardwinnersfinalists/ |
| Scholarship of Teaching and Learning |
181274 |
/fcip/awardsresearchopportunities/scholarshipofteachingandlearning/ |
| What is Scholarship of Teaching and Learning? |
179517 |
/fcip/awardsresearchopportunities/scholarshipofteachingandlearning/whatisscholarshipofteachingandlearning/ |
| Scholarship of Teaching and Learning Resources |
181279 |
/fcip/awardsresearchopportunities/scholarshipofteachingandlearning/scholarshipofteachingandlearningresources/ |
| Library Guides |
127224 |
/fcip/awardsresearchopportunities/scholarshipofteachingandlearning/scholarshipofteachingandlearningresources/libraryguides/ |
| You Teach, We Learn |
194049 |
/fcip/awardsresearchopportunities/scholarshipofteachingandlearning/youteachwelearn/ |
| Fall 2024 Semester Episodes |
202662 |
/fcip/awardsresearchopportunities/scholarshipofteachingandlearning/youteachwelearn/fall2024semesterepisodes/ |
| Stories |
124896 |
/fcip/stories/ |
| archive |
198608 |
/fcip/stories/archive/ |
| Assets |
201406 |
/fcip/assets/ |
| Faculty Council |
20036 |
/faccouncil/ |
| About Us |
20037 |
/faccouncil/about.shtml |
| Executive Committee |
20046 |
/faccouncil/exec_cmte.shtml |
| Elected Members |
20045 |
/faccouncil/elec_mem.shtml |
| Subcommittees |
166087 |
/faccouncil/subcommittees/ |
| History, v2 |
160948 |
/faccouncil/history2.shtml |
| History |
199291 |
/faccouncil/history.shtml |
| Previous Representatives |
195536 |
/faccouncil/history/previousrepresentatives/ |
| AY 2018-2019 |
70813 |
/faccouncil/history/previousrepresentatives/ay2018-2019/ |
| AY 2013-2014 |
56861 |
/faccouncil/history/previousrepresentatives/ay2013-2014/ |
| AY 2012-2013 |
20272 |
/faccouncil/members12-13.shtml |
| AY 2011-2012 |
21831 |
/faccouncil/members11-12.shtml |
| AY 2010-2011 |
20271 |
/faccouncil/members10-11.shtml |
| AY 2009-2010 |
20270 |
/faccouncil/members09-10.shtml |
| AY 2007-2008 |
20269 |
/faccouncil/members07-08.shtml |
| AY 2006-2007 |
20268 |
/faccouncil/members06-07.shtml |
| AY 2003-2004 |
20051 |
/faccouncil/members03-04.shtml |
| AY 2002-2003 |
20050 |
/faccouncil/members02-03.shtml |
| AY 2001-2002 |
20049 |
/faccouncil/members01-02.shtml |
| AY 2000-2001 |
20048 |
/faccouncil/members00-01.shtml |
| AY 1999-2000 |
20047 |
/faccouncil/members99-00.shtml |
| AY 2019-2020 |
199490 |
/faccouncil/history/previousrepresentatives/ay2019-2020/ |
| AY 2020-2021 |
199491 |
/faccouncil/history/previousrepresentatives/ay2020-2021/ |
| AY 2021-2022 |
199492 |
/faccouncil/history/previousrepresentatives/ay2021-2022/ |
| AY 2022-2023 |
199493 |
/faccouncil/history/previousrepresentatives/ay2022-2023/ |
| AY 2023-2024 |
199494 |
/faccouncil/history/previousrepresentatives/ay2023-2024/ |
| AY 2024-2025 |
204065 |
/faccouncil/ |
| Contact Us |
149693 |
/faccouncil/contact_us.shtml |
| Governance |
161035 |
/faccouncil/governance.shtml |
| Bylaws and Constitution |
161036 |
/faccouncil/bylawsandcon.shtml |
| Constitution |
161037 |
/faccouncil/constitution.shtml |
| Faculty Council Elections |
149691 |
/faccouncil/governance/elections.shtml |
| Communication |
149673 |
/faccouncil/meeting_schedule.shtml |
| Meeting Schedule |
200724 |
/faccouncil/communication/meeting_schedule.shtml |
| Meeting Minutes |
20058 |
/faccouncil/archives.shtml |
| Newsletters |
156156 |
/faccouncil/communication/newsletter.html |
| The Council's Work |
149672 |
/faccouncil/co_work.shtml |
| Faculty Handbook |
198855 |
/faccouncil/thecouncilswork/facultyhandbook/ |
| Faculty Member of the Year |
149677 |
/faccouncil/thecouncilswork/fmoy.shtml |
| 2025 Faculty Member of the Year |
166155 |
/faccouncil/thecouncilswork/facultymemberoftheyear/2025facultymemberoftheyear/ |
| Previous Awardees |
193750 |
/faccouncil/thecouncilswork/facultymemberoftheyear/prev_winners.shtml |
| Nominations for the Faculty Member of the Year |
193761 |
/faccouncil/thecouncilswork/facultymemberoftheyear/nominationsforthefacultymemberoftheyear/ |
| Faculty Member of the Year: Nomination Form |
193762 |
/faccouncil/committees/awards/nominate.shtml |
| Evaluation of the Deans |
149676 |
/faccouncil/thecouncilswork/dean_evaluation.shtml |
| Major Issues and Resolutions |
20057 |
/faccouncil/issues.shtml |
| Issues 2019-2020 |
146882 |
/faccouncil/issues2019-2020/ |
| Issues 2020-2021 |
153970 |
/faccouncil/issues2020-2021/ |
| Resources |
149692 |
/faccouncil/resources/ |
| Footer |
20279 |
/faccouncil/footer/ |
| site_logo |
20280 |
/faccouncil/sitelogo/ |
| modules-programming |
200659 |
/faccouncil/modules-programming/ |
| Direct Links |
155381 |
/faccouncil/directlinks/ |
| Family Business Center |
158092 |
/familybusiness/ |
| About |
158093 |
/familybusiness/about/ |
| Mission and Vision |
158223 |
/familybusiness/about/missionandvision/ |
| Our Story |
159132 |
/familybusiness/about/ourstory/ |
| The Team |
158951 |
/familybusiness/about/theteam/ |
| archive |
160268 |
/familybusiness/about/theteam/archive/ |
| Celebrating Anne Smart's Retirement |
178717 |
/familybusiness/about/theteam/celebratingannesmartsretirement/ |
| Introducing the Family Business Center director |
181782 |
/familybusiness/about/theteam/introducingthefamilybusinesscenterdirector/ |
| Board of Advisors |
158098 |
/familybusiness/about/boardofadvisors/ |
| Board of Advisors Expectations |
187459 |
/familybusiness/about/boardofadvisors/boardofadvisorsexpectations/ |
| Community |
158950 |
/familybusiness/about/community/ |
| Contact Us |
158953 |
/familybusiness/about/contactus/ |
| Visit Us |
191119 |
/familybusiness/about/visitus/ |
| Services |
158221 |
/familybusiness/services/ |
| Next Generation Leadership Institute |
158185 |
/familybusiness/services/about_ngli.shtml |
| Alumni |
193949 |
/familybusiness/services/nextgenerationleadershipinstitute/alumni/ |
| Welcome to the Next Gen Leadership Institute |
196114 |
/familybusiness/services/nextgenerationleadershipinstitute/welcometothenextgenleadershipinstitute/ |
| Stewardship Institute |
158187 |
/familybusiness/services/about_fbsi.shtml |
| The journey begins |
199650 |
/familybusiness/services/stewardshipinstitute/thejourneybegins/ |
| Leading with legacy |
199651 |
/familybusiness/services/stewardshipinstitute/leadingwithlegacy/ |
| Building family bonds |
199652 |
/familybusiness/services/stewardshipinstitute/buildingfamilybonds/ |
| Welcome to the Stewardship Institute |
202957 |
/familybusiness/services/stewardshipinstitute/welcometothestewardshipinstitute/ |
| Legacy Institute |
158200 |
/familybusiness/services/legacyinstitute/ |
| Peer Groups |
158181 |
/familybusiness/services/peergroups/ |
| Peer Group Application |
158182 |
/familybusiness/services/peergroups/peergroupapplication/ |
| Thank You |
158183 |
/familybusiness/services/peergroups/thankyou/ |
| right_column |
177448 |
/familybusiness/services/peergroups/rightcolumn/ |
| Family Business CFOs |
195180 |
/familybusiness/services/peergroups/familybusinesscfos/ |
| Mentorship |
203663 |
/familybusiness/services/mentorship/ |
| Family Business Management |
191915 |
/familybusiness/services/familybusinessmanagement/ |
| Thank You for Speaking |
204420 |
/familybusiness/services/familybusinessmanagement/thankyouforspeaking/ |
| Custom Services |
158954 |
/familybusiness/services/customservices/ |
| Connect with Loyola Students |
158177 |
/familybusiness/services/customservices/connectwithloyolastudents/ |
| Library |
158178 |
/familybusiness/services/customservices/resources_library.shtml |
| Custom Services Request for Information |
159777 |
/familybusiness/services/customservices/customservicesrequestforinformation/ |
| Insights |
158222 |
/familybusiness/insights/ |
| Newsletter |
158174 |
/familybusiness/insights/newsletter/ |
| Resources |
158960 |
/familybusiness/insights/resources/ |
| archive |
159151 |
/familybusiness/insights/resources/archive/ |
| Suggested Reading |
158179 |
/familybusiness/insights/resources/resources_reading.shtml |
| FK Day |
198258 |
/familybusiness/insights/resources/fkday/ |
| Blair Trippe |
198259 |
/familybusiness/insights/resources/blairtrippe/ |
| Mary Burke |
198260 |
/familybusiness/insights/resources/maryburke/ |
| Webinars |
159148 |
/familybusiness/insights/webinars/ |
| archive |
159150 |
/familybusiness/insights/webinars/archive/ |
| Economic Trends. Where we are. Where we are going. |
162183 |
/familybusiness/insights/webinars/economictrendswherewearewherewearegoing/ |
| Strategic Planning for the Family Business |
162982 |
/familybusiness/insights/webinars/strategicplanningforthefamilybusiness/ |
| Economic Predictions for Family Businesses |
162983 |
/familybusiness/insights/webinars/economicpredictionsforfamilybusinesses/ |
| Family Business Resiliency |
162984 |
/familybusiness/insights/webinars/familybusinessresiliency/ |
| Crossing the Crisis |
162985 |
/familybusiness/insights/webinars/crossingthecrisis/ |
| Leveraging Your Board in Times of Crisis |
162986 |
/familybusiness/insights/webinars/leveragingyourboardintimesofcrisis/ |
| Legacy in the Final Third of Life |
162987 |
/familybusiness/insights/webinars/legacyinthefinalthirdoflife/ |
| To Pay or Not to Pay: Family Governance and Board Compensation |
166424 |
/familybusiness/insights/webinars/topayornottopayfamilygovernanceandboardcompensation/ |
| Building Credibility and Influence in Your Family Business |
166425 |
/familybusiness/insights/webinars/buildingcredibilityandinfluenceinyourfamilybusiness/ |
| Building a Better Board |
166426 |
/familybusiness/insights/webinars/buildingabetterboard/ |
| Managing Addiction in the Workplace |
166427 |
/familybusiness/insights/webinars/managingaddictionintheworkplace/ |
| You're Getting Paid What?!? |
166428 |
/familybusiness/insights/webinars/youregettingpaidwhat/ |
| You're Getting Paid What?!? |
166428 |
/familybusiness/insights/webinars/youregettingpaidwhat/ |
| You're Getting Paid What?!? |
166428 |
/familybusiness/insights/webinars/youregettingpaidwhat/ |
| You're Getting Paid What?!? |
166428 |
/familybusiness/insights/webinars/youregettingpaidwhat/ |
| Cyber Threats: Could Your Family Be Hacked? |
166430 |
/familybusiness/insights/webinars/cyberthreatscouldyourfamilybehacked/ |
| Family Boards and Outside Directors |
166432 |
/familybusiness/insights/webinars/familyboardsandoutsidedirectors/ |
| Family Councils: Charting a Course for Future Success |
166433 |
/familybusiness/insights/webinars/familycouncilschartingacourseforfuturesuccess/ |
| The Nuts and Bolts of Family Meetings |
166434 |
/familybusiness/insights/webinars/thenutsandboltsoffamilymeetings/ |
| Family Offices |
166435 |
/familybusiness/insights/webinars/familyoffices/ |
| Building a Culture of Accountability |
166436 |
/familybusiness/insights/webinars/buildingacultureofaccountability/ |
| Understanding the Prenup Process |
166437 |
/familybusiness/insights/webinars/understandingtheprenupprocess/ |
| Best Practices in Developing Leaders |
166438 |
/familybusiness/insights/webinars/bestpracticesindevelopingleaders/ |
| Polarities in Family Business |
166439 |
/familybusiness/insights/webinars/polaritiesinfamilybusiness/ |
| Prenups in Family Business |
166440 |
/familybusiness/insights/webinars/prenupsinfamilybusiness/ |
| Raising Normal Children in a Privileged World |
166441 |
/familybusiness/insights/webinars/raisingnormalchildreninaprivilegedworld/ |
| Change the World with Social Entrepreneurship |
166442 |
/familybusiness/insights/webinars/changetheworldwithsocialentrepreneurship/ |
| Managing Social Media |
166443 |
/familybusiness/insights/webinars/managingsocialmedia/ |
| Trusts, Trustees, and Beneficiaries |
166444 |
/familybusiness/insights/webinars/truststrusteesandbeneficiaries/ |
| What Family Members Need to Know |
166445 |
/familybusiness/insights/webinars/whatfamilymembersneedtoknow/ |
| Key Tools for Overcoming Conflict in Family Business |
166446 |
/familybusiness/insights/webinars/keytoolsforovercomingconflictinfamilybusiness/ |
| Family Foundations: Growth and Development Perspectives |
168602 |
/familybusiness/insights/webinars/familyfoundationsgrowthanddevelopmentperspectives/ |
| Online Resources |
158180 |
/familybusiness/insights/resources_links.shtml |
| Stories |
199514 |
/familybusiness/insights/stories/ |
| Sloan |
178506 |
/familybusiness/insights/stories/sloan/ |
| Pivot Point International |
178505 |
/familybusiness/insights/stories/pivotpointinternational/ |
| E.D. Etnyre & Co. |
178503 |
/familybusiness/insights/stories/edetnyreco/ |
| Antunes |
178500 |
/familybusiness/insights/stories/antunes/ |
| Nielsen-Massey Vanillas |
178504 |
/familybusiness/insights/stories/nielsen-masseyvanillas/ |
| Ball Horticultural |
178501 |
/familybusiness/insights/stories/ballhorticultural/ |
| Spraying Systems Co. |
178507 |
/familybusiness/insights/stories/sprayingsystemsco/ |
| Clemens Food Group |
178502 |
/familybusiness/insights/stories/clemensfoodgroup/ |
| Magid |
199516 |
/familybusiness/insights/stories/magid/ |
| W.S. Darley |
199518 |
/familybusiness/insights/stories/wsdarley/ |
| Follett Family Enterprise Learning |
201720 |
/familybusiness/insights/follettfamilyenterpriselearning/ |
| Events |
158226 |
/familybusiness/events/ |
| Upcoming Events |
158111 |
/familybusiness/events/upcomingevents/ |
| archive |
158112 |
/familybusiness/events/upcomingevents/archive/ |
| Think Tank: Women on Family Business Boards |
199262 |
/familybusiness/events/upcomingevents/thinktankwomenonfamilybusinessboards/ |
| Event Consent and Disclosures |
205908 |
/familybusiness/events/upcomingevents/eventconsentanddisclosures/ |
| Self-Leadership Series |
196371 |
/familybusiness/events/self-leadershipseries/ |
| Recaps |
206475 |
/familybusiness/events/self-leadershipseries/recaps/ |
| Understanding Boundaries: Key Takeaways |
206476 |
/familybusiness/events/self-leadershipseries/recaps/understandingboundarieskeytakeaways/ |
| The Power and Process of Transitions |
204505 |
/familybusiness/events/thepowerandprocessoftransitions/ |
| Past Events |
158113 |
/familybusiness/events/pastevents/ |
| archive |
158114 |
/familybusiness/events/pastevents/archive/ |
| Legacy of Trust |
198487 |
/familybusiness/events/pastevents/legacyoftrust/ |
| Virtual Ideas Fair |
199106 |
/familybusiness/events/pastevents/virtualideasfair/ |
| Women in Family Business |
200465 |
/familybusiness/events/pastevents/womeninfamilybusiness/ |
| Family Business Through a Legal Lens |
201628 |
/familybusiness/events/pastevents/familybusinessthroughalegallens/ |
| Economic Outlook Breakfast |
200502 |
/familybusiness/events/pastevents/economicoutlookbreakfast/ |
| Working Capital Analysis for Family Businesses |
201778 |
/familybusiness/events/pastevents/workingcapitalanalysisforfamilybusinesses/ |
| Doing Business in India |
202157 |
/familybusiness/events/pastevents/doingbusinessinindia/ |
| Burnout: Beating It for High Performance and Impact |
202170 |
/familybusiness/events/upcomingevents/burnoutbeatingitforhighperformanceandimpact/ |
| AI for Family Business |
200942 |
/familybusiness/events/pastevents/aiforfamilybusiness/ |
| Family Summer Social |
202425 |
/familybusiness/events/upcomingevents/familysummersocial/ |
| Great Clock Out |
202954 |
/familybusiness/events/pastevents/greatclockout/ |
| Let's Talk Tariffs |
203095 |
/familybusiness/events/upcomingevents/letstalktariffs/ |
| 5 Steps to Having Hard Conversations in Family Business |
204080 |
/familybusiness/events/pastevents/5stepstohavinghardconversationsinfamilybusiness/ |
| 2018 |
207387 |
/familybusiness/events/pastevents/2018/ |
| Women in Family Business 2018 |
207388 |
/familybusiness/events/pastevents/2018/womeninfamilybusiness2018/ |
| Leadership, Culture, and Performance |
207389 |
/familybusiness/events/pastevents/2018/leadershipcultureandperformance/ |
| Family Business Center Member Social |
207390 |
/familybusiness/events/pastevents/2018/familybusinesscentermembersocial/ |
| FBC Young Adult Family Business Camp 2018 |
207391 |
/familybusiness/events/pastevents/2018/fbcyoungadultfamilybusinesscamp2018/ |
| Family Business Conference: Crisis Recovery |
207392 |
/familybusiness/events/pastevents/2018/familybusinessconferencecrisisrecovery/ |
| 2019 |
207393 |
/familybusiness/events/pastevents/2019/ |
| Women in Family Business 2019 |
207394 |
/familybusiness/events/pastevents/2019/womeninfamilybusiness2019/ |
| Spring Conference: Marketing the Family Brand |
207395 |
/familybusiness/events/pastevents/2019/springconferencemarketingthefamilybrand/ |
| Family Business Center Member Social |
207398 |
/familybusiness/events/pastevents/2019/familybusinesscentermembersocial/ |
| Learning Journey at Gold Eagle |
207399 |
/familybusiness/events/pastevents/2019/learningjourneyatgoldeagle/ |
| 2020 |
207481 |
/familybusiness/events/pastevents/2020/ |
| Women in Family Business 2020 |
207482 |
/familybusiness/events/pastevents/2020/womeninfamilybusiness2020/ |
| Main Street Lending: The Next Frontier |
207483 |
/familybusiness/events/pastevents/2020/mainstreetlendingthenextfrontier/ |
| Responding to Racism and Social Injustice |
207487 |
/familybusiness/events/pastevents/2020/respondingtoracismandsocialinjustice/ |
| Adapting at the Speed of Change |
207491 |
/familybusiness/events/pastevents/2020/adaptingatthespeedofchange/ |
| 2021 |
207496 |
/familybusiness/events/pastevents/2021/ |
| Economic Trends 2021 |
207497 |
/familybusiness/events/pastevents/2021/economictrends2021/ |
| 2022 |
207501 |
/familybusiness/events/pastevents/2022/ |
| Women in Family Business |
207502 |
/familybusiness/events/pastevents/2022/womeninfamilybusiness/ |
| Leading with Values |
207503 |
/familybusiness/events/pastevents/2022/leadingwithvalues/ |
| 2023 |
207505 |
/familybusiness/events/pastevents/2023/ |
| Women in Family Business |
207506 |
/familybusiness/events/pastevents/2023/womeninfamilybusiness/ |
| Adventures in Family Business |
207507 |
/familybusiness/events/pastevents/2023/adventuresinfamilybusiness/ |
| Managing Enterprise Risk |
207508 |
/familybusiness/events/pastevents/2023/managingenterpriserisk/ |
| Family Business General Counsel Seminar |
207509 |
/familybusiness/events/pastevents/2023/familybusinessgeneralcounselseminar/ |
| Summer Member Social |
207510 |
/familybusiness/events/pastevents/2023/summermembersocial/ |
| Rethinking ESG in Family Business |
207512 |
/familybusiness/events/pastevents/2023/rethinkingesginfamilybusiness/ |
| Quad Cities Happy Hour |
207513 |
/familybusiness/events/pastevents/2023/quadcitieshappyhour/ |
| Family Business Connect |
207514 |
/familybusiness/events/pastevents/2023/familybusinessconnect/ |
| Visitor Information |
189089 |
/familybusiness/events/visitorinformation/ |
| Widget |
206440 |
/familybusiness/events/widget/ |
| Membership |
158109 |
/familybusiness/membership/ |
| Why Become a Member? |
158225 |
/familybusiness/membership/whybecomeamember/ |
| Member Stories |
160002 |
/familybusiness/membership/memberstories/ |
| archive |
159776 |
/familybusiness/membership/memberstories/archive/ |
| Member Portal |
204053 |
/familybusiness/membership/memberportal/ |
| Support |
159251 |
/familybusiness/support/ |
| Sponsorship |
158958 |
/familybusiness/support/sponsorship/ |
| Make a Gift |
159252 |
https://securelb.imodules.com/s/1548/alumni/giving.aspx?sid=1548&gid=2&pgid=4385&cid=7791 |
| Strategic Partners |
185449 |
/familybusiness/support/strategicpartners/ |
| site_logo |
158205 |
/familybusiness/sitelogo/ |
| social media |
160455 |
/familybusiness/socialmedia/ |
| footer |
158210 |
/familybusiness/footer/ |
| I Links |
158206 |
/familybusiness/ilinks/ |
| Request Information |
158201 |
/familybusiness/requestinformation/ |
| Thank You |
158202 |
/familybusiness/requestinformation/thankyou/ |
| Links |
190490 |
/familybusiness/links/ |
| Family Weekend |
182264 |
/familyweekend/ |
| site_logo |
182265 |
/familyweekend/sitelogo/ |
| Footer |
182266 |
/familyweekend/footer/ |
| cta |
184015 |
/familyweekend/cta/ |
| I Links |
183855 |
/familyweekend/ilinks/ |
| Registration |
182291 |
/familyweekend/registration/ |
| FAQs |
182292 |
/familyweekend/faqs/ |
| Plan Your Visit |
182293 |
/familyweekend/planyourvisit/ |
| Travel to/from Airports |
182299 |
/familyweekend/planyourvisit/traveltofromairports/ |
| Accessibility Options at O’Hare International Airport (ORD) |
182300 |
/familyweekend/planyourvisit/traveltofromairports/accessibilityoptionsatohareinternationalairportord/ |
| Transportation to/from O'Hare |
182301 |
/familyweekend/planyourvisit/traveltofromairports/transportationtofromohare/ |
| Accessibility Options at Chicago Midway International Airport (MDW) |
182302 |
/familyweekend/planyourvisit/traveltofromairports/accessibilityoptionsatchicagomidwayinternationalairportmdw/ |
| Transportation to/from Midway |
182303 |
/familyweekend/planyourvisit/traveltofromairports/transportationtofrommidway/ |
| Lakeshore Campus Hotels |
182304 |
/familyweekend/planyourvisit/lakeshorecampushotels/ |
| Water Tower Campus Hotels |
182305 |
/familyweekend/planyourvisit/watertowercampushotels/ |
| Chicago Attractions |
182306 |
/familyweekend/planyourvisit/chicagoattractions/ |
| Parking |
182307 |
/familyweekend/planyourvisit/parking/ |
| Schedule |
184178 |
/familyweekend/schedule/ |
| Self Guided Tour |
186036 |
/familyweekend/selfguidedtour/ |
| Fellowship Office |
16264 |
/fellowshipoffice/index.shtml |
| About Us |
16265 |
/fellowshipoffice/aboutus.shtml |
| Mission Statement |
55430 |
/fellowshipoffice/missionstatement/ |
| Our Team |
206363 |
/fellowshipoffice/ourteam/ |
| Contact Us |
206362 |
/fellowshipoffice/contactus/ |
| profiles |
206367 |
/fellowshipoffice/contactus/profiles/ |
| Fellowship Office Mission and Vision |
206725 |
https://www.luc.edu/media/lucedu/fellowshipoffice/pdfs/strategicplan2026-31.pdf |
| Fellowships and Scholarships |
206371 |
/fellowshipoffice/fellowshipsandscholarships/ |
| Advice for Applying |
206418 |
/fellowshipoffice/adviceforapplying/ |
| Information Sessions |
206445 |
/fellowshipoffice/adviceforapplying/informationsessions/ |
| Past Applicants |
206446 |
/fellowshipoffice/adviceforapplying/pastapplicants/ |
| profiles |
206447 |
/fellowshipoffice/adviceforapplying/currentapplicants/profiles/ |
| Award Winners |
206455 |
/fellowshipoffice/awardwinners/ |
| profiles |
206456 |
/fellowshipoffice/awardwinners/profiles/ |
| site_logo |
16329 |
/fellowshipoffice/sitelogo/ |
| Footer |
16328 |
/fellowshipoffice/footer/ |
| social media |
198168 |
/fellowshipoffice/socialmedia/ |
| Assets |
206724 |
/fellowshipoffice/assets/ |
| Finance |
29925 |
/finance/ |
| site_logo |
30317 |
/finance/sitelogo/ |
| Footer |
30316 |
/finance/footer/ |
| modules-programming |
199341 |
/finance/modules-programming/ |
| About Us |
30557 |
/finance/about.shtml |
| Staff List |
29998 |
/finance/stafflist.shtml |
| Department Emails |
188769 |
/finance/departmentemails/ |
| Strategic Financial Planning Team (SFPT) |
181540 |
/finance/strategicfinancialplanningteamsfpt/ |
| Departments |
29929 |
/finance/departments.shtml |
| Accounts Payable |
29930 |
/finance/Accounts_Payable.shtml |
| Expenses for Recruiting, Relocation, Housing Assistance |
201967 |
/finance/expensesforrecruitingrelocationhousingassistance/ |
| Budgeting & Financial Analysis |
29932 |
/finance/budgetfinanalysis.shtml |
| right_column |
124673 |
/finance/rightcolumn/ |
| Campus Card |
199356 |
https://www.luc.edu/campuscard/ |
| Cash Management Services |
29935 |
/finance/casmgm.shtml |
| PCI Training |
29989 |
/finance/pci_training.shtml |
| POS Credit Card Terminal Inspection |
94742 |
/finance/poscreditcardterminalinspection/ |
| LUC Receivables via ACH, Wire and Checks |
146780 |
/secure/finance/lucreceivables/ |
| Procedures For Fraudulent Checks |
29993 |
/finance/fraudulentchecks.shtml |
| Controller's Office |
29936 |
/finance/controller.shtml |
| Fiscal Year-End Information |
146802 |
/finance/fiscalyear-endinformation/ |
| Debt Management |
29972 |
/finance/debtmgmt.shtml |
| Financial Systems |
185452 |
/finance/financialsystems/ |
| Internal Audit |
80279 |
/finance/internalaudit/ |
| Investment Office |
30005 |
/finance/investmentoffice.shtml |
| Office of the Bursar |
199357 |
https://www.luc.edu/bursar/ |
| Payroll Services |
30351 |
/finance/payroll.shtml |
| right_column |
107400 |
/finance/rightcolumn/ |
| Out of State Employees |
68246 |
/finance/outofstateemployees/ |
| Electronic W-2 Consent |
72912 |
/finance/w-2consent/ |
| Electronic W-2 Consent Disclosure Statement |
72913 |
/finance/w-2disclosure/ |
| Absence FAQs |
81601 |
/finance/absencefaqs/ |
| W-2 and Taxes FAQs |
81602 |
/finance/w-2andtaxesfaqs/ |
| Understanding Your W-2 |
107371 |
/finance/understandingyourw-2/ |
| Understanding Your Paystub |
153993 |
/finance/understandingyourpaystub/ |
| Year End Reminders |
157250 |
/finance/yearendreminders/ |
| Overpayments Collection |
192455 |
/finance/overpaymentscollection/ |
| Recovery of Payroll Overpayment |
192456 |
/finance/recoveryofpayrolloverpayment/ |
| Procurement Card Program |
29962 |
/finance/procard.shtml |
| Procurement Card Program Tutorial |
68740 |
/finance/procurementcardprogramtutorial/ |
| Procurement Card Training Schedule |
29963 |
/finance/procard_training.shtml |
| Contact Us |
193970 |
/finance/contactus/ |
| Purchasing |
199360 |
https://www.luc.edu/purchasing/ |
| Risk Management |
29996 |
/finance/riskmgmt.shtml |
| Sponsored Program Accounting |
199361 |
https://www.luc.edu/spa/ |
| Tax & Compliance |
69823 |
/finance/taxcompliance/ |
| Sales Tax and Other State and Local Use Tax Guidelines |
185977 |
/finance/taxcompliance/salestaxandotherstateandlocalusetaxguidelines/ |
| Tax Information for Student Financial Assistance / Awards |
69824 |
/finance/taxcompliance/taxinformationforstudentfinancialassistanceawards/ |
| Unrelated Business Income Tax (UBIT) |
188606 |
/finance/taxcompliance/unrelatedbusinessincometaxubit/ |
| Sprintax Calculus User Resources |
199312 |
/finance/taxcompliance/sprintaxcalculususerresources/ |
| Nonresident - Tax Season FAQ |
201608 |
/finance/taxcompliance/nonresident-taxseasonfaq/ |
| Travel Resources |
168239 |
/finance/travelresources/ |
| Treasurer's Office |
29940 |
/finance/Treasurersoffice.shtml |
| right_column |
124672 |
/finance/rightcolumn/ |
| Investor Information Disclaimer |
29954 |
/finance/disclaimer.shtml |
| Financial Applications |
29949 |
/finance/financialapps.shtml |
| Lawson Portal |
157057 |
https://lawson.luc.edu |
| UKG Ready Timecard |
157058 |
https://luc.edu/ukgready |
| Reporting Services |
202342 |
/finance/reportingservices/ |
| DocFinity |
157060 |
https://docfinity.luc.edu/ |
| Employee Self Service |
155360 |
https://ess.luc.edu |
| Egencia |
168467 |
http://luc.egencia.com/ |
| Visa Spend Clarity |
184721 |
https://enterprise.spendclarity.visa.com/ |
| Policies & Procedures |
29943 |
/finance/policies.shtml |
| Capital Expenditure Policy |
29967 |
/finance/capexppolicy.shtml |
| Procard Policy & Procedure Manual |
29946 |
/finance/procard_policy_and_procedure.shtml |
| Sponsored Program Accounting Policies |
199404 |
https://www.luc.edu/spa/policies.shtml |
| Travel & Business Expense Policy |
29948 |
/finance/expensepolicy.shtml |
| University Contract Policy |
30454 |
/purchasing/contractpolicy/index.shtml |
| Approving Requests in Excess of $5000 |
29941 |
/finance/approving_trans.shtml |
| Capital Asset Management Policy |
68190 |
/finance/capitalassetmanagementpolicy/ |
| Credit Card Policy |
29971 |
/finance/ccpolicy.shtml |
| EFT Policies and Procedures |
29979 |
/finance/eftpolicy/index.shtml |
| Endowment Spending Policy |
68189 |
/finance/endowmentspendingpolicy/ |
| FCPA Policy |
88637 |
/finance/fcpapolicy/ |
| FCPA FAQs |
88638 |
/finance/fcpafaqs/ |
| Federal Tax Exempt Status – 501(c)(3) |
188609 |
/finance/federaltaxexemptstatus501c3/ |
| Gift Card Policy |
70111 |
/finance/giftcardpolicy/ |
| Interest Rate Swap Policy |
68193 |
/finance/interestrateswappolicy/ |
| Joint Venture Policy |
95867 |
/finance/jointventurepolicy/ |
| Motor Vehicle Records and Vehicle Use Policy |
68192 |
/finance/motorvehiclepolicy/ |
| Nonresident Alien Compliance |
96255 |
/finance/nracompliance/ |
| Policy for Financial Records Retention |
56423 |
/finance/policyforfinancialrecordsretention/ |
| Policy for Petty Cash Funds |
29991 |
/finance/pettycash_policy.shtml |
| Policy on the Protection of Minors |
166085 |
/finance/policyontheprotectionofminors/ |
| Procedures for Paying Nonresident Alien (Non U.S. Citizen) Visitors/Contractors |
58293 |
/finance/Pmts_NonResAlien.shtml |
| Student Employment FICA Exemption Policy |
30003 |
/finance/student_fica.shtml |
| Tax-Exempt Bond Financing Compliance Policy |
68191 |
/finance/tax-exemptbondfinancingcompliancepolicy/ |
| Worker's Classification Procedure |
56802 |
/finance/workersclassificationprocedure/ |
| Investment Policy and Guidelines |
207016 |
/finance/investmentpolicyandguidelines/ |
| Debt Policy |
207082 |
/finance/debtpolicy/ |
| LUERP Investment Policy |
207088 |
/finance/luerpinvestmentpolicy/ |
| Resources |
29966 |
/finance/resources.html |
| Chart of Accounts |
29968 |
/finance/chartofaccounts.shtml |
| Rates |
29994 |
/finance/rates.shtml |
| Fringe Benefits Rates |
30007 |
/finance/fbrates.shtml |
| Mileage Reimbursement Rates |
29986 |
/finance/milereim.shtml |
| Per Diem Rates |
29944 |
/finance/perdiem.shtml |
| Investor Relations |
30361 |
/finance/disclaimer.shtml |
| Balance Sheet Accounts |
29926 |
/finance/balsheetaccounts.shtml |
| Investor Relations |
30419 |
/finance/investor_relations.shtml |
| Financial Statements |
29981 |
/finance/finst.shtml |
| GL Structure |
176923 |
/finance/glstructure/ |
| Documentation |
29974 |
/finance/fsdoc.shtml |
| Online Forms |
29988 |
/finance/forms.shtml |
| Accounts Payable |
35984 |
/finance/accountspayable/ |
| Electronic Payment Requisition FAQs |
160796 |
/finance/accountspayable/electronicpaymentrequisitionfaqs/ |
| AP Expense Transfer Form Instructions |
160122 |
/finance/accountspayable/apexpensetransferforminstructions/ |
| Check Requisition Instructions |
29928 |
/finance/checkreqinstr.shtml |
| Electronic W9/W8 Form Instructions |
121258 |
/finance/accountspayable/electronicw9w8forminstructions/ |
| Expense Reimbursement Form Instructions |
29942 |
/finance/expense_req_instr.shtml |
| Personal Purchase Reimbursement Instructions |
93322 |
/finance/accountspayable/personalpurchasereimbursementinstructions/ |
| Budget and Financial Planning |
35981 |
/finance/budgetandfinancialplanning/ |
| Permanent Budget Transfer Request Form Instructions |
29960 |
/finance/perm_instruct.shtml |
| Temporary Budget Transfer request Form Instructions |
30004 |
/finance/temp_instruct.shtml |
| General Accounting |
58328 |
/finance/generalaccounting/ |
| AU Type Info |
167761 |
/finance/generalaccounting/autypeinfo/ |
| Expense Transfer Form Instructions |
59709 |
/finance/generalaccounting/exptrans_instruct/index.shtml |
| New AU Request Form Instructions |
155332 |
/finance/generalaccounting/newaurequestforminstructions/ |
| Salary Transfer Instructions |
99356 |
/finance/generalaccounting/salarytransferinstructions/ |
| Standard Journal Entry Instructions |
59719 |
/finance/generalaccounting/sj_instruct/index.shtml |
| Year End Accrual Form Instructions |
103453 |
/finance/generalaccounting/yearendaccrualforminstructions/ |
| University Deposit Slip Instructions |
29927 |
/finance/deposit.shtml |
| Level Reorganization Form Instructions |
188905 |
/finance/generalaccounting/levelreorganizationforminstructions/ |
| SPA Forms |
59737 |
/finance/spaforms/ |
| Appropriation Amendment Instructions |
59738 |
/finance/spaforms/appropriationamendmentinstructions/ |
| Treasurer's Office |
35983 |
/finance/treasurersoffice/ |
| EFT Authorization For LUC to LUC Bank Account Instructions |
30599 |
/finance/lutolu_auth.shtml |
| EFT Database Authorization Instructions |
29976 |
/finance/eft_auth.shtml |
| EFT Database Requisition Instructions |
29977 |
/finance/eft_req.shtml |
| EFT Requisition For LUC to LUC Bank Account Instructions |
30600 |
/finance/lutolu_req.shtml |
| Non-Repetitive Wire Transfer Instructions |
29987 |
/finance/nonrepwt_inst.shtml |
| Repetitive Electronic Funds Transfer Requisition Instructions |
29995 |
/finance/repwt_inst.shtml |
| Setup/Change/Delete Repetitive EFT Authorization Instructions |
29997 |
/finance/setuprepwt_inst.shtml |
| Lawson Requisition Center vs Electronic Payment Requisition Application |
185925 |
/finance/lawsonrequisitioncentervselectronicpaymentrequisitionapplication/ |
| Purchase Requisition Instructions |
29965 |
/finance/purchreq_instruct.shtml |
| ProCard Expense Transfer Form Instructions |
188994 |
/finance/procardexpensetransferforminstructions/ |
| Finance SharePoints |
206996 |
/finance/financesharepoints/ |
| Obtaining Access |
188570 |
/finance/obtainingaccess/ |
| Transfers |
189044 |
/finance/transfers/ |
| Blog Media |
102407 |
/finance/blogmedia/ |
| News |
191342 |
/finance/news/ |
| Finance Town Halls 2026 |
191343 |
/finance/news/financetownhalls2026/ |
| Banking at Loyola |
12763 |
/banking/index.shtml |
| Financial Aid Office |
201085 |
/finaid/ |
| site_logo |
201154 |
/finaid/sitelogo/ |
| Footer |
201153 |
/finaid/footer/ |
| social media |
201346 |
/finaid/socialmedia/ |
| cta |
201347 |
/finaid/cta/ |
| The Aid Process |
201089 |
/finaid/aid-process/ |
| Step-by-Step Guide |
201090 |
/finaid/aid-process/guide/ |
| Student Responsibilities |
201095 |
/finaid/aid-process/responsibilities/ |
| Satisfactory Academic Progress |
201096 |
/finaid/aid-process/responsibilities/academic-progress/ |
| Verification |
201098 |
/finaid/aid-process/responsibilities/verification/ |
| Complete Withdrawal |
201097 |
/finaid/withdrawal.shtml |
| FAQs |
201092 |
/finaid/aid-process/faqs/ |
| Contact Us |
201094 |
/finaid/aid-process/contact/ |
| Español |
201099 |
/finaid/aid-process/espaol/ |
| Guia Paso-A-Paso |
201100 |
/finaid/aid-process/espaol/guiapaso-a-paso/ |
| Preguntas y Respuestas |
201101 |
/finaid/aid-process/espaol/preguntasyrespuestas/ |
| Scholarships |
201122 |
/finaid/scholarships/ |
| Undergraduate Scholarships |
201125 |
/finaid/scholarships/undergraduate/ |
| Scholarship Policy |
201126 |
/finaid/scholarships_renewal.shtml |
| The O’Brien Vrba Scholarship Trust |
201127 |
/finaid/scholarships/undergraduate/theobrienvrbascholarshiptrust/ |
| Transfer Student Scholarships |
201124 |
/finaid/scholarships/transfer/ |
| Graduate Student Scholarship |
201123 |
/finaid/scholarships/graduate/ |
| Adult & Continuing Ed Scholarships |
201129 |
/finaid/scholarships/continuing-education/ |
| Research Scholarships |
201130 |
/finaid/scholarships/research/ |
| Additional Scholarship Resources |
201128 |
/finaid/scholarships/external/ |
| Loyola Scholarship Connection |
201131 |
/finaid/scholarships/loyolascholarshipconnection/ |
| Grants |
201146 |
/finaid/grants/ |
| Loyola Grants |
201150 |
/finaid/grants/loyola-grants/ |
| Illinois Monetary Award Program (MAP) Grant |
201151 |
/finaid/grants/illinois-map-grants/ |
| Federal Pell Grant |
201148 |
/finaid/grants/pell/ |
| Federal Supplemental Educational Opportunity Grant |
201147 |
/finaid/grants/fseog/ |
| TEACH Grant |
201149 |
/finaid/grants/teach-grant/ |
| Mission Grants |
202707 |
/finaid/grants/missiongrants/ |
| Loans |
201132 |
/finaid/loans/ |
| Federal Direct Loans |
201135 |
/finaid/loans/stafford/ |
| Federal PLUS Loans |
201136 |
/finaid/loans/federal-plus/ |
| Federal Nursing Student Loans |
201138 |
/finaid/loans/federal-nursing/ |
| Mandel Short-term Loan |
201137 |
/finaid/mandel_loan.shtml |
| Private Loans |
201133 |
/finaid/loans/private/ |
| Alternative Loan Disclosures |
201134 |
/finaid/loans/private/disclosures/ |
| Loan Specifics |
201139 |
/finaid/loans/loan-specifics/ |
| Declining or Reducing a Loan |
201140 |
/finaid/loans/declining/ |
| Enrollment Requirements |
201145 |
/finaid/loans/enrollment/ |
| Entrance Counseling |
201143 |
/finaid/loans/entrance-counseling/ |
| Exit Counseling |
201141 |
/finaid/loans/exit-counseling/ |
| Promissory Notes |
201144 |
/finaid/loans/promissory-notes/ |
| Veterans/Military |
201155 |
/finaid/military/ |
| Veterans Administration Programs |
201159 |
/finaid/military/veterans/ |
| Using VA Benefits |
201160 |
/finaid/military/veterans/using-benefits/ |
| Veteran Grants & Scholarship |
201157 |
/finaid/military/veteran-scholarships.shtml |
| ROTC Scholarships |
201158 |
/finaid/military/rotc-scholarships/ |
| Military Grants |
201156 |
/finaid/scholarships_military.shtml |
| right_column |
201161 |
/finaid/military/rightcolumn/ |
| Resources |
201104 |
/finaid/resources/ |
| Forms |
201113 |
/finaid/forms/ |
| 2026-2027 Forms |
201116 |
/finaid/forms/2026-2027forms/ |
| 2025-2026 Forms |
201117 |
/finaid/forms/2025-2026forms/ |
| Student Employment |
201110 |
/finaid/resources/employment/ |
| Federal Work-Study |
201112 |
/finaid/resources/employment/work-study/ |
| Assistantships and Fellowships |
201111 |
/finaid/resources/employment/fellowships/ |
| Study Abroad |
201105 |
/finaid/resources/study-abroad/ |
| Summer Sessions |
201108 |
/finaid/resources/summer/ |
| Additional Resources |
201106 |
/finaid/resources/additional-resources/ |
| FACHEX and Tuition Exchange |
201107 |
/finaid/fachex/ |
| Registration Holds |
201109 |
/finaid/resources/registration/ |
| Consumer Information |
201119 |
/finaid/resources/consumerinformation/ |
| External Scholarship Processing |
201118 |
/finaid/resources/externalscholarshipprocessing/ |
| Inceptia (Verification Gateway) |
201120 |
/finaid/resources/inceptiaverificationgateway/ |
| One Big Beautiful Bill Act (OBBBA) |
205609 |
/finaid/resources/onebigbeautifulbillactobbba/ |
| Loan proration |
207225 |
/finaid/resources/onebigbeautifulbillactobbba/loanproration/ |
| Financial Wellness |
201302 |
/finaid/financialwellness/ |
| Financial Wellness Programming |
201305 |
/finaid/financialwellness/financialwellnessprogramming/ |
| Understanding Your Aid |
201306 |
/finaid/financialwellness/understandingyouraid/ |
| Emotions of Money |
201308 |
/finaid/financialwellness/emotionsofmoney/ |
| Banking Basics |
201307 |
/finaid/financialwellness/bankingbasics/ |
| Paychecks and Taxes |
201309 |
/finaid/financialwellness/paychecksandtaxes/ |
| Budgets and Spending Plans |
201311 |
/finaid/financialwellness/budgetsandspendingplans/ |
| Credit Scores |
201303 |
/finaid/financialwellness/creditscores/ |
| Student Loan Repayment |
201304 |
/finaid/financialwellness/studentloanrepayment/ |
| Government and Community Resources |
201310 |
/finaid/financialwellness/governmentandcommunityresources/ |
| Gainful Employment |
201246 |
/finaid/gainfulemployment/ |
| testHealthCareInformaticsCert |
201247 |
/finaid/gainfulemployment/testhealthcareinformaticscert/ |
| How to file to a Complaint with IBHE and HLC |
201248 |
/finaid/gainfulemployment/howtofiletoacomplaintwithibheandhlc/ |
| individual |
201249 |
/finaid/gainfulemployment/individual/ |
| scps |
201250 |
/finaid/gainfulemployment/individual/scps/ |
| Business Communication Certificate |
201251 |
/finaid/gainfulemployment/individual/scps/businesscommunicationcertificate/ |
| Computer Science Certificate |
201252 |
/finaid/gainfulemployment/individual/scps/computersciencecertificate/ |
| Graphic Design Certificate |
201253 |
/finaid/gainfulemployment/individual/scps/graphicdesigncertificate/ |
| Organizational Development Certificate |
201254 |
/finaid/gainfulemployment/individual/scps/organizationaldevelopmentcertificate/ |
| Litigation Practice Certificate |
201255 |
/finaid/gainfulemployment/individual/scps/litigationpracticecertificate/ |
| Corporate Practice Certificate |
201256 |
/finaid/gainfulemployment/individual/scps/corporatepracticecertificate/ |
| Litigation and Corporate Practice Certificate |
201257 |
/finaid/gainfulemployment/individual/scps/litigationandcorporatepracticecertificate/ |
| gradschool |
201258 |
/finaid/gainfulemployment/individual/gradschool/ |
| Post-Baccalaureate Certificate in Classical Studies |
201259 |
/finaid/gainfulemployment/individual/gradschool/post-baccalaureatecertificateinclassicalstudies/ |
| education |
201260 |
/finaid/gainfulemployment/individual/education/ |
| Leading Inclusive Catholic Schools Certificate |
201261 |
/finaid/gainfulemployment/individual/education/leadinginclusivecatholicschoolscertificate/ |
| School Counseling Endorsement |
201262 |
/finaid/gainfulemployment/individual/education/schoolcounselingendorsement/ |
| Reading Teacher Endorsement |
201263 |
/finaid/gainfulemployment/individual/education/readingteacherendorsement/ |
| English as a Second Language (ESL) Endorsement |
201264 |
/finaid/gainfulemployment/individual/education/englishasasecondlanguageeslendorsement/ |
| law |
201269 |
/finaid/gainfulemployment/individual/law/ |
| Trial Advocacy Certificate |
201270 |
/finaid/gainfulemployment/individual/law/trialadvocacycertificate/ |
| Child and Family Law Certificate |
201271 |
/finaid/gainfulemployment/individual/law/childandfamilylawcertificate/ |
| Health Law Certificate |
201272 |
/finaid/gainfulemployment/individual/law/healthlawcertificate/ |
| Public Interest Certificate |
201274 |
/finaid/gainfulemployment/individual/law/publicinterestcertificate/ |
| Tax Law Certificate |
201275 |
/finaid/gainfulemployment/individual/law/taxlawcertificate/ |
| quinlan |
201276 |
/finaid/gainfulemployment/individual/quinlan/ |
| Business Data Analytics Certificate |
201277 |
/finaid/gainfulemployment/individual/quinlan/businessdataanalyticscertificate/ |
| Business Ethics Certificate |
201278 |
/finaid/gainfulemployment/individual/quinlan/businessethicscertificate/ |
| Information Systems Certificate |
201279 |
/finaid/gainfulemployment/individual/quinlan/informationsystemscertificate/ |
| Business Intelligence and Data Warehousing Certificate |
201280 |
/finaid/gainfulemployment/individual/quinlan/businessintelligenceanddatawarehousingcertificate/ |
| nursing |
201281 |
/finaid/gainfulemployment/individual/nursing/ |
| Oncology Nursing Certificate |
201282 |
/finaid/gainfulemployment/individual/nursing/oncologynursingcertificate/ |
| Health Care Informatics Certificate |
201283 |
/finaid/gainfulemployment/individual/nursing/healthcareinformaticscertificate/ |
| Outcomes Performance Management Certificate |
201284 |
/finaid/gainfulemployment/individual/nursing/outcomesperformancemanagementcertificate/ |
| Family Nurse Practitioner Certificate |
201285 |
/finaid/gainfulemployment/individual/nursing/familynursepractitionercertificate/ |
| Family Nurse Practitioner with Emergency Subspecialty |
201286 |
/finaid/gainfulemployment/individual/nursing/familynursepractitionerwithemergencysubspecialty/ |
| Adult Gerontology Clinical Nurse Specialist with Oncology Specialty |
201287 |
/finaid/gainfulemployment/individual/nursing/adultgerontologyclinicalnursespecialistwithoncologyspecialty/ |
| Women's Health Nurse Practitioner |
201288 |
/finaid/gainfulemployment/individual/nursing/womenshealthnursepractitioner/ |
| ips |
201289 |
/finaid/gainfulemployment/individual/ips/ |
| Pastoral Counseling Certificate |
201290 |
/finaid/gainfulemployment/individual/ips/pastoralcounselingcertificate/ |
| Religious Education Certificate |
201291 |
/finaid/gainfulemployment/individual/ips/religiouseducationcertificate/ |
| Social Justice Certificate |
201292 |
/finaid/gainfulemployment/individual/ips/socialjusticecertificate/ |
| Spiritual Direction Certificate |
201293 |
/finaid/gainfulemployment/individual/ips/spiritualdirectioncertificate/ |
| stritch |
201294 |
/finaid/gainfulemployment/individual/stritch/ |
| Certificate in Public Health |
201295 |
/finaid/gainfulemployment/individual/stritch/certificateinpublichealth/ |
| PDFs - For Internal Use Only |
201296 |
/finaid/pdfs-forinternaluseonly/index.shtml |
| Bar Exam Expenses |
201102 |
/finaid/barexamfinancialaid.shtml |
| ABSN Program |
201086 |
/finaid/absn_programs.shtml |
| ABSN Program: August Cohort |
201087 |
/finaid/specialprograms_absn.shtml |
| ABSN Program: January cohort |
201088 |
/finaid/specialprograms_absn1.shtml |
| RN to BSN Online Program Financial Aid |
201121 |
/finaid/rntobsnfinancialaid.shtml |
| Constitution Day |
201103 |
/finaid/Constitution_Day.shtml |
| First and Second Year Advising |
180151 |
/fsya/index.shtml |
| site_logo |
180152 |
/fsya/sitelogo/ |
| Footer |
180153 |
/fsya/footer/ |
| cta |
180587 |
/fsya/cta/ |
| social media |
180154 |
/fsya/socialmedia/ |
| modules-programming |
180155 |
/fsya/modules-programming/ |
| About Us |
180156 |
/fsya/aboutus/ |
| Meet our Team |
180169 |
/fsya/aboutus/meetourteam/ |
| Profiles |
180205 |
/fsya/aboutus/meetourteam/profiles/ |
| Contact Us |
180170 |
/fsya/aboutus/contactinformation/ |
| Our Values |
180171 |
/fsya/aboutus/ourvalues/ |
| Current Students |
180157 |
/fsya/currentstudents/ |
| Academic Planning |
180173 |
/fsya/currentstudents/academicplanning/ |
| Academic Planning Workshops |
204520 |
/fsya/currentstudents/academicplanning/academicplanningworkshops/ |
| Academic Forms |
180174 |
/fsya/currentstudents/academicforms/ |
| Registration Guide |
206717 |
/fsya/currentstudents/registrationguide/ |
| Express Advising |
204793 |
/fsya/currentstudents/expressadvising/ |
| Academic Policies |
180175 |
/fsya/currentstudents/academicpolicies/ |
| Resources |
180176 |
/fsya/currentstudents/resources/ |
| Sample Hidden Page |
202767 |
/fsya/currentstudents/samplehiddenpage/ |
| Incoming Students |
180158 |
/fsya/incomingstudents/ |
| Welcome From FSYA |
202053 |
/fsya/incomingstudents/welcomefromfsya/ |
| Important Dates & Communications |
202051 |
/fsya/incomingstudents/importantdatescommunications/ |
| Fall Class Registration Recommendations |
201985 |
/fsya/incomingstudents/fallclassregistrationrecommendations/ |
| College of Arts and Sciences |
201986 |
/fsya/incomingstudents/fall2025registrationrecommendations/collegeofartsandsciences/ |
| African Studies and the African Diaspora (BA) |
202054 |
/fsya/incomingstudents/fall2025registrationrecommendations/collegeofartsandsciences/africanstudiesandtheafricandiasporaba/ |
| Anthropology (BA & BS) |
202055 |
/fsya/incomingstudents/fall2025registrationrecommendations/collegeofartsandsciences/anthropologybabs/ |
| Applied Mathematics (BS) |
202058 |
/fsya/incomingstudents/fall2025registrationrecommendations/collegeofartsandsciences/appliedmathematicsbs/ |
| Art History (BA) |
202059 |
/fsya/incomingstudents/fall2025registrationrecommendations/collegeofartsandsciences/arthistoryba/ |
| Biochemistry (BA or BS) |
202099 |
/fsya/incomingstudents/fall2025registrationrecommendations/collegeofartsandsciences/biochemistrybaorbs/ |
| Bioinformatics (BS) |
202100 |
/fsya/incomingstudents/fall2025registrationrecommendations/collegeofartsandsciences/bioinformaticsbs/ |
| Biology (BS) |
202101 |
/fsya/incomingstudents/fall2025registrationrecommendations/collegeofartsandsciences/biologybs/ |
| Biophysics (BS) |
202102 |
/fsya/incomingstudents/fall2025registrationrecommendations/collegeofartsandsciences/biophysicsbs/ |
| Chemistry (BA or BS) |
202103 |
/fsya/incomingstudents/fall2025registrationrecommendations/collegeofartsandsciences/chemistrybaorbs/ |
| Classical Civilization (BA) |
202104 |
/fsya/incomingstudents/fall2025registrationrecommendations/collegeofartsandsciences/classicalcivilizationba/ |
| Computer Science (BS) |
202105 |
/fsya/incomingstudents/fall2025registrationrecommendations/collegeofartsandsciences/computersciencebs/ |
| Criminal Justice & Criminology (BS) |
202106 |
/fsya/incomingstudents/fall2025registrationrecommendations/collegeofartsandsciences/criminaljusticecriminologybs/ |
| Cybersecurity (BS) |
202107 |
/fsya/incomingstudents/fall2025registrationrecommendations/collegeofartsandsciences/cybersecuritybs/ |
| Dance (BA) |
202108 |
/fsya/incomingstudents/fall2025registrationrecommendations/collegeofartsandsciences/danceba/ |
| Data Science (BS) |
202110 |
/fsya/incomingstudents/fall2025registrationrecommendations/collegeofartsandsciences/datasciencebs/ |
| Economics (BA) |
202111 |
/fsya/incomingstudents/fall2025registrationrecommendations/collegeofartsandsciences/economicsba/ |
| Engineering Science (BS) |
202112 |
/fsya/incomingstudents/fall2025registrationrecommendations/collegeofartsandsciences/engineeringsciencebs/ |
| English (BA) |
202113 |
/fsya/incomingstudents/fall2025registrationrecommendations/collegeofartsandsciences/englishba/ |
| Forensic Science (BS) |
202115 |
/fsya/incomingstudents/fall2025registrationrecommendations/collegeofartsandsciences/forensicsciencebs/ |
| French (BA) |
202116 |
/fsya/incomingstudents/fall2025registrationrecommendations/collegeofartsandsciences/frenchba/ |
| Global Studies (BA) |
202117 |
/fsya/incomingstudents/fall2025registrationrecommendations/collegeofartsandsciences/globalstudiesba/ |
| Greek (BA) |
202118 |
/fsya/incomingstudents/fall2025registrationrecommendations/collegeofartsandsciences/greekba/ |
| History (BA) |
202120 |
/fsya/incomingstudents/fall2025registrationrecommendations/collegeofartsandsciences/historyba/ |
| Information Technology (BS) |
202123 |
/fsya/incomingstudents/fall2025registrationrecommendations/collegeofartsandsciences/informationtechnologybs/ |
| Italian (BA) |
202124 |
/fsya/incomingstudents/fall2025registrationrecommendations/collegeofartsandsciences/italianba/ |
| Latin (BA) |
202126 |
/fsya/incomingstudents/fall2025registrationrecommendations/collegeofartsandsciences/latinba/ |
| Mathematics (BS) |
202127 |
/fsya/incomingstudents/fall2025registrationrecommendations/collegeofartsandsciences/mathematicsbs/ |
| Mathematics & Computer Science (BS) |
202128 |
/fsya/incomingstudents/fall2025registrationrecommendations/collegeofartsandsciences/mathematicscomputersciencebs/ |
| Music (BA) |
202129 |
/fsya/incomingstudents/fall2025registrationrecommendations/collegeofartsandsciences/musicba/ |
| Neuroscience (BS) |
202130 |
/fsya/incomingstudents/fall2025registrationrecommendations/collegeofartsandsciences/neurosciencebs/ |
| Philosophy (BA) |
202131 |
/fsya/incomingstudents/fall2025registrationrecommendations/collegeofartsandsciences/philosophyba/ |
| Physics (BS) |
202132 |
/fsya/incomingstudents/fall2025registrationrecommendations/collegeofartsandsciences/physicsbs/ |
| Physics with Computer Science (BS) |
202133 |
/fsya/incomingstudents/fall2025registrationrecommendations/collegeofartsandsciences/physicswithcomputersciencebs/ |
| Physics & Engineering Dual Degree (BS) |
202134 |
/fsya/incomingstudents/fall2025registrationrecommendations/collegeofartsandsciences/physicsengineeringdualdegreebs/ |
| Political Science (BA) |
202135 |
/fsya/incomingstudents/fall2025registrationrecommendations/collegeofartsandsciences/politicalscienceba/ |
| Psychology (BS) |
202137 |
/fsya/incomingstudents/fall2025registrationrecommendations/collegeofartsandsciences/psychologybs/ |
| Religious Studies (BA) |
202138 |
/fsya/incomingstudents/fall2025registrationrecommendations/collegeofartsandsciences/religiousstudiesba/ |
| Sociology (BA) |
202139 |
/fsya/incomingstudents/fall2025registrationrecommendations/collegeofartsandsciences/sociologyba/ |
| Sociology & Anthropology (BA) |
202140 |
/fsya/incomingstudents/fall2025registrationrecommendations/collegeofartsandsciences/sociologyanthropologyba/ |
| Software Engineering (BS) |
202141 |
/fsya/incomingstudents/fall2025registrationrecommendations/collegeofartsandsciences/softwareengineeringbs/ |
| Spanish (BA) |
202142 |
/fsya/incomingstudents/fall2025registrationrecommendations/collegeofartsandsciences/spanishba/ |
| Statistics (BS) |
202143 |
/fsya/incomingstudents/fall2025registrationrecommendations/collegeofartsandsciences/statisticsbs/ |
| Studio Art: Drawing, Painting, and Printmaking (BA) |
202144 |
/fsya/incomingstudents/fall2025registrationrecommendations/collegeofartsandsciences/studioartdrawingpaintingandprintmakingba/ |
| Studio Art: Photography and Video Art (BA) |
202145 |
/fsya/incomingstudents/fall2025registrationrecommendations/collegeofartsandsciences/studioartphotographyandvideoartba/ |
| Studio Art: Sculpture and Ceramics (BA) |
202146 |
/fsya/incomingstudents/fall2025registrationrecommendations/collegeofartsandsciences/studioartsculptureandceramicsba/ |
| Theatre (BA) |
202147 |
/fsya/incomingstudents/fall2025registrationrecommendations/collegeofartsandsciences/theatreba/ |
| Theology (BA) |
202148 |
/fsya/incomingstudents/fall2025registrationrecommendations/collegeofartsandsciences/theologyba/ |
| Theoretical Physics and Applied Mathematics (TPAM) (BS) |
202150 |
/fsya/incomingstudents/fall2025registrationrecommendations/collegeofartsandsciences/theoreticalphysicsandappliedmathematicstpambs/ |
| Undecided |
202151 |
/fsya/incomingstudents/fall2025registrationrecommendations/collegeofartsandsciences/undecided/ |
| Visual Communication (BA) |
202057 |
/fsya/incomingstudents/fall2025registrationrecommendations/collegeofartsandsciences/visualcommunicationba/ |
| Women's Studies and Gender Studies (BA) |
202056 |
/fsya/incomingstudents/fall2025registrationrecommendations/collegeofartsandsciences/womensstudiesandgenderstudiesba/ |
| Marcella Niehoff School of Nursing |
201996 |
/fsya/incomingstudents/fallclassregistrationrecommendations/marcellaniehoffschoolofnursing/ |
| Nursing (BSN) |
201998 |
/fsya/incomingstudents/fallclassregistrationrecommendations/marcellaniehoffschoolofnursing/nursingbsn/ |
| Parkinson School of Health Sciences and Public Health |
201995 |
/fsya/incomingstudents/fallclassregistrationrecommendations/parkinsonschoolofhealthsciencesandpublichealth/ |
| Exercise Science (BS) |
202000 |
/fsya/incomingstudents/fallclassregistrationrecommendations/parkinsonschoolofhealthsciencesandpublichealth/exercisesciencebs/ |
| Healthcare Administration (BS) |
202001 |
/fsya/incomingstudents/fallclassregistrationrecommendations/parkinsonschoolofhealthsciencesandpublichealth/healthcareadministrationbs/ |
| Public Health (BA) |
203190 |
/fsya/incomingstudents/fallclassregistrationrecommendations/parkinsonschoolofhealthsciencesandpublichealth/publichealthba/ |
| Public Health (BS) |
201999 |
/fsya/incomingstudents/fallclassregistrationrecommendations/parkinsonschoolofhealthsciencesandpublichealth/publichealthbs/ |
| Quinlan School of Business |
201990 |
/fsya/incomingstudents/fall2025registrationrecommendations/quinlanschoolofbusiness/ |
| Accounting (BBA) |
202002 |
/fsya/incomingstudents/fall2025registrationrecommendations/quinlanschoolofbusiness/accountingbba/ |
| Accounting and Analytics (BBA) |
202003 |
/fsya/incomingstudents/fall2025registrationrecommendations/quinlanschoolofbusiness/accountingandanalyticsbba/ |
| Economics (BBA) |
202004 |
/fsya/incomingstudents/fall2025registrationrecommendations/quinlanschoolofbusiness/economicsbba/ |
| Entrepreneurship (BBA) |
202005 |
/fsya/incomingstudents/fall2025registrationrecommendations/quinlanschoolofbusiness/entrepreneurshipbba/ |
| Finance (BBA) |
202006 |
/fsya/incomingstudents/fall2025registrationrecommendations/quinlanschoolofbusiness/financebba/ |
| Human Resource Management (BBA) |
202007 |
/fsya/incomingstudents/fall2025registrationrecommendations/quinlanschoolofbusiness/humanresourcemanagementbba/ |
| Information Systems and Analytics (BBA) |
202008 |
/fsya/incomingstudents/fall2025registrationrecommendations/quinlanschoolofbusiness/informationsystemsandanalyticsbba/ |
| International Business (BBA) |
202009 |
/fsya/incomingstudents/fall2025registrationrecommendations/quinlanschoolofbusiness/internationalbusinessbba/ |
| Management (BBA) |
202010 |
/fsya/incomingstudents/fall2025registrationrecommendations/quinlanschoolofbusiness/managementbba/ |
| Marketing (BBA) |
202011 |
/fsya/incomingstudents/fall2025registrationrecommendations/quinlanschoolofbusiness/marketingbba/ |
| Sport Management (BBA) |
202013 |
/fsya/incomingstudents/fall2025registrationrecommendations/quinlanschoolofbusiness/sportmanagementbba/ |
| Supply Chain Management (BBA) |
202014 |
/fsya/incomingstudents/fall2025registrationrecommendations/quinlanschoolofbusiness/supplychainmanagementbba/ |
| Undecided Business (BBA) |
202012 |
/fsya/incomingstudents/fall2025registrationrecommendations/quinlanschoolofbusiness/undecidedbusinessbba/ |
| U.S. (BBA) / Europe Double Degree |
202015 |
/fsya/incomingstudents/fall2025registrationrecommendations/quinlanschoolofbusiness/usbbaeuropedoubledegree/ |
| School of Communication |
201987 |
/fsya/incomingstudents/fall2025registrationrecommendations/schoolofcommunication/ |
| Advertising Creative (BA) |
202016 |
/fsya/incomingstudents/fall2025registrationrecommendations/schoolofcommunication/advertisingcreativeba/ |
| Advertising and Public Relations (BA) |
202017 |
/fsya/incomingstudents/fall2025registrationrecommendations/schoolofcommunication/advertisingandpublicrelationsba/ |
| Advocacy and Social Change (BA) |
202019 |
/fsya/incomingstudents/fall2025registrationrecommendations/schoolofcommunication/advocacyandsocialchangeba/ |
| Communication Studies (BA) |
202018 |
/fsya/incomingstudents/fall2025registrationrecommendations/schoolofcommunication/communicationstudiesba/ |
| Film and Digital Media (BA) |
202020 |
/fsya/incomingstudents/fall2025registrationrecommendations/schoolofcommunication/filmanddigitalmediaba/ |
| Multimedia Journalism (BA) |
202021 |
/fsya/incomingstudents/fall2025registrationrecommendations/schoolofcommunication/multimediajournalismba/ |
| School of Environmental Sustainability |
201991 |
/fsya/incomingstudents/fall2025registrationrecommendations/schoolofenvironmentalsustainability/ |
| Environmental Economics and Sustainability (BA) |
202024 |
/fsya/incomingstudents/fall2025registrationrecommendations/schoolofenvironmentalsustainability/environmentaleconomicsandsustainabilityba/ |
| Environmental Policy (BA) |
202022 |
/fsya/incomingstudents/fall2025registrationrecommendations/schoolofenvironmentalsustainability/environmentalpolicyba/ |
| Environmental Science (BS) |
202025 |
/fsya/incomingstudents/fall2025registrationrecommendations/schoolofenvironmentalsustainability/environmentalsciencebs/ |
| Environmental Science: Climate and Energy (BS) |
203078 |
/fsya/incomingstudents/fall2025registrationrecommendations/schoolofenvironmentalsustainability/environmentalscienceclimateandenergybs/ |
| Environmental Studies (BA) |
202023 |
/fsya/incomingstudents/fall2025registrationrecommendations/schoolofenvironmentalsustainability/environmentalstudiesba/ |
| School of Education |
201988 |
/fsya/incomingstudents/fall2025registrationrecommendations/schoolofeducation/ |
| Early Childhood Special Education (BSEd) |
202027 |
/fsya/incomingstudents/fall2025registrationrecommendations/schoolofeducation/earlychildhoodspecialeducationbsed/ |
| Elementary Education (BSEd) |
202028 |
/fsya/incomingstudents/fall2025registrationrecommendations/schoolofeducation/elementaryeducationbsed/ |
| Middle Grades Education (BSEd) |
202030 |
/fsya/incomingstudents/fallclassregistrationrecommendations/schoolofeducation/middlegradeseducationbsed/ |
| Secondary Education: Biology (BSEd) |
202032 |
/fsya/incomingstudents/fallclassregistrationrecommendations/schoolofeducation/secondaryeducationbiologybsed/ |
| Secondary Education: English (BSEd) |
202033 |
/fsya/incomingstudents/fall2025registrationrecommendations/schoolofeducation/secondaryeducationenglishbsed/ |
| Secondary Education: History (BSEd) |
202034 |
/fsya/incomingstudents/fall2025registrationrecommendations/schoolofeducation/secondaryeducationhistorybsed/ |
| Secondary Education: Math (BSEd) |
202035 |
/fsya/incomingstudents/fall2025registrationrecommendations/schoolofeducation/secondaryeducationmathbsed/ |
| Secondary Education: Physics (BSEd) |
202036 |
/fsya/incomingstudents/fallclassregistrationrecommendations/schoolofeducation/secondaryeducationphysicsbsed/ |
| Secondary Education: Political Science (BSEd) |
202037 |
/fsya/incomingstudents/fall2025registrationrecommendations/schoolofeducation/secondaryeducationpoliticalsciencebsed/ |
| Secondary Education (BSEd) with Psychology Minor |
202038 |
/fsya/incomingstudents/fallclassregistrationrecommendations/schoolofeducation/secondaryeducationbsedwithpsychologyminor/ |
| Special Education (BSEd) |
202039 |
/fsya/incomingstudents/fall2025registrationrecommendations/schoolofeducation/specialeducationbsed/ |
| School of Social Work |
201989 |
/fsya/incomingstudents/fall2025registrationrecommendations/schoolofsocialwork/ |
| Social Work (BSW) |
201997 |
/fsya/incomingstudents/fall2025registrationrecommendations/schoolofsocialwork/socialworkbsw/ |
| SOAR Leaders |
202755 |
/fsya/incomingstudents/soarleaders/ |
| Graduation Requirements |
202166 |
/fsya/incomingstudents/graduationrequirements/ |
| Developing Your Academic Plan |
202171 |
/fsya/incomingstudents/developingyouracademicplan/ |
| Advising and Technology Videos |
202756 |
/fsya/incomingstudents/advisingandtechnologyvideos/ |
| LOCUS Tips and Tricks |
202168 |
/fsya/incomingstudents/locustipsandtricks/ |
| Explanation of Common Terms |
202335 |
/fsya/incomingstudents/explanationofcommonterms/ |
| Frequently Asked Questions |
202336 |
/fsya/incomingstudents/frequentlyaskedquestions/ |
| Schedule Change Request |
202752 |
/fsya/incomingstudents/schedulechangerequest/ |
| right_column |
180733 |
/fsya/rightcolumn/ |
| Prospective & Admitted Students |
184211 |
/fsya/prospectiveadmittedstudents/ |
| Student Academic Services |
202631 |
/fsya/studentacademicservices/ |
| New Student Programs |
202633 |
https://www.luc.edu/nsp/ |
| Scholars Programs |
202635 |
https://www.luc.edu/scholarsprograms/ |
| Student Accessibility Center |
202634 |
https://www.luc.edu/sac/ |
| Student-Athlete Academic Services |
202636 |
https://www.luc.edu/athleteadvising |
| Tutoring Center |
202632 |
https://www.luc.edu/tutoring |
| Focus on Teaching and Learning |
43044 |
/fotl/index.shtml |
| Past FOTL Resources |
4041 |
/fotl/pastfotlresources/ |
| January 2026 Resources |
207163 |
/fotl/pastfotlresources/january2026resources/ |
| August 2025 FOTL Resources |
205756 |
/fotl/pastfotlresources/august2025fotlresources/ |
| January 2025 FOTL Resources |
200413 |
/fotl/pastfotlresources/january2025fotlresources/ |
| August 2024 FOTL Resources |
197945 |
/fotl/pastfotlresources/august2024fotlresources/ |
| January 2024 FOTL Resources |
191338 |
/fotl/pastfotlresources/january2024fotlresources/ |
| August 2023 FOTL Resources |
188232 |
/fotl/pastfotlresources/august2023fotlresources/ |
| January 2023 FOTL Resources |
182447 |
/fotl/pastfotlresources/january2023fotlresources/ |
| August 2022 FOTL Resources |
180038 |
/fotl/pastfotlresources/august2022fotlresources/ |
| January 2022 FOTL Resources |
167712 |
/fotl/pastfotlresources/january2022fotlresources/ |
| Focus on Teaching and Learning: August 2018 |
116946 |
/fotl/pastfotlresources/focusonteachingandlearningaugust2018/ |
| Focus on Teaching and Learning: Spring 2018 |
109516 |
/fotl/pastfotlresources/focusonteachingandlearningspring2018/ |
| Focus on Teaching and Learning: Spring 2017 |
102416 |
/fotl/pastfotlresources/focusonteachingandlearningspring2017/ |
| Focus on Teaching and Learning: Fall 2017 |
105943 |
/fotl/pastfotlresources/focusonteachingandlearningfall2017/ |
| Focus on Teaching and Learning: Spring 2016 |
93296 |
/fotl/pastfotlresources/focusonteachinglearningjanuary2016/ |
| Focus on Teaching and Learning: Fall 2016 |
93295 |
/fotl/pastfotlresources/focusonteachinglearningaugust2016/ |
| Focus on Teaching and Learning: Spring 2015 |
80264 |
/fotl/pastfotlresources/focusonteachingandlearningspring2015/ |
| Focus on Teaching and Learning: Fall 2015 |
88440 |
/fotl/pastfotlresources/focusonteachingandlearningfall2015/ |
| Focus on Teaching and Learning: Spring 2014 |
66545 |
/fotl/pastfotlresources/focusonteachingandlearningspring2014/ |
| Focus on Teaching and Learning: Fall 2014 |
72222 |
/fotl/pastfotlresources/focusonteachingandlearningfall2014/ |
| Focus on Teaching and Learning Fall 2013 |
62929 |
/fotl/pastfotlresources/focusonteachingandlearningfall2013/ |
| Focus on Teaching and Learning: Spring 2012 |
9045 |
/fotl/pastfotlresources/focusonteachingandlearningspring2012/ |
| Focus on Teaching and Learning: Fall 2012 |
19557 |
/fotl/pastfotlresources/focusonteachingandlearningfall2012/ |
| Focus on Teaching: Spring 2011 |
4045 |
/fotl/pastfotlresources/focusonteachingspring2011/ |
| Focus on Teaching: Spring 2010 |
4043 |
/fotl/pastfotlresources/focusonteachingspring2010/ |
| Focus on Teaching: Fall 2010 |
4044 |
/fotl/pastfotlresources/focusonteachingfall2010/ |
| Focus on Teaching: Fall 2009 |
4042 |
/fotl/pastfotlresources/focusonteachingfall2009/ |
| archive |
52519 |
/fotl/archive/ |
| Campus Partners |
99061 |
/fotl/campuspartners/ |
| August 2024 Keynote Speaker Information |
99746 |
/fotl/august2024keynotespeakerinformation/ |
| FOTL Gallery |
107686 |
/fotl/fotlgallery/ |
| Photo Archive |
127206 |
/fotl/photoarchive/ |
| Footer |
199772 |
/fotl/footer/ |
| site_logo |
199773 |
/fotl/sitelogo/ |
| social media |
199776 |
/fotl/socialmedia/ |
| Infographics |
199795 |
/fotl/infographics/ |
| Forensic Science |
22693 |
/forensicscience/index.shtml |
| Crime Scene - Forensics |
109375 |
/features/stories/academics/crimescene-forensics/ |
| assets |
109537 |
/features/stories/academics/crimescene-forensics/assets/ |
| Faculty |
22685 |
/forensicscience/faculty.shtml |
| Profiles |
199639 |
/forensicscience/profiles/ |
| right_column |
87352 |
/forensicscience/rightcolumn/ |
| Academics |
22687 |
/forensicscience/academics.shtml |
| BS in Forensic Science |
22688 |
/forensicscience/bs.shtml |
| Minor in Computer Crime and Forensics |
22689 |
/forensicscience/minor.shtml |
| right_column |
87355 |
/forensicscience/rightcolumn/ |
| Admission |
22691 |
/forensicscience/admission.shtml |
| Request Information |
22692 |
/forensicscience/requestinformation.html |
| Financial Aid |
23443 |
/forensicscience/finaid.html |
| Tuition |
23444 |
/forensicscience/tuition.html |
| Undergraduate Admission |
23445 |
/forensicscience/undergrad.html |
| Transfer Students |
76972 |
/forensicscience/transferstudents/ |
| right_column |
87356 |
/forensicscience/rightcolumn/ |
| Resources |
22694 |
/forensicscience/activities.shtml |
| Careers |
22695 |
/forensicscience/careers.shtml |
| Facilities |
22696 |
/forensicscience/facilities.shtml |
| Program Statistics |
22697 |
/forensicscience/programstats.shtml |
| Student Activities |
22698 |
/forensicscience/studentactivities/ |
| Upcoming Seminars |
92149 |
/forensicscience/upcomingseminars/ |
| Archived Seminars |
99111 |
/forensicscience/archivedseminars/ |
| right_column |
87357 |
/forensicscience/rightcolumn/ |
| site_logo |
22703 |
/forensicscience/sitelogo/ |
| Footer |
22699 |
/forensicscience/footer/ |
| News and Events |
179704 |
/forensicscience/newsandevents/ |
| archive |
200937 |
/forensicscience/newsandevents/archive/ |
| social media |
199573 |
/forensicscience/socialmedia/ |
| cta |
199574 |
/forensicscience/cta/ |
| modules-programming |
199575 |
/forensicscience/modules-programming/ |
| Forms |
31444 |
/forms/index.shtml |
| JFRC Scholarship Recipient Biography Form |
31445 |
/forms/jfrc_scholarship.shtml |
| Office of Research Services and Corporate & Foundation Relations |
31446 |
/forms/ltdsubcomp_form.shtml |
| Student Scholarship Biography |
31447 |
/forms/student_scholarship.shtml |
| Thank You |
31450 |
/forms/thankyou.shtml |
| Footer |
31461 |
/forms/footer/ |
| site_logo |
31462 |
/forms/sitelogo/ |
| Internship Course Enrollment Request |
78337 |
/forms/internshipcourseenrollment/index.shtml |
| Thank You |
78392 |
/forms/internshipcourseenrollment/thankyou.shtml |
| Gannon Center for Women and Leadership |
15792 |
/gannon/ |
| site_logo |
199713 |
/gannon/sitelogo/ |
| Footer |
15905 |
/gannon/footer/ |
| I Links |
199716 |
/gannon/ilinks/ |
| social media |
199717 |
/gannon/socialmedia/ |
| modules-programming |
199718 |
/gannon/modules-programming/ |
| About Us |
15793 |
/gannon/about.shtml |
| Our Mission |
15798 |
/gannon/mission.shtml |
| Message from the Director |
15796 |
/gannon/welcome.shtml |
| Staff |
203158 |
/gannon/staff.php |
| profiles |
203160 |
/gannon/staff/profiles/ |
| History of Mundelein College |
94985 |
/gannon/historyofmundeleincollege/ |
| Piper Hall: Past and Present |
60821 |
/gannon/piperhallpastandpresent/ |
| Highlights of the Restored Piper Hall |
203157 |
/gannon/piperhallpastandpresent/highlightsoftherestoredpiperhall/ |
| Contact Us |
15795 |
/gannon/hours.shtml |
| The Passing of Ann Ida Gannon, BVM |
110904 |
/gannon/thepassingofannidagannonbvm/ |
| Farrell Professorship |
70257 |
/gannon/farrellprofessorship/ |
| Farrell Assistant Professor - Dr. Paula Skye Tallman |
199629 |
/gannon/farrellprofessorship/farrellassistantprofessor-drpaulaskyetallman/ |
| Women and Leadership Archives |
206355 |
https://www.luc.edu/wla/ |
| Programs |
15833 |
/gannon/programs.shtml |
| Gannon Scholars |
15836 |
/gannon/gslp.shtml |
| Gannon Scholar Application |
95113 |
/gannon/gannonscholarapplication/ |
| Program Expectations |
95115 |
/gannon/programexpectations/ |
| Gannon Scholar Research |
157254 |
/gannon/gannonscholarresearch/ |
| Impact of the Gannon Scholars Program |
157412 |
/gannon/impactofthegannonscholarsprogram/ |
| FAQs |
15812 |
/gannon/faqs/ |
| Current Gannon Scholars |
199759 |
/gannon/currentgannonscholars/ |
| Profiles |
199760 |
/gannon/currentgannonscholars/profiles/ |
| Featured Current Student |
204221 |
/gannon/featuredcurrentstudent/ |
| Gannon Graduate Leaders |
191315 |
/gannon/gannongraduateleaders/ |
| Past GGL Leadership Profiles |
195747 |
/gannon/gannongraduateleaders/pastgglleadershipprofiles/ |
| Impact of the GGL program |
197087 |
/gannon/gannongraduateleaders/impactofthegglprogram/ |
| About GGL Coordinator Dr. Paula Skye Tallman |
197088 |
/gannon/gannongraduateleaders/aboutgglcoordinatordrpaulaskyetallman/ |
| FAQs |
197089 |
/gannon/gannongraduateleaders/faqs/ |
| Current GGL Scholars |
199761 |
/gannon/gannongraduateleaders/currentgglscholars/ |
| Profiles |
199762 |
/gannon/gannongraduateleaders/currentgglscholars/profiles/ |
| Program Details and How to Apply |
203966 |
/gannon/gannongraduateleaders/programdetailsandhowtoapply/ |
| Gannon Faculty Fellows |
15835 |
/gannon/fellows.shtml |
| Faculty Fellows |
15817 |
/gannon/facultyfellows/ |
| Faculty Fellow Application |
98663 |
/gannon/facultyfellowapplication/ |
| Johnson Scholars |
15839 |
/gannon/Johnson_Scholarship.shtml |
| Johnson Scholar Photos |
101346 |
/gannon/johnsonscholarphotos/ |
| Current Johnson Scholars |
199757 |
/gannon/currentjohnsonscholars/ |
| Profiles |
199758 |
/gannon/currentjohnsonscholars/profiles/ |
| WISER |
15841 |
/gannon/wiser.shtml |
| 2025-2026 Mentorship Projects |
80269 |
/gannon/2025-2026mentorshipprojects/ |
| WISER Application |
95128 |
/gannon/wiserapplication/ |
| Mallinckrodt Scholars |
66330 |
/gannon/mallinckrodtscholars/ |
| Current Mallinckrodt Scholars |
82444 |
/gannon/mallinckrodtscholars/currentmallinckrodtscholars/ |
| Profiles |
82448 |
/gannon/mallinckrodtscholars/currentmallinckrodtscholars/profiles/ |
| Reflections about Blessed Pauline von Mallinckrodt |
203197 |
/gannon/mallinckrodtscholars/reflectionsaboutblessedpaulinevonmallinckrodt/ |
| Ann F. Baum Speaker Series |
15834 |
/gannon/Baum_Speaker_Series.shtml |
| Ann Ida Gannon, BVM |
203338 |
/gannon/annidagannonbvm/ |
| Anne Carr, BVM Activist, Scholar, and Contemplative in Action |
204108 |
/gannon/annecarrbvmactivistscholarandcontemplativeinaction/ |
| Carol Frances Jegen, BVM Teaching the Way of Justice and Peace |
204109 |
/gannon/carolfrancesjegenbvmteachingthewayofjusticeandpeace/ |
| Videos |
87314 |
/gannon/videos/ |
| archive |
87315 |
/gannon/videos/archive/ |
| Former Visiting Scholars |
15824 |
/gannon/formervisitingscholars/ |
| Undergraduate Leadership Award |
76041 |
/gannon/undergraduateleadershipaward/ |
| Women's History Month |
89937 |
/gannon/womenshistorymonth/ |
| Recent Events |
204467 |
/gannon/recentevents/ |
| Mundelein Alumnae |
60820 |
/gannon/mundeleinalumnae/ |
| Coffey Award |
57692 |
/gannon/mundeleinalumnae/coffeyaward/ |
| Coffey Award Recipients |
57695 |
/gannon/mundeleinalumnae/coffeyaward/coffeyawardrecipients/ |
| Tina Stretch |
95917 |
/gannon/mundeleinalumnae/coffeyaward/coffeyawardrecipients/stretch/ |
| Sharon Gist Gilliam |
95918 |
/gannon/mundeleinalumnae/coffeyaward/coffeyawardrecipients/gist-gilliam/ |
| Patricia O'Donnell Ewers |
95919 |
/gannon/mundeleinalumnae/coffeyaward/coffeyawardrecipients/ewers/ |
| Barbara Baynes Mahoney |
95920 |
/gannon/mundeleinalumnae/coffeyaward/coffeyawardrecipients/baynes-mahoney/ |
| Alice Bourke Hayes |
95921 |
/gannon/mundeleinalumnae/coffeyaward/coffeyawardrecipients/hayes/ |
| Mary M. Dwyer, PhD |
95922 |
/gannon/mundeleinalumnae/coffeyaward/coffeyawardrecipients/dwyer/ |
| The Honorable June Carter Perry |
95923 |
/gannon/mundeleinalumnae/coffeyaward/coffeyawardrecipients/carter-perry/ |
| Janet W. Sisler |
95924 |
/gannon/mundeleinalumnae/coffeyaward/coffeyawardrecipients/sisler/ |
| Jacqueline Powers Doud |
95925 |
/gannon/mundeleinalumnae/coffeyaward/coffeyawardrecipients/doud/ |
| Mary Ann Smith |
95926 |
/gannon/mundeleinalumnae/coffeyaward/coffeyawardrecipients/smith/ |
| Kumiko Watanuki |
95927 |
/gannon/mundeleinalumnae/coffeyaward/coffeyawardrecipients/watanuki/ |
| Elaine M. Schuster |
95928 |
/gannon/mundeleinalumnae/coffeyaward/coffeyawardrecipients/schuster/ |
| Dr. Judith A. Mayotte |
95929 |
/gannon/mundeleinalumnae/coffeyaward/coffeyawardrecipients/mayotte/ |
| Dr. Adrienne Y. Bailey |
95930 |
/gannon/mundeleinalumnae/coffeyaward/coffeyawardrecipients/bailey/ |
| Joyce R. Saxon |
95931 |
/gannon/mundeleinalumnae/coffeyaward/coffeyawardrecipients/saxon/ |
| Mary Ann Zollmann, BVM |
105889 |
/gannon/mundeleinalumnae/coffeyaward/coffeyawardrecipients/maryannzollmannbvm/ |
| Christine Boyd |
117205 |
/gannon/mundeleinalumnae/coffeyaward/coffeyawardrecipients/christineboyd/ |
| Connect with Alumnae Relations |
64160 |
/gannon/mundeleinalumnae/connectwithalumnaerelations/ |
| Golden Phoenix Society |
95136 |
/gannon/mundeleinalumnae/goldenphoenixsociety/ |
| Mundelein College & Gannon Scholars Alumnae Board |
60905 |
/gannon/mundeleinalumnae/mundeleincollegegannonscholarsalumnaeboard/ |
| Mundelein College & Gannon Scholars Alumnae Board Members |
123582 |
/gannon/mundeleinalumnae/mundeleincollegegannonscholarsalumnaeboard/mundeleincollegegannonscholarsalumnaeboardmembers/ |
| Denise Folk Adams |
123584 |
/gannon/mundeleinalumnae/mundeleincollegegannonscholarsalumnaeboard/mundeleincollegegannonscholarsalumnaeboardmembers/denisefolkadams/ |
| Gabrielle M. Buckley |
123586 |
/gannon/mundeleinalumnae/mundeleincollegegannonscholarsalumnaeboard/mundeleincollegegannonscholarsalumnaeboardmembers/gabriellembuckley/ |
| Paula Carney |
123587 |
/gannon/mundeleinalumnae/mundeleincollegegannonscholarsalumnaeboard/mundeleincollegegannonscholarsalumnaeboardmembers/paulacarney/ |
| Mary Frances Consola |
123588 |
/gannon/mundeleinalumnae/mundeleincollegegannonscholarsalumnaeboard/mundeleincollegegannonscholarsalumnaeboardmembers/maryfrancesconsola/ |
| Elena Duarte |
123589 |
/gannon/mundeleinalumnae/mundeleincollegegannonscholarsalumnaeboard/mundeleincollegegannonscholarsalumnaeboardmembers/elenaduarte/ |
| Sandra Williams |
123590 |
/gannon/mundeleinalumnae/mundeleincollegegannonscholarsalumnaeboard/mundeleincollegegannonscholarsalumnaeboardmembers/sandrawilliams/ |
| Leslie Linke |
123591 |
/gannon/mundeleinalumnae/mundeleincollegegannonscholarsalumnaeboard/mundeleincollegegannonscholarsalumnaeboardmembers/leslielinke/ |
| Andrea A. Raila |
123593 |
/gannon/mundeleinalumnae/mundeleincollegegannonscholarsalumnaeboard/mundeleincollegegannonscholarsalumnaeboardmembers/andreaaraila/ |
| Mary Sharon Reilly |
123594 |
/gannon/mundeleinalumnae/mundeleincollegegannonscholarsalumnaeboard/mundeleincollegegannonscholarsalumnaeboardmembers/marysharonreilly/ |
| Janet Sisler |
123595 |
/gannon/mundeleinalumnae/mundeleincollegegannonscholarsalumnaeboard/mundeleincollegegannonscholarsalumnaeboardmembers/janetsisler/ |
| Nancy Slack Stachnik |
123596 |
/gannon/mundeleinalumnae/mundeleincollegegannonscholarsalumnaeboard/mundeleincollegegannonscholarsalumnaeboardmembers/nancyslackstachnik/ |
| Theresa Faulkner |
155147 |
/gannon/mundeleinalumnae/mundeleincollegegannonscholarsalumnaeboard/mundeleincollegegannonscholarsalumnaeboardmembers/theresafaulkner/ |
| Sue Heintz |
184504 |
/gannon/mundeleinalumnae/mundeleincollegegannonscholarsalumnaeboard/mundeleincollegegannonscholarsalumnaeboardmembers/sueheintz/ |
| Erna Dzafic Badic |
201458 |
/gannon/mundeleinalumnae/mundeleincollegegannonscholarsalumnaeboard/mundeleincollegegannonscholarsalumnaeboardmembers/ernadzaficbadic/ |
| Megan (Meagher) Cederoth |
201460 |
/gannon/mundeleinalumnae/mundeleincollegegannonscholarsalumnaeboard/mundeleincollegegannonscholarsalumnaeboardmembers/meganmeaghercederoth/ |
| Rae Ali |
202040 |
/gannon/mundeleinalumnae/mundeleincollegegannonscholarsalumnaeboard/mundeleincollegegannonscholarsalumnaeboardmembers/raeali/ |
| Mundelein College Alumnae Events |
71877 |
/gannon/mundeleinalumnae/mundeleincollegealumnaeevents/ |
| Past Presidents of Mundelein College |
15845 |
/gannon/Mundelein_Presidents.shtml |
| Sister Ann Ida Gannon, BVM Receives Prestigious Newberry Award |
15847 |
/gannon/Newberry_Award.shtml |
| Coffey Award 2013 |
57561 |
/gannon/coffeyaward2013/ |
| Past Event Photos |
204464 |
/gannon/mundeleinalumnae/pasteventphotos/ |
| The Mundelein College Paper Records Project |
99491 |
/gannon/mundeleinalumnae/themundeleincollegepaperrecordsproject/ |
| Give to Gannon |
60753 |
/gannon/givetogannon/ |
| Celebrate Mundelein |
64157 |
/gannon/givetogannon/celebratemundelein/ |
| Estate Giving |
60758 |
/gannon/givetogannon/estategiving/ |
| Scholarship Campaign |
60760 |
/gannon/givetogannon/scholarshipcampaign/ |
| right_column |
87326 |
/gannon/givetogannon/rightcolumn/ |
| Loyola Women's Leadership Council |
22666 |
/gannon/loyolawomensleadershipcouncil/ |
| Documents |
106281 |
/gannon/documents/ |
| Archived |
203955 |
/gannon/archived/ |
| Visiting Scholar Application |
15816 |
/gannon/visitingscholarapplication/ |
| Graduated Gannon Scholars |
203956 |
/gannon/archived/graduatedgannonscholars/ |
| Johnson Scholars |
204322 |
/gannon/archived/johnsonscholars/ |
| Mallinckrodt Scholars |
204917 |
/gannon/archived/mallinckrodtscholars/ |
| Sister Jean Dolores Schmidt, BVM |
204650 |
/gannon/sisterjeandoloresschmidtbvm/ |
| GDPR @ Loyola |
109598 |
/gdpr/ |
| site_logo |
203414 |
/gdpr/sitelogo/ |
| Footer |
109827 |
/gdpr/footer/ |
| modules-programming |
203416 |
/gdpr/modules-programming/ |
| About Us |
109815 |
/gdpr/aboutus/ |
| GDPR Request |
110326 |
/gdpr/aboutus/gdprrequest/ |
| Thank You |
110457 |
/gdpr/aboutus/thank-you.shtml |
| GDPR Information |
110318 |
/gdpr/gdprinformation/ |
| GDPR Consent Forms |
123528 |
/gdpr/gdprinformation/consentforms/ |
| GDPR FAQ |
110320 |
/gdpr/gdprinformation/gdprfaq/ |
| GDPR Vendor FAQ |
121457 |
/gdpr/gdprinformation/vendor/faq.shtml |
| Policies |
109816 |
/gdpr/policies/ |
| GDPR Privacy Notice |
110487 |
/gdpr/policies/gdprprivacynotice/ |
| Notice of Personal Data Breach Form |
116874 |
/gdpr/policies/noticeofpersonaldatabreachform/ |
| GDPR Notice for University Students |
157382 |
/gdpr/policies/gdprnoticeforuniversitystudents/ |
| GDPR Notice for University Employees |
157383 |
/gdpr/policies/gdprnoticeforuniversityemployees/ |
| German Studies Minor |
55972 |
/germanstudies/index.shtml |
| site_logo |
55989 |
/germanstudies/sitelogo/ |
| Footer |
55988 |
/germanstudies/footer/ |
| modules-programming |
202211 |
/germanstudies/modules-programming/ |
| About Us |
55973 |
/germanstudies/aboutus/ |
| right_column |
86929 |
/germanstudies/aboutus/rightcolumn/ |
| Academics |
55974 |
/germanstudies/academics/ |
| Requirements |
55977 |
/germanstudies/academics/requirements/ |
| Study Abroad |
56738 |
/germanstudies/academics/studyabroad/ |
| right_column |
86930 |
/germanstudies/academics/rightcolumn/ |
| Faculty |
55975 |
/germanstudies/faculty/ |
| right_column |
86934 |
/germanstudies/faculty/rightcolumn/ |
| Resources |
55976 |
/germanstudies/resources/ |
| On Campus |
55981 |
/germanstudies/resources/oncampus/ |
| Cultural Organizations in Chicago |
55982 |
/germanstudies/resources/culturalorganizationsinchicago/ |
| right_column |
86936 |
/germanstudies/resources/rightcolumn/ |
| Giving to Loyola |
179057 |
/giving/ |
| site_logo |
179139 |
/giving/sitelogo/ |
| Footer |
179140 |
/giving/footer/ |
| cta |
179252 |
/giving/cta/ |
| Contact us |
179253 |
/giving/contactus/ |
| Impact of Giving |
179146 |
/giving/impactofgiving/ |
| Hear from our students |
179148 |
/giving/impactofgiving/hearfromourstudents/ |
| archive |
179160 |
/giving/impactofgiving/hearfromourstudents/archive/ |
| Your Gift At Work |
179149 |
/giving/impactofgiving/yourgiftatwork/ |
| New Donors |
179150 |
/giving/impactofgiving/newdonors/ |
| right_column |
179567 |
/giving/rightcolumn/ |
| How To Give |
179151 |
/giving/howtogive/ |
| Gift Planning |
201314 |
https://luc.planmygift.org/ |
| Faculty & Staff Giving |
179154 |
/giving/howtogive/facultystaffgiving/ |
| Matching Gifts |
202358 |
/giving/howtogive/matchinggifts/ |
| Donor Bill of Rights |
207185 |
/giving/howtogive/donorbillofrights/ |
| Giving Priorities |
179153 |
/giving/givingpriorities/ |
| The Loyola Athletic Fund |
110587 |
/giving/givingpriorities/theloyolaathleticfund/ |
| site_logo |
110592 |
/giving/givingpriorities/theloyolaathleticfund/sitelogo/ |
| documents |
110588 |
/giving/givingpriorities/theloyolaathleticfund/documents/ |
| Audrey G. Ratner Endowments |
179234 |
/giving/givingpriorities/audreygratnerendowments/ |
| What to Support |
179152 |
/giving/givingpriorities/whattosupport/ |
| Colleges and Schools |
179228 |
/giving/givingpriorities/whattosupport/collegesandschools/ |
| Programs and Centers |
179229 |
/giving/givingpriorities/whattosupport/programsandcenters/ |
| Donor Recognition |
179155 |
/giving/donorrecognition/ |
| Giving Societies |
179235 |
/giving/donorrecognition/givingsocieties/ |
| Damen Society |
179236 |
/giving/donorrecognition/givingsocieties/damensociety/ |
| Loyola Loyalists |
179246 |
/giving/donorrecognition/givingsocieties/loyolaloyalists/ |
| Founders' Circle |
179247 |
/giving/donorrecognition/givingsocieties/founderscircle/ |
| Society of the Shield |
179248 |
/giving/donorrecognition/givingsocieties/societyoftheshield/ |
| Spirit of Mundelein Club |
179249 |
/giving/donorrecognition/givingsocieties/spiritofmundeleinclub/ |
| Società di Donatori |
179250 |
/giving/donorrecognition/givingsocieties/societadidonatori/ |
| Stories of Generosity |
179254 |
/giving/donorrecognition/storiesofgenerosity/ |
| archive |
179255 |
/giving/donorrecognition/storiesofgenerosity/archive/ |
| News |
179304 |
/giving/news/ |
| Responding to the Call |
179305 |
/giving/news/respondingtothecall/ |
| Alumni Relations |
179565 |
https://www.alumni.luc.edu/s/1548/alumni/start.aspx?gid=2&pgid=61 |
| The Black Alumni Board Mamie Till-Mobley Scholarship |
180658 |
/giving/mamie-till-mobley-scholarship/ |
| The Follett Family Impact at Loyola |
181092 |
/giving/follett-family/ |
| Support the Climate Change Conference |
181474 |
/giving/support-climate-change-conference/ |
| The Martino Scholars |
187047 |
/giving/martino-scholars/ |
| Latino Alumni Board Endowed Scholarship |
191109 |
/giving/latino-alumni-board-endowed-scholarship/ |
| social media |
191774 |
/giving/latino-alumni-board-endowed-scholarship/socialmedia/ |
| Empowering the Next Generation of Business Leaders: Jeff and Stephanie Jarczyk’s Call to Action for the Loyola Community |
201625 |
/giving/empoweringthenextgenerationofbusinessleadersjeffandstephaniejarczykscalltoactionfortheloyolacommunity/ |
| Loyola University Chicago Announces Gift to Strengthen Clinical Legal Education |
203696 |
/giving/loyolauniversitychicagoannouncesgifttostrengthenclinicallegaleducation/ |
| Trustee Tom Schoewe and family make investment in Arrupe College |
204210 |
/giving/trusteetomschoeweandfamilymakeinvestmentinarrupecollege/ |
| Gift to Advance Polish Diaspora Studies |
204355 |
/giving/gifttoadvancepolishdiasporastudies/ |
| Global Studies |
17495 |
/globalstudies/ |
| About Us |
17496 |
/globalstudies/about/ |
| Faculty |
60792 |
/globalstudies/about/faculty/ |
| Office Hours |
17515 |
/globalstudies/about/officehours/ |
| Online Resources |
17499 |
/globalstudies/about/onlineresources/ |
| FAQs |
17498 |
/globalstudies/about/faqs/ |
| Contact Us |
17497 |
/globalstudies/about/contact/ |
| right_column |
87966 |
/globalstudies/about/rightcolumn/ |
| Academics |
17501 |
/globalstudies/academics/ |
| BA in Global Studies |
195178 |
https://catalog.luc.edu/undergraduate/arts-sciences/global-studies/global-studies-ba/#text |
| BA in Global Studies |
17502 |
/globalstudies/academics/ba/ |
| Minor in Global Studies |
195179 |
https://catalog.luc.edu/undergraduate/arts-sciences/global-studies/global-studies-minor/ |
| Minor in Global Studies |
17505 |
/globalstudies/academics/minoringlobalstudies/ |
| Searching for Classes |
202407 |
/globalstudies/academics/searchingforclasses/ |
| Course Offerings |
17503 |
/globalstudies/academics/courseofferings/ |
| Fall Courses 2022 |
168558 |
/globalstudies/academics/courseofferings/fallcourses2022/ |
| J-Term Courses 2023 |
181463 |
/globalstudies/academics/courseofferings/j-termcourses2023/ |
| Spring Courses 2023 |
181464 |
/globalstudies/academics/courseofferings/springcourses2023/ |
| Summer Courses 2023 |
185811 |
/globalstudies/academics/courseofferings/summercourses2023/ |
| Fall Courses 2023 |
185806 |
/globalstudies/academics/courseofferings/fallcourses2023/ |
| J-Term Courses 2024 |
189263 |
/globalstudies/academics/courseofferings/j-termcourses2024/ |
| Spring Courses 2024 |
189264 |
/globalstudies/academics/courseofferings/springcourses2024/ |
| Summer Courses 2024 |
190931 |
/globalstudies/academics/courseofferings/summercourses2024/ |
| Summer Courses 2026 |
206211 |
/globalstudies/academics/courseofferings/summercourses2026/ |
| Fall Courses 2026 |
206830 |
/globalstudies/academics/courseofferings/fallcourses2026/ |
| Internships |
100080 |
/globalstudies/academics/internships/ |
| Student Testimonials |
100082 |
/globalstudies/academics/internships/studenttestimonials/ |
| FAQ |
100084 |
/globalstudies/academics/internships/faq/ |
| right_column |
100096 |
/globalstudies/academics/internships/rightcolumn/ |
| right_column |
88005 |
/globalstudies/academics/rightcolumn/ |
| Admission |
17507 |
/globalstudies/admission/ |
| Financial Aid |
17508 |
/globalstudies/admission/financialaid/ |
| Request Information |
17509 |
/globalstudies/admission/requestinformation/ |
| Tuition |
17510 |
/globalstudies/admission/tuition/ |
| Undergraduate Admission |
17511 |
/globalstudies/admission/undergraduateadmission/ |
| right_column |
88007 |
/globalstudies/admission/rightcolumn/ |
| Footer |
17522 |
/globalstudies/footer/ |
| site_logo |
17523 |
/globalstudies/sitelogo/ |
| modules-programming |
198884 |
/globalstudies/modules-programming/ |
| Graduate, Professional, and Adult Student Life |
26995 |
/gpasl/ |
| About GPASL |
27003 |
/gpasl/about/ |
| Welcome |
95651 |
/gpasl/about/welcome/ |
| Mission |
79714 |
/gpasl/about/mission/ |
| Vision |
79715 |
/gpasl/about/vision/ |
| Learning Outcomes & Values |
79716 |
/gpasl/about/learningoutcomesvalues/ |
| GPASL Newsletter |
99153 |
/gpasl/about/gpaslnewsletter/ |
| Contact Us |
110967 |
/gpasl/about/contactus/ |
| Grad, Prof, Adult Student Resources |
60578 |
/gpasl/gradprofadultstudentresources/ |
| Academic Programs |
60880 |
/gpasl/gradprofadultstudentresources/academicprograms/ |
| Programs & Events |
95664 |
/gpasl/gradprofadultstudentresources/programsevents/ |
| Resources |
60881 |
/gpasl/gradprofadultstudentresources/resources/ |
| Student Organizations |
78338 |
/gpasl/gradprofadultstudentresources/studentorganizations/ |
| Housing |
60834 |
/gpasl/gradprofadultstudentresources/housing/ |
| GPASL Newsletter |
206153 |
/gpasl/about/gpaslnewsletter/ |
| GPAC |
95667 |
/gpasl/gpac/ |
| 2024-2025 Officers of the Council |
95668 |
/gpasl/gpac/2024-2025officersofthecouncil/ |
| GPAC By-Laws |
95692 |
/gpasl/gpac/gpacby-laws/ |
| Special Events |
110958 |
/gpasl/specialevents/ |
| WTC Block Party |
87103 |
/gpasl/specialevents/wtcblockparty/ |
| What is the President's Medallion |
61837 |
/gpasl/specialevents/whatisthepresidentsmedallion/ |
| Graduate, Professional, & Adult Toast |
110969 |
/gpasl/specialevents/graduateprofessionaladulttoast/ |
| Campus Resources |
152059 |
/gpasl/campusresources/ |
| WTC Study Area Guide |
95666 |
/gpasl/campusresources/wtcstudyareaguide/ |
| Water Tower Campus Student Area Guide |
106937 |
/gpasl/campusresources/watertowercampusstudentareaguide/ |
| Water Tower Posting Policy |
106938 |
/gpasl/campusresources/watertowerpostingpolicy/ |
| DSD Areas |
186636 |
/gpasl/dsdareas/ |
| Campus Recreation |
186637 |
/campusrec/ |
| Campus Reservations |
186638 |
/campus_reservations/ |
| Community Coalition on Gender-Based Violence |
186642 |
/coalition/ |
| Conference Services |
186643 |
/conference/index.shtml |
| CTA U-Pass |
186644 |
/upass/ |
| Damen Student Center |
186646 |
/damenstudentcenter/index.shtml |
| Family Weekend |
186648 |
/familyweekend/ |
| Graduate, Professional, and Adult Student Life |
186649 |
/gpasl/ |
| Loyola University Museum of Art |
186650 |
/luma/ |
| Office of Student Conduct and Conflict Resolution |
186651 |
/osccr/ |
| Student Government |
186653 |
/sglc/ |
| Terry Student Center |
186654 |
/tsc/ |
| Wellness Center |
186656 |
/wellness/ |
| Stories |
82350 |
/gpasl/stories/ |
| archive |
82352 |
/gpasl/stories/archive/ |
| Videos |
82351 |
/gpasl/videos/ |
| cta |
186048 |
/gpasl/cta/ |
| site_logo |
206148 |
/gpasl/sitelogo/ |
| Footer |
27052 |
/gpasl/footer/ |
| News |
206150 |
/gpasl/news/ |
| Health Equity Landing Page |
183847 |
/healthequity/ |
| site_logo |
183848 |
/healthequity/sitelogo/ |
| I Links |
183850 |
/healthequity/ilinks/ |
| cta |
183851 |
/healthequity/cta/ |
| social media |
183852 |
/healthequity/socialmedia/ |
| Footer |
183849 |
/healthequity/footer/ |
| Health Equity Quest 2025 |
197080 |
/parkinson/innovationchallenge/ |
| site_logo |
197081 |
/parkinson/innovationchallenge/sitelogo/ |
| Health Equity Quest (splashpage) - 2023 |
188006 |
/parkinson/healthequityquest/ |
| site_logo |
188007 |
/parkinson/healthequityquest/sitelogo/ |
| Footer |
188008 |
/parkinson/healthequityquest/footer/ |
| Keynote Speaker |
188010 |
/parkinson/healthequityquest/keynotespeaker/ |
| Agenda |
188011 |
/parkinson/healthequityquest/agenda/ |
| Panelist Bios |
189058 |
/parkinson/healthequityquest/panelistbios/ |
| Health Sciences Campus - Ministry |
182126 |
/hsc/ministry/ |
| site_logo |
182127 |
/hsc/ministry/sitelogo/ |
| modules-programming |
199869 |
/hsc/ministry/modules-programming/ |
| Footer |
182128 |
/hsc/ministry/footer/ |
| About |
182150 |
/hsc/ministry/about/ |
| Meet Our Team |
182156 |
/hsc/ministry/about/meetourteam/ |
| Faculty & Staff Programming |
182157 |
/hsc/ministry/about/facultystaffprogramming/ |
| Prayer & Reflection Spaces |
182158 |
/hsc/ministry/about/prayerreflectionspaces/ |
| Racial Justice |
182159 |
https://www.luc.edu/irj/ |
| Donate |
182160 |
/hsc/ministry/about/donate/ |
| Contact Us |
183439 |
/hsc/ministry/about/contactus/ |
| Community |
182151 |
/hsc/ministry/community/ |
| First Year Dinners |
182168 |
/hsc/ministry/community/firstyeardinners/ |
| JUMP Retreat |
182169 |
/hsc/ministry/community/jumpretreat/ |
| MIX Retreat |
182170 |
/hsc/ministry/community/mixretreat/ |
| Small Groups |
182171 |
/hsc/ministry/community/smallgroups/ |
| St. Luke's Week |
188940 |
/hsc/ministry/community/stlukesweek/ |
| Anatomical Donor Service of Gratitude |
201630 |
/hsc/ministry/community/anatomicaldonorserviceofgratitude/ |
| right_column |
203532 |
/hsc/ministry/community/anatomicaldonorserviceofgratitude/rightcolumn/ |
| Faith |
182152 |
/hsc/ministry/faith/ |
| Eucharistic Ministry at LUMC |
182177 |
/hsc/ministry/faith/eucharisticministryatlumc/ |
| Interfaith and Multifaith Initiatives |
182178 |
/hsc/ministry/faith/interfaithandmultifaithinitiatives/ |
| Liturgies |
182179 |
/hsc/ministry/faith/liturgies/ |
| Spiritual Direction |
182180 |
/hsc/ministry/faith/spiritualdirection/ |
| Stations of the Cross |
182181 |
/hsc/ministry/faith/stationsofthecross/ |
| Ignatian Service Immersion |
182153 |
/hsc/ministry/ignatianserviceimmersion/ |
| Values |
182190 |
/hsc/ministry/ignatianserviceimmersion/values/ |
| Trip Destinations |
182191 |
/hsc/ministry/ignatianserviceimmersion/destinations/ |
| Student Info & Application |
182222 |
/hsc/ministry/ignatianserviceimmersion/forms/ |
| Support ISI |
182221 |
/hsc/ministry/ignatianserviceimmersion/donate/ |
| Co-Curricular Programs |
182154 |
/hsc/ministry/co-curricularprograms/ |
| Anatomy Course Blessings |
182223 |
/hsc/ministry/co-curricularprograms/anatomycourseblessings/ |
| right_column |
200367 |
/hsc/ministry/co-curricularprograms/anatomycourseblessings/rightcolumn/ |
| Blessing of Hands |
182224 |
/hsc/ministry/co-curricularprograms/blessingofhands/ |
| Chaplain Mentor Program |
182225 |
/hsc/ministry/co-curricularprograms/chaplainmentorprogram/ |
| right_column |
205800 |
/hsc/ministry/co-curricularprograms/chaplainmentorprogram/rightcolumn/ |
| Professional Development and Jesuit Values |
182226 |
/hsc/ministry/co-curricularprograms/professionaldevelopmentandjesuitvalues/ |
| Service & Advocacy |
182155 |
/hsc/ministry/serviceadvocacy/ |
| Bading House |
182228 |
/hsc/ministry/serviceadvocacy/badinghouse/ |
| Day of Community & Service |
182229 |
/hsc/ministry/serviceadvocacy/dayofservice/ |
| Jack MacCarthy Service in Medicine Award |
188941 |
/hsc/ministry/serviceadvocacy/jackmaccarthyserviceinmedicineaward/ |
| Thanksgiving Initiatives 2025 |
182232 |
/hsc/ministry/serviceadvocacy/thanksgiving/ |
| social media |
182247 |
/hsc/ministry/socialmedia/ |
| cta |
183440 |
/hsc/ministry/cta/ |
| HSC - Clinical Research Office |
76583 |
/hsc/cro/ |
| site_logo |
76592 |
/hsc/cro/sitelogo/ |
| Footer |
198760 |
/hsc/cro/footer/ |
| social media |
198763 |
/hsc/cro/socialmedia/ |
| I Links |
198762 |
/hsc/cro/ilinks/ |
| Biostatistics |
83894 |
/hsc/cro/biostatistics/ |
| right_column |
102253 |
/hsc/cro/biostatistics/rightcolumn/ |
| Biostatistics Services |
99879 |
/hsc/cro/biostatistics/biostatisticsservices/ |
| Biostatistics Rates |
105329 |
/hsc/cro/biostatistics/biostatisticsrates/ |
| Biostatistics Prioritization |
147641 |
/hsc/cro/biostatistics/biostatisticsprioritization/ |
| Biostatistics FAQ |
99881 |
/hsc/cro/biostatistics/biostatisticsfaq/ |
| Biostatistics Feedback |
198771 |
https://hscrc.luc.edu/redcap/surveys/?s=L4YK733DJE8KYFDT |
| Student Training in Approaches to Research (STAR) |
127229 |
/hsc/cro/biostatistics/studenttraininginapproachestoresearchstar/ |
| Recommended Resources |
157103 |
/hsc/cro/biostatistics/recommendedresources/ |
| Biorepository |
83897 |
/hsc/cro/biorepository/ |
| right_column |
198772 |
/hsc/cro/biorepository/rightcolumn/ |
| Sponsored Clinical Research |
76586 |
/hsc/cro/sponsoredclinicalresearch/ |
| Regulatory |
83898 |
/hsc/cro/regulatory/ |
| Directories |
82515 |
/hsc/cro/directories/ |
| Faculty |
76585 |
/hsc/cro/directories/faculty/ |
| Profiles |
80285 |
/hsc/cro/directories/faculty/profiles/ |
| right_column |
203102 |
/hsc/cro/directories/faculty/profiles/rightcolumn/ |
| Staff |
82516 |
/hsc/cro/directories/staff/ |
| profiles |
198773 |
/hsc/cro/directories/staff/profiles/ |
| right_column |
203103 |
/hsc/cro/directories/staff/profiles/rightcolumn/ |
| Volunteers |
84890 |
/hsc/cro/directories/volunteers/ |
| Contact Us |
76587 |
/hsc/cro/contact-us/ |
| HSC - Comparative Medicine |
101427 |
/hsc-comparative-medicine/ |
| site_logo |
203934 |
/hsc-comparative-medicine/sitelogo/ |
| Footer |
203935 |
/hsc-comparative-medicine/footer/ |
| social media |
203937 |
/hsc-comparative-medicine/socialmedia/ |
| right_column |
101474 |
/hsc-comparative-medicine/rightcolumn/ |
| About Us |
101436 |
/hsc-comparative-medicine/aboutus/ |
| Mission |
203939 |
/hsc-comparative-medicine/aboutus/ |
| Contact Us |
101458 |
/hsc-comparative-medicine/aboutus/contactus/ |
| Boilerplate |
101459 |
/hsc-comparative-medicine/aboutus/boilerplate/ |
| Regulatory Information |
101460 |
/hsc-comparative-medicine/aboutus/regulatoryinformation/ |
| Administrative Services |
101669 |
/hsc-comparative-medicine/aboutus/administrativeservices/ |
| Veterinary Services |
101670 |
/hsc-comparative-medicine/aboutus/veterinaryservices/ |
| Husbandry Services |
101671 |
/hsc-comparative-medicine/aboutus/husbandryservices/ |
| Diagnostic Services |
101672 |
/hsc-comparative-medicine/aboutus/diagnosticservices/ |
| Initiating Your Research |
101437 |
/hsc-comparative-medicine/initiatingyourresearch/ |
| Introduction |
203940 |
/hsc-comparative-medicine/initiatingyourresearch/ |
| Opening an Account |
101674 |
/hsc-comparative-medicine/initiatingyourresearch/openinganaccount/ |
| Access and Security |
101678 |
/hsc-comparative-medicine/initiatingyourresearch/accessandsecurity/ |
| Animal Ordering |
101679 |
/hsc-comparative-medicine/initiatingyourresearch/animalordering/ |
| Controlled Substances |
101681 |
/hsc-comparative-medicine/initiatingyourresearch/controlledsubstances/ |
| Housing Locations |
101438 |
/hsc-comparative-medicine/housinglocations/ |
| Rates & Services |
101439 |
/hsc-comparative-medicine/ratesservices/ |
| Introduction |
203941 |
/hsc-comparative-medicine/ratesservices/ |
| Per Diem Charges |
101683 |
/hsc-comparative-medicine/ratesservices/perdiemcharges/ |
| Special Charges |
101684 |
/hsc-comparative-medicine/ratesservices/specialcharges/ |
| Surgery Charges |
101685 |
/hsc-comparative-medicine/ratesservices/surgerycharges/ |
| Technical Charges |
101686 |
/hsc-comparative-medicine/ratesservices/technicalcharges/ |
| Policies & Programs |
101440 |
/hsc-comparative-medicine/policiesprograms/ |
| right_column |
101725 |
/hsc-comparative-medicine/policiesprograms/rightcolumn/ |
| Forms |
203942 |
/hsc-comparative-medicine/policiesprograms/ |
| Standard Operating Procedures |
203948 |
/secure/hsc-comparative-medicine/standardoperatingprocedures/ |
| Standard Operating Procedures (Secure) |
101697 |
/secure/hsc-comparative-medicine/standardoperatingprocedures/ |
| Rodents From Non-commercial Sources |
101698 |
/hsc-comparative-medicine/policiesprograms/rodentsfromnon-commercialsources/ |
| Occupational Health & Safety Program |
101699 |
/hsc-comparative-medicine/policiesprograms/occupationalhealthsafetyprogram/ |
| Code Triage Disaster Plan |
204037 |
/secure/hsc-comparative-medicine/codetriagedisasterplan/ |
| Code Triage Disaster Plan (Secure) |
101700 |
/secure/hsc-comparative-medicine/codetriagedisasterplan/ |
| Anesthetics & Analgesics |
101441 |
/hsc-comparative-medicine/anestheticsanalgesics/ |
| Overview |
203943 |
/hsc-comparative-medicine/anestheticsanalgesics/ |
| Mice |
101737 |
/hsc-comparative-medicine/anestheticsanalgesics/mice/ |
| Rats |
101738 |
/hsc-comparative-medicine/anestheticsanalgesics/rats/ |
| Guinea Pigs |
101739 |
/hsc-comparative-medicine/anestheticsanalgesics/guineapigs/ |
| Rabbits |
101740 |
/hsc-comparative-medicine/anestheticsanalgesics/rabbits/ |
| Cats and Dogs |
101741 |
/hsc-comparative-medicine/anestheticsanalgesics/catsanddogs/ |
| Swine |
101742 |
/hsc-comparative-medicine/anestheticsanalgesics/swine/ |
| Nonhuman Primates |
101743 |
/hsc-comparative-medicine/anestheticsanalgesics/nonhumanprimates/ |
| HSC - Conference Services |
94195 |
/hsc/conference/ |
| site_logo |
199696 |
/hsc/conference/sitelogo/ |
| Footer |
199697 |
/hsc/conference/footer/ |
| social media |
199700 |
/hsc/conference/socialmedia/ |
| Campus Venues |
94225 |
/hsc/conference/campusvenues/ |
| Center for Translational Research and Education |
94593 |
/hsc/conference/campusvenues/centerfortranslationalresearchandeducation/ |
| Sample Venue Page |
199708 |
/hsc/conference/campusvenues/samplevenuepage/ |
| CTRE Auditorium |
199726 |
/hsc/conference/campusvenues/samplevenuepage/ctreauditorium/ |
| CTRE Atrium |
199727 |
/hsc/conference/campusvenues/samplevenuepage/ctreatrium/ |
| CTRE Seminar Room |
199728 |
/hsc/conference/campusvenues/samplevenuepage/ctreseminarroom/ |
| Usage Policy |
94226 |
/hsc/conference/usagepolicy/ |
| Room Rates |
94228 |
/hsc/conference/roomrates/ |
| Contact Us |
94237 |
/hsc/conference/contactus/ |
| Thank You |
94244 |
/hsc/conference/contactus/thankyou/ |
| HSC - I-TIE |
94257 |
/hsc/itie/ |
| site_logo |
199785 |
/hsc/itie/sitelogo/ |
| Footer |
199786 |
/hsc/itie/footer/ |
| social media |
199788 |
/hsc/itie/socialmedia/ |
| modules-programming |
199790 |
/hsc/itie/modules-programming/ |
| Interprofessional Education |
94268 |
/hsc/itie/interprofessionaleducation/ |
| Overview |
199782 |
/hsc/itie/interprofessionaleducation/ |
| Simulation Experiences |
101801 |
/hsc/itie/interprofessionaleducation/simulationexperiences/ |
| Programs and Events |
94269 |
/hsc/itie/programsandevents/ |
| Overview |
199783 |
/hsc/itie/programsandevents/ |
| Poverty Simulation |
101798 |
/hsc/itie/programsandevents/povertysimulation/ |
| Collaborative Practice |
94270 |
/hsc/itie/collaborativepractice/ |
| Overview |
199784 |
/hsc/itie/collaborativepractice/ |
| Family Medicine |
101797 |
/hsc/itie/collaborativepractice/familymedicine/ |
| School-Based Health Center |
101793 |
/hsc/itie/collaborativepractice/school-basedhealthcenter/ |
| Interprofessional Research |
101799 |
/hsc/itie/collaborativepractice/interprofessionalresearch/ |
| HSC - Research Services |
74504 |
/hsc/researchservices/ |
| site_logo |
199837 |
/hsc/researchservices/sitelogo/ |
| Footer |
199838 |
/hsc/researchservices/footer/ |
| social media |
199840 |
/hsc/researchservices/socialmedia/ |
| modules-programming |
199842 |
/hsc/researchservices/modules-programming/ |
| Directory |
199846 |
/hsc/researchservices/directory/ |
| profiles |
199844 |
/hsc/researchservices/directory/profiles/ |
| About Us |
75670 |
/hsc/researchservices/aboutus/ |
| Research Deans |
75531 |
/hsc/researchservices/aboutus/researchdeans/ |
| Office of Research Services |
75550 |
/hsc/researchservices/aboutus/officeofresearchservices/ |
| Pre & Post Award Administration |
75672 |
/hsc/researchservices/prepostawardadministration/ |
| About Pre & Post Award |
199848 |
/hsc/researchservices/prepostawardadministration/ |
| Preaward |
75548 |
/hsc/researchservices/prepostawardadministration/preaward/ |
| Post Award |
75547 |
/hsc/researchservices/prepostawardadministration/postaward/ |
| Funding Opportunities |
75535 |
/hsc/researchservices/prepostawardadministration/fundingopportunities/ |
| Policies & Procedures |
75546 |
/hsc/researchservices/prepostawardadministration/policiesprocedures/ |
| Sponsored Program Accounting |
75560 |
/hsc/researchservices/prepostawardadministration/sponsoredprogramaccounting/ |
| Research Compliance |
75770 |
/hsc/researchservices/researchcompliance/ |
| Institutional Animal Care and Use Committee (IACUC) |
75537 |
/hsc/researchservices/researchcompliance/institutionalanimalcareandusecommitteeiacuc/ |
| Institutional Review Board (IRB) |
75540 |
/hsc/researchservices/researchcompliance/irb/ |
| right_column |
83625 |
/hsc/researchservices/researchcompliance/irb/rightcolumn/ |
| Technology Transfer: Intellectual Property |
101843 |
/hsc/researchservices/researchcompliance/technologytransfercommittee/ |
| right_column |
110205 |
/hsc/researchservices/researchcompliance/technologytransfercommittee/rightcolumn/ |
| Technology Transfer: Technologies Available for Licensing |
110328 |
/hsc/researchservices/researchcompliance/technologytransfercommittee/technologytransfertechnologiesavailableforlicensing/ |
| Cayuse |
202485 |
/hsc/researchservices/cayuse/ |
| Student Research |
75771 |
/hsc/researchservices/studentresearch/ |
| Medical Student Research Opportunities |
75563 |
/hsc/researchservices/studentresearch/medicalstudentresearchopportunities/ |
| right_column |
75812 |
/hsc/researchservices/studentresearch/medicalstudentresearchopportunities/rightcolumn/ |
| STAR Program |
75561 |
/hsc/researchservices/studentresearch/starprogram/ |
| right_column |
78427 |
/hsc/researchservices/studentresearch/starprogram/rightcolumn/ |
| Research Training Programs |
114485 |
/hsc/researchservices/studentresearch/starprogram/researchtrainingprograms/ |
| right_column |
116977 |
/hsc/researchservices/studentresearch/starprogram/researchtrainingprograms/rightcolumn/ |
| Research Honors Program |
75536 |
/hsc/researchservices/studentresearch/researchhonorsprogram/ |
| St. Albert's Day |
75776 |
/hsc/researchservices/studentresearch/stalbertsday/ |
| right_column |
199847 |
/hsc/researchservices/studentresearch/stalbertsday/rightcolumn/ |
| right_column |
75795 |
/hsc/researchservices/studentresearch/rightcolumn/ |
| Forms & Applications |
75534 |
/hsc/researchservices/studentresearch/formsapplications/ |
| COVID19 |
128929 |
/hsc/researchservices/covid19/ |
| St. Albert's Day Abstract Submission Form |
75777 |
/hsc/researchservices/content/stalbertsdayabstractsubmissionform/ |
| right_column |
79396 |
/hsc/researchservices/content/researchopportunitiesbeyondloyola/rightcolumn/ |
| Other Loyola Research Opportunities |
75544 |
/hsc/researchservices/content/otherloyolaresearchopportunities/ |
| right_column |
79395 |
/hsc/researchservices/content/otherloyolaresearchopportunities/rightcolumn/ |
| Forms and Applications |
75779 |
/hsc/researchservices/content/formsandapplications/ |
| STAR Program Mentor List |
75562 |
/hsc/researchservices/content/starprogrammentorlist/ |
| Thank You |
92584 |
/hsc/researchservices/thankyou.shtml |
| Searle Scholars Program |
94824 |
/hsc/researchservices/searlescholarsprogram/ |
| right_column |
94832 |
/hsc/researchservices/searlescholarsprogram/rightcolumn/ |
| Test Page |
93362 |
/hsc/researchservices/storage/testpage/ |
| pdfs |
163126 |
/hsc/researchservices/pdfs/ |
| Internal |
182120 |
/hsc/researchservices/internal/ |
| HIPAA |
197507 |
/hipaa/ |
| site_logo |
197508 |
/hipaa/sitelogo/ |
| Footer |
197509 |
/hipaa/footer/ |
| cta |
197510 |
/hipaa/cta/ |
| social media |
197512 |
/hipaa/socialmedia/ |
| History |
13932 |
/history/index.shtml |
| About |
13934 |
/history/about.shtml |
| About the Department |
13940 |
/history/aboutthedepartment/ |
| Department News |
52991 |
/history/stories/ |
| archive |
195800 |
/history/stories/archive/ |
| 2023 Stories |
183579 |
/history/stories/2023stories/ |
| archive |
195801 |
/history/stories/2023stories/archive/ |
| Newsletter |
127711 |
/history/stories/newsletter/ |
| News Archive |
86284 |
/history/news/ |
| 2022 Stories |
178833 |
/history/news/2022stories/ |
| Dr. Barbara Rosenwein Presents Book |
178723 |
/history/news/2022stories/drbarbararosenweinpresentsbook/ |
| HGSA Hosts Successful 2022 Conference |
178724 |
/history/news/2022stories/hgsahostssuccessful2022conference/ |
| Loyola History Senior Tells POW Stories Through Graphic Novels |
178731 |
/history/news/2022stories/loyolahistoryseniortellspowstoriesthroughgraphicnovels/ |
| Join Us for a Special Screening of 'The Loyola Project' |
179303 |
/history/news/2022stories/joinusforaspecialscreeningoftheloyolaproject/ |
| The Death of Queen Elizabeth II: Q&A with Dr. Robert Bucholz |
180359 |
/history/news/2022stories/thedeathofqueenelizabethiiqawithdrrobertbucholz/ |
| History Department Welcomes Two New Faculty Members |
180575 |
/history/news/2022stories/historydepartmentwelcomestwonewfacultymembers/ |
| archive |
196439 |
/history/news/2022stories/archive/ |
| 2021 Stories |
178722 |
/history/news/2021stories/ |
| Congratulations and Farewell, Dr. Manning! |
178781 |
/history/news/2021stories/congratulationsandfarewelldrmanning/ |
| A Conversation with Anthony Stamilio, 2021 McCluggage Award Recipient |
178782 |
/history/news/2021stories/aconversationwithanthonystamilio2021mccluggageawardrecipient/ |
| Faculty and Student Awards 2021 |
178783 |
/history/news/2021stories/facultyandstudentawards2021/ |
| Dr. Jo Hays Book Publication |
178725 |
/history/news/2021stories/drjohaysbookpublication/ |
| History Graduate Student Association, Honor Societies, and History Club 2021-22 |
178785 |
/history/news/2021stories/historygraduatestudentassociationhonorsocietiesandhistoryclub2021-22/ |
| History Students Welcomed Back to Campus |
178727 |
/history/news/2021stories/historystudentswelcomedbacktocampus/ |
| Faculty Spotlight: Q & A With Dr. Tikia Hamilton |
178728 |
/history/news/2021stories/facultyspotlightqawithdrtikiahamilton/ |
| Loyola Public History Program Wins NCPH Founders Award |
178789 |
/history/news/2021stories/loyolapublichistoryprogramwinsncphfoundersaward/ |
| History Alumnus Featured in Mister Kelly's Documentary |
178729 |
/history/news/2021stories/historyalumnusfeaturedinmisterkellysdocumentary/ |
| Loyola Hosts the 17th Annual HGSA Conference Virtually |
178790 |
/history/news/2021stories/loyolahoststhe17thannualhgsaconferencevirtually/ |
| Summer Experience for the History Department |
178730 |
/history/news/2021stories/summerexperienceforthehistorydepartment/ |
| Dr. Jo Hays Book Publication |
178791 |
/history/news/2021stories/drjohaysbookpublication/ |
| Loyola Alum Rev. Bill Corcoran Speaks Up |
178788 |
/history/news/2021stories/loyolaalumrevbillcorcoranspeaksup/ |
| archive |
196440 |
/history/news/2021stories/archive/ |
| 2020 Stories |
178792 |
/history/news/2020stories/ |
| Undergraduate student Melina Testin was awarded an ASPIRE Scholarship! |
178793 |
/history/news/2020stories/undergraduatestudentmelinatestinwasawardedanaspirescholarship/ |
| Oral History Project Led by Current Graduate Intern |
178795 |
/history/news/2020stories/oralhistoryprojectledbycurrentgraduateintern/ |
| Welcome Dr. Hunt |
178814 |
/history/news/2020stories/welcomedrhunt/ |
| Visit Chicagoland- Alumni Virtual Tours |
178815 |
/history/news/2020stories/visitchicagoland-alumnivirtualtours/ |
| Dr. Elliott Gorn Book Publication |
178816 |
/history/news/2020stories/drelliottgornbookpublication/ |
| Dr. Gema Kloppe-Santamaría Book Publication |
178819 |
/history/news/2020stories/drgemakloppe-santamariabookpublication/ |
| Summer Graduate Interns Promote Research and Access |
178820 |
/history/news/2020stories/summergraduateinternspromoteresearchandaccess/ |
| Watch Dr. Robert Bucholz on TV |
178821 |
/history/news/2020stories/watchdrrobertbucholzontv/ |
| Summer Undergraduate Interns Explore the Past and Engage With the Public |
178822 |
/history/news/2020stories/summerundergraduateinternsexplorethepastandengagewiththepublic/ |
| In Grief and Anger |
178823 |
/history/news/2020stories/ingriefandanger/ |
| In Memoriam: Dr. Lawrence J. McCaffrey (1925-2020) |
178824 |
/history/news/2020stories/inmemoriamdrlawrencejmccaffrey1925-2020/ |
| Honor Societies, History Graduate Student Association, and History Club 2020 |
178825 |
/history/news/2020stories/honorsocietieshistorygraduatestudentassociationandhistoryclub2020/ |
| COVID-19 Shutdown in the History Department |
178826 |
/history/news/2020stories/covid-19shutdowninthehistorydepartment/ |
| 2020 History Department Awards Announced |
178827 |
/history/news/2020stories/2020historydepartmentawardsannounced/ |
| Public History Students Contribute to Suffrage Anniversary Blog |
178828 |
/history/news/2020stories/publichistorystudentscontributetosuffrageanniversaryblog/ |
| UHA Announces Executive Director Transition - Hope Shannon |
178829 |
/history/news/2020stories/uhaannouncesexecutivedirectortransition-hopeshannon/ |
| The Lili Elbe digital archive is now online! |
178830 |
/history/news/2020stories/thelilielbedigitalarchiveisnowonline/ |
| Timothy B. Neary Presents for 17th Annual Signum Fidei Lecture |
178831 |
/history/news/2020stories/timothybnearypresentsfor17thannualsignumfideilecture/ |
| Alum Maria Reynolds, Ph.D., Combines Ice Skating and History |
178832 |
/history/news/2020stories/alummariareynoldsphdcombinesiceskatingandhistory/ |
| archive |
196441 |
/history/news/2020stories/archive/ |
| 2019 Stories |
195754 |
/history/news/2019stories/ |
| archive |
196438 |
/history/news/2019stories/archive/ |
| 2018 Stories |
195755 |
/history/news/2018stories/ |
| archive |
196442 |
/history/news/2018stories/archive/ |
| 2017 Stories |
195783 |
/history/news/2017stories/ |
| archive |
196443 |
/history/news/2017stories/archive/ |
| 2016 Stories |
195784 |
/history/news/2016stories/ |
| archive |
196444 |
/history/news/2016stories/archive/ |
| 2015 Stories |
195785 |
/history/news/2015stories/ |
| archive |
196445 |
/history/news/2015stories/archive/ |
| 2014 Stories |
195786 |
/history/news/2014stories/ |
| 2013 Stories |
195787 |
/history/news/2013stories/ |
| Photos |
86287 |
/history/photos/ |
| archive |
86288 |
/history/photos/archive/ |
| Videos |
86285 |
/history/videos/ |
| Faculty Awards |
87784 |
/history/facultyawards/ |
| Faculty Books & Major Projects |
52784 |
/history/facultybooksmajorprojects/ |
| Contact Us |
72499 |
/history/contactus/ |
| People |
45240 |
/history/people/ |
| Faculty and Staff Directory |
199416 |
/history/people/facultyandstaffdirectory/ |
| Faculty by Theme |
199417 |
/history/people/facultyandstaffdirectory/facultybytheme/ |
| African American |
199418 |
/history/people/facultyandstaffdirectory/facultybytheme/africanamerican/ |
| Archaeology |
199419 |
/history/people/facultyandstaffdirectory/facultybytheme/archaeology/ |
| Book History |
199420 |
/history/people/facultyandstaffdirectory/facultybytheme/bookhistory/ |
| Cultural History |
199424 |
/history/people/facultyandstaffdirectory/facultybytheme/culturalhistory/ |
| Politics |
199440 |
/history/people/facultyandstaffdirectory/facultybytheme/politics/ |
| Women, Gender and Sexuality |
199447 |
/history/people/facultyandstaffdirectory/facultybytheme/womengenderandsexuality/ |
| Faculty by Region |
199458 |
/history/people/facultyandstaffdirectory/facultybyregion/ |
| Asia |
199460 |
/history/people/facultyandstaffdirectory/facultybyregion/asia/ |
| Europe |
199461 |
/history/people/facultyandstaffdirectory/facultybyregion/europe/ |
| United States |
199463 |
/history/people/facultyandstaffdirectory/facultybyregion/unitedstates/ |
| Emeritus Faculty |
199465 |
/history/people/facultyandstaffdirectory/emeritusfaculty/ |
| Profiles |
199466 |
/history/people/facultyandstaffdirectory/emeritusfaculty/profiles/ |
| In Memoriam |
199467 |
/history/people/facultyandstaffdirectory/inmemoriam/ |
| Profiles |
199468 |
/history/people/facultyandstaffdirectory/inmemoriam/profiles/ |
| Aggregate Profile Page |
202487 |
/history/people/facultyandstaffdirectory/aggregateprofilepage/ |
| Profiles |
199469 |
/history/people/facultyandstaffdirectory/aggregateprofilepage/profiles/ |
| right_column |
199481 |
/history/people/facultyandstaffdirectory/aggregateprofilepage/profiles/rightcolumn/ |
| Graduate Students |
204180 |
/history/currentstudents/currenthistorygraduatestudents/ |
| History Librarian |
47103 |
http://libguides.luc.edu/history |
| Undergraduate |
13955 |
/history/undergraduate.shtml |
| Why Major in History? |
69531 |
/history/whymajorinhistory/ |
| History Major |
178243 |
/history/historymajor/ |
| History Minor |
178244 |
/history/historyminor/ |
| Accelerated Master’s Pathway: History MA |
201707 |
https://catalog.luc.edu/undergraduate/accelerated-bachelors-masters-program/history-five-year-ba-ma-program/ |
| Advising |
13959 |
/history/requestinformation.shtml |
| Resources |
13945 |
/history/advising.shtml |
| Honors Program |
13948 |
/history/honors.shtml |
| Scholarships |
45115 |
/history/scholarships/ |
| Polish Resistance (AK) Foundation Scholarship |
14102 |
/history/Polish_History_Schol.shtml |
| John R. Jozwiak History Scholarship |
101713 |
/history/scholarships/johnrjozwiakhistoryscholarship/ |
| Double Dipping Policy |
104116 |
/history/doubledippingpolicy/ |
| Societies and Clubs |
45242 |
/history/societiesandclubs/ |
| Phi Alpha Theta: Honor Society |
14844 |
/history/societiesandclubs/phialphathetahonorsociety/ |
| right_column |
47823 |
/history/societiesandclubs/phialphathetahonorsociety/rightcolumn/ |
| Alpha Sigma Nu |
66528 |
/history/societiesandclubs/alphasigmanu/ |
| Awards and Essay Contests |
122372 |
/history/awardsandessaycontests/ |
| Undergraduate Essay Contest |
122373 |
/history/awardsandessaycontests/undergraduateessaycontest/ |
| Past Winners |
122376 |
/history/awardsandessaycontests/undergraduateessaycontest/pastwinners/ |
| History Blogging Contest |
122374 |
/history/awardsandessaycontests/historybloggingcontest/ |
| Past Winners |
122377 |
/history/awardsandessaycontests/historybloggingcontest/pastwinners/ |
| Paul S. Lietz Award for Outstanding Historical Scholarship |
122375 |
/history/awardsandessaycontests/paulslietzawardforoutstandinghistoricalscholarship/ |
| Newberry Library Undergraduate Seminar |
87659 |
/history/newberrylibraryundergraduateseminar/ |
| Internship Program |
13958 |
/history/internships.shtml |
| right_column |
86328 |
/history/rightcolumn/ |
| Courses |
199355 |
https://catalog.luc.edu/undergraduate/arts-sciences/history/ |
| Graduate |
13944 |
/history/academics.shtml |
| Welcome From the Program Director |
199365 |
/history/welcomefromtheprogramdirector/ |
| Prospective Students |
45247 |
/history/prospectivestudents/ |
| Current Students |
122237 |
/history/currentstudents/ |
| Current and Recent Course Offerings |
14005 |
/history/graduate/graduate_courses.shtml |
| Regularly Scheduled Courses |
14004 |
/history/graduate/grad_catalog_course_descriptions.shtml |
| Current History Graduate Students |
178797 |
/history/currentstudents/currenthistorygraduatestudents/ |
| Graduate Program Handbook |
71039 |
/history/graduateprogramhandbook/ |
| History Graduate Student Association (HGSA) |
45252 |
/history/historygraduatestudentassociationhgsa/ |
| Structure and Committees |
122192 |
/history/historygraduatestudentassociationhgsa/structureandcommittees/ |
| Current and Past Leadership |
14007 |
/history/graduate/officers.shtml |
| History Graduate Student Association Conference |
14006 |
/history/graduate/conference_test.shtml |
| Career Pathways |
106652 |
/history/careerpathways/ |
| Career Exploration |
207083 |
/history/careerpathways/careerexploration/ |
| Professional Development Resources |
207084 |
/history/careerpathways/professionaldevelopmentresources/ |
| Job Market Resources |
207085 |
/history/careerpathways/jobmarketresources/ |
| Events |
207086 |
/history/careerpathways/events/ |
| Alumni |
45245 |
/history/alumni/ |
| PhD Alumni Employment Information |
14000 |
/history/graduate/phdoutcomes.shtml |
| MA Alumni Employment Information |
87191 |
/history/alumni/maalumniemploymentinformation/ |
| MA Public History Alumni Employment Information |
55431 |
/history/alumni/mapublichistoryalumniemploymentinformation/ |
| Alumni Spotlight |
107615 |
/history/alumni/alumnispotlight/ |
| archive |
107616 |
/history/alumni/alumnispotlight/archive/ |
| Student Profiles |
123375 |
/history/alumni/studentprofiles/ |
| Profiles |
199579 |
/history/alumni/studentprofiles/profiles/ |
| MA Public History-MLIS Alumni Employment Information |
206955 |
/history/alumni/mapublichistory-mlisalumniemploymentinformation/ |
| McCluggage Award Competition |
122363 |
/history/mccluggageawardcompetition/ |
| Past Winners |
122364 |
/history/mccluggageawardcompetition/pastwinners/ |
| Public History |
147384 |
/history/publichistory/ |
| Public History Projects |
147394 |
/history/publichistory/publichistoryprojects/ |
| Catalog of Public History Projects |
147551 |
/history/publichistory/publichistoryprojects/catalogofpublichistoryprojects/ |
| History of Program |
147391 |
/history/publichistory/historyofprogram/ |
| Testimonials |
147392 |
/history/publichistory/testimonials/ |
| Oral Histories |
159157 |
/history/publichistory/oralhistories/ |
| Graduate Career Success |
147393 |
/history/publichistory/graduatecareersuccess/ |
| right_column |
199414 |
/history/publichistory/rightcolumn/ |
| fac_resources\NLUS |
13979 |
/history/fac_resources/nlus/application_form.shtml |
| KD Embed test |
14015 |
/history/KD_Embed_Test.shtml |
| Footer |
14088 |
/history/footer/ |
| site_logo |
14089 |
/history/sitelogo/ |
| Midnight Bike Ride |
62059 |
/history/midnightbikeride/ |
| White Cities, Linguistic Turns, and Disneylands: The New Paradigms of Urban History |
62065 |
/history/whitecitieslinguisticturnsanddisneylandsthenewparadigmsofurbanhistory/ |
| Election 2016 |
98240 |
/history/election2016/ |
| social media |
199322 |
/history/socialmedia/ |
| cta |
199323 |
/history/cta/ |
| I Links |
199324 |
/history/ilinks/ |
| modules-programming |
199325 |
/history/modules-programming/ |
| Holiday Cards Central |
166683 |
/holidayecards/ |
| site_logo |
166684 |
/holidayecards/sitelogo/ |
| Footer |
166686 |
/holidayecards/footer/ |
| Honors |
70845 |
/honors/ |
| site_logo |
70884 |
/honors/site_logo/ |
| Footer |
85696 |
/honors/footer/ |
| cta |
200618 |
/honors/cta/ |
| About Us |
70853 |
/honors/aboutus/ |
| Contact Us |
70858 |
/honors/aboutus/contactus/ |
| Profiles |
201446 |
/honors/aboutus/contactus/profiles/ |
| Honors Event Highlights |
205299 |
/honors/aboutus/honorseventhighlights/ |
| Honors Magazine |
163045 |
/honors/honorsmagazine/ |
| Loyola at A Glance |
163042 |
https://www.luc.edu/about.shtml |
| Program Admission |
70876 |
/honors/aboutus/programadmission/ |
| Program Description |
161513 |
/honors/aboutus/programdescription/ |
| Visit Loyola |
161516 |
https://www.luc.edu/undergrad/comevisit/ |
| Community |
161874 |
/honors/community/ |
| Honors Magazine |
163046 |
/honors/honorsmagazine/ |
| Honors Residence Experience |
161951 |
/honors/community/honorsresidenceexperience/ |
| Honors Student Groups |
161953 |
/honors/community/honorsstudentgroups/ |
| Honors BIPOC Coalition (HBC) |
161955 |
/honors/community/honorsstudentgroups/hbc/ |
| Honors Mentors |
162181 |
/honors/community/honorsstudentgroups/mentors/ |
| Honors Student Government |
162073 |
/honors/community/honorsstudentgroups/hsa/ |
| Loyola and Chicago |
162309 |
https://www.luc.edu/about/chicago.shtml |
| LUC Student Government |
162308 |
https://www.luc.edu/sglc/ |
| LUC Student Life |
162307 |
https://www.luc.edu/saga/ |
| Service |
161952 |
/honors/community/service/ |
| YouTube Channel |
177910 |
https://www.youtube.com/channel/UCgtEysiZJ263NRZT2sPMdMg/featured |
| Campus Ministry |
192227 |
https://www.luc.edu/campusministry/index.shtml |
| In Memoriam |
166481 |
/honors/community/inmemoriam/ |
| Student Resources |
191985 |
/honors/studentresources/ |
| End of Year Checklist |
196452 |
/honors/studentresources/endofyearchecklist/ |
| Academic Calendars |
161937 |
https://www.luc.edu/academics/schedules/index.shtml#calendars |
| Academic Integrity |
161938 |
https://www.luc.edu/media/lucedu/cas/pdfs/academicintegrity.pdf |
| Academic Plan Resources |
180327 |
https://www.luc.edu/fsya/currentstudents/academicplanning/ |
| Advising |
162154 |
/honors/studentresources/advising/ |
| Awards |
161940 |
/honors/studentresources/awards/ |
| Honors Student Award Winners |
162253 |
/honors/studentresources/awards/honorsstudentawardwinners/ |
| Course Descriptions by Semester |
80872 |
/honors/studentresources/coursedescriptionsbysemester/ |
| Curriculum |
161943 |
/honors/studentresources/curriculum/ |
| Course Descriptions |
163044 |
/honors/studentresources/curriculum/coursedescriptions/ |
| Honors Magazine |
192229 |
https://www.luc.edu/honors/honorsmagazine/ |
| The Honors Program and the University Core |
161942 |
/honors/studentresources/thehonorsprogramandtheuniversitycore/ |
| The Honors Undergraduate Conference |
161946 |
/honors/studentresources/thehonorsundergraduateconference/ |
| Research Opportunities |
161945 |
/honors/studentresources/researchopportunities/ |
| Scholarships |
162251 |
/honors/studentresources/scholarships/ |
| Study Abroad |
166482 |
/honors/studentresources/studyabroad/ |
| Writing and Research Tools |
163059 |
/honors/studentresources/writingandresearchtools/ |
| Conferences |
201401 |
/honors/studentresources/conferences/ |
| Faculty Resources |
191926 |
/honors/facultyresources/ |
| Certificate in Experiential Learning |
192027 |
https://www.luc.edu/celts/engagedteachingscholarship/facultydevelopmentprograms/facultycertificateinexperientiallearning/ |
| Instructional Technology and Research Support |
192028 |
https://www.luc.edu/its/itrs/ |
| Teaching and Learning Workshops |
192029 |
https://www.luc.edu/fcip/student-centereddesign/student-centereddesignprograms/ |
| Faculty Pathway Series |
192030 |
https://www.luc.edu/academicaffairs/facultyaffairs/facultydevelopment/centerforfacultyexcellence/facultypathwayseries/ |
| Alumni |
99594 |
/honors/alumni/ |
| Alumni Awards |
163037 |
https://www.alumni.luc.edu/s/1548/alumni/index.aspx?sid=1548&gid=2&pgid=3948 |
| Alumni Weekend |
161959 |
https://www.luc.edu/alumniweekend/ |
| Event Calendar |
161961 |
https://www.alumni.luc.edu/s/1548/alumni/social.aspx?sid=1548&gid=2&pgid=401 |
| Loyola Travels |
161964 |
https://www.alumni.luc.edu/s/1548/alumni/social.aspx?sid=1548&gid=2&pgid=435 |
| Loyola at 150: Student Life Timeline |
166691 |
http://libapps.luc.edu/digitalexhibits/s/150-student-life-timeline/page/welcome |
| Make a Gift |
161966 |
https://securelb.imodules.com/s/1548/alumni/giving.aspx?sid=1548&gid=2&pgid=497&cid=1256&dids=479&bledit=1&appealcode=23Y13 |
| Retreats |
161963 |
https://www.alumni.luc.edu/s/1548/alumni/social.aspx?sid=1548&gid=2&pgid=3276 |
| Service |
161962 |
https://www.alumni.luc.edu/s/1548/alumni/social.aspx?sid=1548&gid=2&pgid=2620 |
| Update Your Contact Information |
161965 |
https://www.alumni.luc.edu/s/1548/alumni/index.aspx?sid=1548&gid=2&pgid=669 |
| Andrew Leith |
105310 |
/honors/alumni/andrewleith/ |
| Tommy Jorgensen |
105887 |
/honors/alumni/tommyjorgensen/ |
| Dana Dahhan |
109660 |
/honors/alumni/danadahhan/ |
| Senior Speeches |
109776 |
/honors/alumni/seniorspeeches/ |
| Stephanie Wong |
120273 |
/honors/alumni/stephaniewong/ |
| Honors Magazine |
163047 |
/honors/honorsmagazine/ |
| Honors Magazine |
162152 |
/honors/honorsmagazine/ |
| Human Resources |
195197 |
/hr/ |
| site_logo |
195465 |
/hr/sitelogo/ |
| Footer |
195466 |
/hr/footer/ |
| social media |
195469 |
/hr/socialmedia/ |
| modules-programming |
195471 |
/hr/modules-programming/ |
| About Us |
195198 |
/hr/aboutus/ |
| Contact Us |
195199 |
/hr/aboutus/contactus/ |
| Archived News |
195201 |
/hr/news/ |
| archive |
195202 |
/hr/news/archive/ |
| Careers |
195207 |
/hr/careers/ |
| right_column |
195210 |
/hr/careers/rightcolumn/ |
| Faculty/Staff Opportunities |
195211 |
/hr/careers/facultystaffopportunities/ |
| Internal Opportunities |
200744 |
/hr/careers/internalopportunities/ |
| Student Employment |
195208 |
/hr/careers/studentemployment/ |
| PeopleAdmin 7.6 (Employment Applicant System) |
195212 |
/hr/careers/peopleadmin76employmentapplicantsystem/ |
| Faculty & Staff Benefits |
195217 |
/hr/benefits/ |
| right_column |
195274 |
/hr/benefits/rightcolumn/ |
| Benefits Descriptions |
200533 |
/hr/benefits/benefitsdescription/ |
| Accident and Critical Illness Insurance |
195304 |
/hr/benefits/accidentandcriticalillnessinsurance/ |
| right_column |
195305 |
/hr/benefits/accidentandcriticalillnessinsurance/rightcolumn/ |
| Benefits Advisory Committee |
195315 |
/hr/benefits/benefitsadvisorycommittee/ |
| Dental Insurance |
195299 |
/hr/benefits/dentalinsurance/ |
| right_column |
195300 |
/hr/benefits/dentalinsurance/rightcolumn/ |
| Eligibility and Enrollment |
195224 |
/hr/enrollment/ |
| Reporting Your Qualified Life Event |
195225 |
/hr/enrollment/reportingyourqualifiedlifeevent/ |
| Employee Assistance Program |
195222 |
/hr/eap/ |
| right_column |
195223 |
/hr/eap/rightcolumn/ |
| First Stop Health |
195316 |
/hr/benefits/firststophealth/ |
| Flexible Spending Accounts |
195306 |
/hr/benefits/flexiblespendingaccounts/ |
| Health Care FSA |
195307 |
/hr/benefits/flexiblespendingaccounts/healthcarefsa/ |
| Dependent Care FSA |
195308 |
/hr/benefits/flexiblespendingaccounts/dependentcarefsa/ |
| Limited FSA |
195309 |
/hr/benefits/flexiblespendingaccounts/limitedfsa/ |
| right_column |
195310 |
/hr/benefits/flexiblespendingaccounts/rightcolumn/ |
| Health Insurance |
195226 |
/hr/health/ |
| Aetna's 24-Hour Nurse Line |
195230 |
/hr/health/aetnas24-hournurseline/ |
| Aetna Simple Steps to a Healthier Life |
195237 |
/hr/health/aetnasimplestepstoahealthierlife/ |
| COBRA |
195227 |
/hr/cobra/ |
| right_column |
195228 |
/hr/cobra/rightcolumn/ |
| Flu Vaccine |
195238 |
/hr/health/fluvaccine/ |
| Loyola Prescription (Rx) Plan |
195235 |
/hr/health/loyolaprescriptionrxplan/ |
| Smoking Cessation Resources |
195233 |
/hr/health/smokingcessationresources/ |
| Spousal/LDA Premium - FAQs |
195232 |
/hr/health/spousalldapremium-faqs/ |
| Teladoc - 24/7 Medical Assistance |
195231 |
/hr/health/teladoc-247medicalassistance/ |
| Tobacco Premium - FAQs |
195234 |
/hr/health/tobaccopremium-faqs/ |
| right_column |
195229 |
/hr/health/rightcolumn/ |
| Medical Glossary |
195236 |
/hr/health/medicalglossary/ |
| Health Savings Account |
195312 |
/hr/benefits/healthsavingsaccount/ |
| right_column |
195313 |
/hr/benefits/healthsavingsaccount/rightcolumn/ |
| Leave of Absence & Disability Insurance |
195218 |
/hr/benefits_disabilityinsurance/ |
| right_column |
195219 |
/hr/benefits_disabilityinsurance/rightcolumn/ |
| Short-Term Disability |
195220 |
/hr/policies/policy_shorttermdisability/ |
| Leave of Absence Checklist |
195221 |
/hr/benefits_disabilityinsurance/leaveofabsencechecklist/ |
| Life Insurance |
195240 |
/hr/life-insurance/ |
| right_column |
195241 |
/hr/life-insurance/rightcolumn/ |
| Long-Term Care Insurance |
195289 |
/hr/electivebenefits/longtermcareinsurance/ |
| right_column |
195290 |
/hr/electivebenefits/longtermcareinsurance/rightcolumn/ |
| Mental Health Support/Resources |
195314 |
/hr/benefits/mentalhealthsupportresources/ |
| Retirement 403(b) Plan |
195246 |
/hr/benefits_retirement.shtml |
| right_column |
195247 |
/hr/rightcolumn/ |
| Retiree Information |
195242 |
/hr/retirees/ |
| Loyola University Employees' Retirement Plan (LUERP) |
195245 |
/hr/luerp/ |
| Medicare Facts and FAQs |
195244 |
/hr/retirees/medicarefactsandfaqs/ |
| right_column |
195243 |
/hr/retirees/rightcolumn/ |
| Tuition Benefit |
195311 |
/hr/benefits/tuitionbenefit/ |
| Vision Insurance |
195301 |
/hr/benefits/visioninsurance/ |
| right_column |
195302 |
/hr/benefits/visioninsurance/rightcolumn/ |
| Wellness Program |
195275 |
/hr/wellness/ |
| Aetna's 24-Hour Nurse Line |
195802 |
/hr/health/aetnas24-hournurseline/ |
| Aetna Simple Steps to a Healthier Life |
195803 |
/hr/health/aetnasimplestepstoahealthierlife/ |
| CPR Certification Course |
195284 |
/hr/wellness/cprcertificationcourse/ |
| Equinox Fitness + Loyola University Chicago |
195280 |
/hr/wellness/equinoxfitnessloyolauniversitychicago/ |
| Loyola Fitness Center Membership |
195285 |
/hr/wellness/loyolafitnesscentermembership/ |
| Smoking Cessation Resources |
195804 |
/hr/health/smokingcessationresources/ |
| Teladoc - 24/7 Medical Assistance |
195805 |
/hr/health/teladoc-247medicalassistance/ |
| WW® (Weight Watchers Reimagined) |
195276 |
/hr/ww_reimbursement_program/ |
| right_column |
195277 |
/hr/ww_reimbursement_program/rightcolumn/ |
| right_column |
195278 |
/hr/wellness/rightcolumn/ |
| Work-Life-Benefits |
195249 |
/hr/benefits/work-life-benefits/ |
| Accident and Critical Illness Insurance |
195806 |
/hr/benefits/accidentandcriticalillnessinsurance/ |
| Adoption Assistance Program |
195256 |
/hr/benefits/work-life-benefits/adoptionassistanceprogram/ |
| Credit Union |
195257 |
/hr/work-life-benefits/loyolacreditunion/ |
| Discounts |
195807 |
/hr/resources/discounts/ |
| Housing Program |
195250 |
/hr/uahprogram/ |
| UNIVERSITY ASSISTED HOUSING PROGRAM - Application Form |
195251 |
/hr/forms/uah_app/ |
| THANK YOU |
195252 |
/hr/forms/uah-thankyou.shtml |
| right_column |
195253 |
/hr/uahprogram/rightcolumn/ |
| KinderCare |
195266 |
/hr/benefits/work-life-benefits/kindercare/ |
| right_column |
195267 |
/hr/benefits/work-life-benefits/kindercare/rightcolumn/ |
| Long-Term Care Insurance |
195808 |
/hr/electivebenefits/longtermcareinsurance/ |
| MetLife Legal |
195258 |
/hr/electivebenefits/grouplegalplan/ |
| right_column |
195259 |
/hr/electivebenefits/grouplegalplan/rightcolumn/ |
| Nationwide - Veterinary Pet Insurance |
195260 |
/hr/pet-insurance/ |
| right_column |
195261 |
/hr/pet-insurance/rightcolumn/ |
| Transit Benefit |
195254 |
/hr/transit/ |
| right_column |
195255 |
/hr/transit/rightcolumn/ |
| Benefit Document Library |
195318 |
https://cld.bz/c/sy7N6a?utm_medium=email&utm_source=transactional&utm_campaign=CldBz-Share-Collection |
| Compensation |
195445 |
/hr/compensation/ |
| right_column |
195449 |
/hr/compensation/rightcolumn/ |
| Pay & Holiday Calendar |
195447 |
/hr/holiday-calendar/ |
| Total Compensation Statement |
195448 |
/hr/total-rewards/ |
| Training & Development |
195450 |
/hr/trainingdevelopment/ |
| right_column |
195459 |
/hr/trainingdevelopment/rightcolumn/ |
| Annual Compliance Training |
195460 |
/hr/trainingdevelopment/annualcompliancetraining/ |
| Leadership Essentials Program |
195456 |
/hr/professionaldevelopment/emerge/ |
| Employee Assistance Program |
195809 |
/hr/eap/ |
| Executive and Professional Education |
195458 |
/hr/professionaldevelopment/executiveeducation/ |
| Information Technology Services - Training Central |
195457 |
/hr/professionaldevelopment/itstrainingcentral/ |
| Skillsoft: Business Skills |
195463 |
/hr/trainingdevelopment/skillsoftbusinessskills/ |
| Employee Resources |
195319 |
/hr/resources/ |
| right_column |
195437 |
/hr/resources/rightcolumn/ |
| 2026 Feast Day of St. Ignatius Mass and Picnic |
202745 |
/hr/resources/2026feastdayofstignatiusmassandpicnic/ |
| Manager Resources |
195324 |
/hr/manager_resources.shtml |
| Applicant Review and Hiring Guide |
195354 |
/hr/applicantreviewandhiringguide/ |
| Background Checks |
195326 |
/hr/recruitmentguide_backgroundchecks.shtml |
| Candidate Review Guide |
195336 |
/hr/recruitmentguide_fac_candidatereview1.shtml |
| Chair Duties |
195327 |
/hr/recruitmentguide_chair.shtml |
| Committee Member Duties |
195329 |
/hr/recruitmentguide_fac_memberduties.shtml |
| Creating a Job Description |
195355 |
/hr/creatingajobdescription/ |
| Department Orientation |
195325 |
/hr/managerresources_deptorientation.shtml |
| Faculty Candidate Review Guide |
195330 |
/hr/recruitmentguide_fac_candidatereview.shtml |
| Guidelines for Forming a Search Committee |
195337 |
/hr/recruitmentguide_search.shtml |
| Interview Questions to Avoid |
195334 |
/hr/recruitmentguide_interviewq'stoavoid.shtml |
| Interviewing Candidates |
195338 |
/hr/recruitmentguide_Tips4conductinginterview.shtml |
| Job and Salary Offer |
195335 |
/hr/recruitmentguide_job_and_salary_offer.shtml |
| Position Sourcing Ideas |
195339 |
/hr/recruitmentguide_fac_sourcing.shtml |
| Post Recruitment Guide |
195331 |
/hr/recruitmentguide.shtml |
| Reference Checks |
195340 |
/hr/recruitmentguide_refchecks.shtml |
| Sample Interview Questions for Any Position |
195342 |
/hr/recruitmentguide_Sample_Interview_Questions_for_any_type_of_.shtml |
| Sample Interview Questions for Faculty |
195343 |
/hr/recruitmentguide_fac_interviewQ's.shtml |
| Sample Interview Questions for Managerial Positions |
195344 |
/hr/recruitmentguide_managerinterviewq's.shtml |
| Sample Interview Questions for Non-Managerial Positions |
195341 |
/hr/sampleinterviewquestionsfornon-managerialpositions/ |
| Sample Reference Check Questions |
195345 |
/hr/samplereferencecheckquestions/ |
| Sample Telephone Pre-Screen Questions |
195346 |
/hr/sampletelephonepre-screenquestions/ |
| Screening Candidates |
195347 |
/hr/screeningcandidates/ |
| Search Committee Guide |
195348 |
/hr/searchcommitteeguide/ |
| Staff Pre-Recruitment Guide |
195349 |
/hr/staffpre-recruitmentguide/ |
| Staff Recruitment and Hiring Guide |
195350 |
/hr/staffrecruitmentandhiringguide/ |
| Tips on Forming a Search Committee |
195351 |
/hr/tipsonformingasearchcommittee/ |
| right_column |
195353 |
/hr/rightcolumn/ |
| Accommodation |
195410 |
/hr/legalnotices/requestsforreasonableaccommodationfordisability/ |
| right_column |
195411 |
/hr/legalnotices/requestsforreasonableaccommodationfordisability/rightcolumn/ |
| Committees |
195417 |
/hr/resources/committees/ |
| Retirement Committee DCRP |
195418 |
/hr/retirementcommitteedcrp/ |
| Discounts |
195419 |
/hr/resources/discounts/ |
| Chicagoland Restaurants |
195423 |
/hr/resources/discounts/chicagolandrestaurants/ |
| Divvy |
195422 |
/hr/divvy/ |
| National Seminars Rockhurst University |
195420 |
/hr/professionaldevelopment/nationalseminarsrockhurstuniversity/ |
| Diversity and Inclusion at Loyola |
195416 |
/hr/diversity/ |
| Employee Self-Service |
195414 |
/secure/hr/selfservice/ |
| Employment & Income Verification Service |
195412 |
/hr/employmentincomeverificationservice/ |
| Public Service Loan Forgiveness |
195413 |
/hr/employmentincomeverificationservice/publicserviceloanforgiveness/ |
| EthicsLine Reporting Hotline |
195415 |
/hr/ethics/ |
| Faculty Council |
195407 |
/hr/professionaldevelopment/facultycouncil/ |
| Form 1095-C |
195425 |
/hr/resources/form1095-c/ |
| Forms |
195400 |
/hr/forms/ |
| New Federal Form W-4 |
195404 |
/hr/forms/newfederalformw-4/ |
| Change of Address |
195401 |
/hr/forms/change-of-address/ |
| Form 1095-C |
195810 |
/hr/resources/form1095-c/ |
| Handbooks |
195321 |
/hr/handbooks/ |
| Legal Notices |
195322 |
/hr/legal-notices/ |
| Mandated Reporting of Child Abuse and Neglect |
195323 |
/hr/legal-notices/mandatedreportingofchildabuseandneglect/ |
| llinois Mandates Pay Transparency in Job Postings Starting January 1, 2025 |
200532 |
/hr/legal-notices/llinoismandatespaytransparencyinjobpostingsstartingjanuary12025/ |
| Hiring a Student Worker & Processing HR Paperwork |
195431 |
/hr/resources/hiringastudentworkerprocessinghrpaperwork/ |
| Form I-9 |
195432 |
/hr/resources/hiringastudentworkerprocessinghrpaperwork/formi-9/ |
| Sick Leave Policy |
195811 |
/hr/policies/sick-leave/ |
| right_column |
195436 |
/hr/resources/hiringastudentworkerprocessinghrpaperwork/rightcolumn/ |
| Hiring with Purpose |
206986 |
https://loyolauniversitychicago.sharepoint.com/sites/LoyolaOrientationandOnboardingProgram |
| Human Resources Policies |
195356 |
/hr/policies/ |
| Animals on Campus Policy |
197157 |
/hr/policies/animalsoncampuspolicy/ |
| Anti-Nepotism Policy |
195394 |
/hr/policies/anti-nepotismpolicy/ |
| Chicago Paid Leave Ordinance Policy |
197957 |
/hr/policies/chicagopaidleaveordinancepolicy/ |
| Code of Conduct |
195358 |
/hr/policies/policy_codeofconductpolicy/ |
| Conflict of Interest |
195362 |
/hr/policies/policy_conflictofinterest/ |
| Consensual Relationships Policy |
195395 |
/hr/policies/consensualrelationshipspolicy/ |
| Drug and Alcohol Abuse |
195363 |
/hr/policies/policy_drugalcoholabuse/ |
| Employee Relations |
195364 |
/hr/policies/policy_emprelations/ |
| Employment Review Period |
195365 |
/hr/policies/policy_empreview/ |
| Equal Opportunity, Affirmative Action and Nondiscrimination Policy |
195366 |
/hr/policies/policy_equalopp/ |
| right_column |
195367 |
/hr/policies/policy_equalopp/rightcolumn/ |
| Fitness For Duty |
195368 |
/hr/policies/policy_fitness/ |
| General Leave of Absence and Family/Medical Leave Act |
195369 |
/hr/policies/policy_loafmla/ |
| right_column |
195370 |
/hr/policies/policy_loafmla/rightcolumn/ |
| Holiday Policy |
195359 |
/hr/policies/holiday/ |
| Long-Term Disability |
195393 |
/hr/policies/policy_longtermdisability.shtml |
| Overtime/Compensation |
195371 |
/hr/policies/policy_overtime/ |
| Pay Classification |
195372 |
/hr/policies/policy_payclass/ |
| Paid Parental Leave |
195392 |
/hr/policies/paidparentalleave/ |
| Personal/Family-Friendly Days Policy |
195361 |
/hr/policies/personal-time/ |
| Policy on Policies |
195373 |
/hr/policies/policy_policies/ |
| Post-Offer Physical and Drug Screening |
195374 |
/hr/policies/policy_postofferscreening/ |
| Progressive Discipline |
195375 |
/hr/policies/policy_progdiscipline/ |
| Recruitment and Employment |
195376 |
/hr/policies/policy_employment/ |
| Security of Property |
195377 |
/hr/policies/policy_securityofproperty/ |
| Sexual Harassment |
195378 |
/hr/policies/policy_sexualharassment/ |
| right_column |
195379 |
/hr/policies/policy_sexualharassment/rightcolumn/ |
| Short-Term Disability |
195388 |
/hr/policies/policy_shorttermdisability/ |
| Sick-Leave Policy |
195384 |
/hr/policies/sick-leave/ |
| Chicago Leave Ordinances |
195386 |
/hr/policies/sick-leave/chicagoleaveordinances/ |
| Smoke and Tobacco-Free Campus Policy |
195360 |
/hr/policies/policy_nonsmoking/ |
| Staff and Librarian Teaching |
195380 |
/hr/policies/policy_slteaching/ |
| Tuition Benefit Policy |
195390 |
/hr/policies/tuition/ |
| right_column |
195391 |
/hr/policies/tuition/rightcolumn/ |
| Vacation Policy |
195357 |
/hr/policies/vacation/ |
| Wage Information |
195381 |
/hr/policies/policy_wageinfo/ |
| Workforce Reduction Policy |
195383 |
/hr/policies/policy_workforcereduction/ |
| Workers' Compensation Policy |
195382 |
/hr/policies/policy_workerscomp/ |
| Workplace Strategies |
195389 |
/hr/policies/workplacestrategies/ |
| Loyola Orientation & Onboarding Program (LOOP) 101 |
206987 |
https://loyolauniversitychicago.sharepoint.com/sites/LoyolaOrientationandOnboardingProgram |
| Onboarding - Benefits Enrollment |
195426 |
/hr/resources/onboarding-benefitsenrollment/ |
| right_column |
195696 |
/hr/resources/onboarding-benefitsenrollment/rightcolumn/ |
| Organizational Charts |
202814 |
https://www.luc.edu/universityleadership/organizationalcharts/ |
| Paid Time Off |
195396 |
/hr/paid-time-off/ |
| right_column |
195397 |
/hr/paid-time-off/rightcolumn/ |
| Pregnant & Parenting Resources |
195430 |
/hr/resources/pregnantparentingresources/ |
| Resignation & Exit Process |
195320 |
/hr/resignation/ |
| Summary Annual Reports (SARs) |
195408 |
/hr/summaryannualreportssar/ |
| Supporting Departments After Loss |
207582 |
/hr/resources/supportingdepartmentsafterloss/ |
| Title IX |
195444 |
/hr/resources/titleix/ |
| Unemployment Insurance Fraud |
195442 |
/hr/resources/unemploymentinsurancefraud/ |
| University Policies |
195424 |
/hr/university-policies/ |
| University Staff Council |
195406 |
/hr/professionaldevelopment/staffcouncil/ |
| Vaccine Recommendations and Requirements |
195443 |
/hr/resources/vaccinerecommendationsandrequirements/ |
| Tools |
195472 |
/hr/tools/ |
| Bias Reporting |
195510 |
/hr/tools/biasreporting.shtml |
| right_column |
195511 |
/hr/tools/biasreporting/rightcolumn/ |
| Candidate Review and Selection |
195477 |
/hr/tools/managerresources_candidateselection.shtml |
| Career Opportunities at Loyola |
195478 |
/hr/tools/handbookstaff_careeropps.shtml |
| Employee Responsibility |
195479 |
/hr/tools/handbookstaff_empresponsibility.shtml |
| Employee Staff Handbook |
195480 |
/hr/tools/handbook_employee.shtml |
| Faculty Handbook |
195481 |
/hr/tools/handbook_faculty.html |
| Hours of Work and Pay |
195482 |
/hr/tools/handbookstaff_workandpayhrs.shtml |
| Information for New Employees to Know |
195483 |
/hr/tools/resourcestools_infofornewee.shtml |
| LDAP |
195512 |
/secure/hr/ |
| Loyola Vocabulary |
195484 |
/hr/tools/resourcestools_loyolavocab.shtml |
| LUERP Estimate Request Form |
195475 |
/hr/forms/luerp_estimate.shtml |
| Thank You. |
195476 |
/hr/forms/luerp_thankyou.shtml |
| Manager Resources, Recruitment & Hiring Guide |
195485 |
/hr/tools/managerresources_recruitmentandhiring.shtml |
| Maps and Directions |
195506 |
/hr/tools/mapsanddirections.shtml |
| New Employee Resources |
195513 |
/hr/tools/newemployeeresources/ |
| New Hire Employee Packet Instructions |
195507 |
/hr/tools/forms_newemp.shtml |
| Performance Management |
195487 |
/hr/tools/managerresources_process.shtml |
| Purpose of Handbook |
195489 |
/hr/tools/handbookstaff_purpose.shtml |
| Resources |
195490 |
/hr/tools/resources.shtml |
| Sample Interview Questions |
195491 |
/hr/tools/managerresources_sampleintquestions.shtml |
| Service and Service Recognition |
195492 |
/hr/tools/handbookstaff_service.shtml |
| Services Available |
195496 |
/hr/tools/handbookstaff_servicesavailable.shtml |
| Sick Leave |
195497 |
/hr/tools/policy_sickleave.shtml |
| Student Worker Employment Guide |
195498 |
/hr/sweg/index.shtml |
| Career Opportunities |
195500 |
/hr/sweg/careeropportunities/ |
| Benefits & Services |
195501 |
/hr/sweg/benefitsservices/ |
| Equal Opportunity Employment |
195502 |
/hr/sweg/equalopportunityemployment/ |
| Pay & Pay Related Information |
195503 |
/hr/sweg/paypayrelatedinformation/ |
| Purpose of the Student Worker Employment Guide |
195499 |
/hr/sweg/purposeofthestudentworkeremploymentguide/ |
| Your Responsibility As An Employee |
195504 |
/hr/sweg/yourresponsibilityasanemployee/ |
| Tuition Benefit |
195720 |
/hr/benefits/tuitionbenefit/ |
| Human Services |
28440 |
/humanservices/index.shtml |
| right_column |
88052 |
/humanservices/rightcolumn/ |
| Academics |
28430 |
/humanservices/academics.html |
| BS in Human Services |
28431 |
/humanservices/bs.shtml |
| right_column |
88053 |
/humanservices/rightcolumn/ |
| Financial Aid |
28436 |
/humanservices/financial.html |
| right_column |
88054 |
/humanservices/rightcolumn/ |
| right_column |
88055 |
/humanservices/rightcolumn/ |
| Apply Now |
28435 |
/humanservices/apply.html |
| Request Information |
28437 |
/humanservices/requestinformation.html |
| site_logo |
28461 |
/humanservices/sitelogo/ |
| Footer |
28465 |
/humanservices/footer/ |
| Information Commons |
12868 |
/ic/index.shtml |
| Welcome |
12813 |
/ic/about.shtml |
| Directory |
12819 |
/ic/staff.shtml |
| Environmental Features |
12820 |
/ic/environment.shtml |
| Floor Maps |
12821 |
/ic/Floor_Maps.shtml |
| Hours |
12824 |
/ic/hours/ |
| For Student Communication |
59370 |
/ic/forstudentcommunication/ |
| right_column |
88015 |
/ic/rightcolumn/ |
| Library Services |
59635 |
/ic/libraryservices/ |
| Ask A Librarian |
49069 |
http://libraries.luc.edu/ask |
| Congressional Archives |
49083 |
/ic/libraryservices/congressionalarchives/ |
| Databases (By Title) |
49070 |
http://libraries.luc.edu/databases |
| Read the Library Blog (Noteworthy News) |
49071 |
http://blogs.lib.luc.edu/locl/ |
| Research Guides |
49072 |
http://libraries.luc.edu/subjectguides |
| Information Technology Services |
59636 |
/ic/informationtechnologyservices/ |
| Assistive Technology |
49079 |
/ic/informationtechnologyservices/assistivetechnology/ |
| Computer Labs & Printing |
12861 |
/ic/computing.shtml |
| Digital Media Support |
12856 |
/ic/techadvisors.shtml |
| Equipment Loan |
12865 |
/ic/dmsequipment.shtml |
| Alumni & Guest Computers |
111741 |
/ic/informationtechnologyservices/alumniguestcomputers/ |
| Faculty Drop-In & Statistical Advising |
49104 |
https://www.luc.edu/its/learningtechnologies/teamdirectory/ |
| ITS Service Desk |
49103 |
/its/aboutus/itsservicedesk/ |
| Video Conferencing |
49110 |
/ic/informationtechnologyservices/videoconferencing/ |
| right_column |
188422 |
/ic/informationtechnologyservices/rightcolumn/ |
| Other Services |
59637 |
/ic/otherservices/ |
| Writing Center |
12857 |
/ic/writingcenter.shtml |
| Footer |
12873 |
/ic/footer/ |
| site_logo |
12876 |
/ic/sitelogo/ |
| social media |
202075 |
/ic/socialmedia/ |
| modules-programming |
202076 |
/ic/modules-programming/ |
| Information Technology Services (ITS) |
159736 |
/its/ |
| About Us |
177834 |
/its/aboutus/ |
| ITS Governance |
163508 |
/its/aboutus/itsgovernance/ |
| LDAP Protected Test Page |
180386 |
/its/aboutus/itsgovernance/ldapprotectedtestpage/ |
| ITS Policies & Guidelines |
169011 |
/its/aboutus/itspoliciesguidelines/ |
| right_column |
185617 |
/its/aboutus/itspoliciesguidelines/rightcolumn/ |
| Access Control Policy |
180419 |
/its/aboutus/itspoliciesguidelines/accesscontrolpolicy/ |
| Acceptable Use Policy for Electronic University Resources |
180403 |
/its/aboutus/itspoliciesguidelines/acceptableusepolicyforelectronicuniversityresources/ |
| Acceptable Use Policy for University Computer Labs |
203929 |
/its/aboutus/itspoliciesguidelines/acceptableusepolicyforuniversitycomputerlabs/ |
| Antivirus Policy |
180432 |
/its/aboutus/itspoliciesguidelines/antiviruspolicy/ |
| Change Management Policy |
180420 |
/its/aboutus/itspoliciesguidelines/changemanagementpolicy/ |
| Cloud Computing Policy |
180405 |
/its/aboutus/itspoliciesguidelines/cloudcomputingpolicy/ |
| Computer Security Standard |
180421 |
/its/aboutus/itspoliciesguidelines/computersecuritystandard/ |
| Data Breach Response Policy |
180422 |
/its/aboutus/itspoliciesguidelines/databreachresponsepolicy/ |
| Data Classification Policy |
180404 |
/its/aboutus/itspoliciesguidelines/dataclassificationpolicy/ |
| Digital Surveillance Governance Policy |
180423 |
/its/aboutus/itspoliciesguidelines/digitalsurveillancegovernancepolicy/ |
| Disposal of Sensitive Data |
180424 |
/its/aboutus/itspoliciesguidelines/disposalofsensitivedata/ |
| DMCA Policy |
180408 |
/its/aboutus/itspoliciesguidelines/dmcapolicy/ |
| Electronic Mail and Voicemail Use and Disclosure |
180426 |
/its/aboutus/itspoliciesguidelines/electronicmailandvoicemailuseanddisclosure/ |
| Electronic Security & Sensitive Data |
180427 |
/its/aboutus/itspoliciesguidelines/electronicsecuritysensitivedata/ |
| E-Mail Retention FAQ |
180425 |
/its/aboutus/itspoliciesguidelines/e-mailretentionfaq/ |
| Emeritus Support Policy |
202383 |
/its/aboutus/itspoliciesguidelines/emeritussupportpolicy/ |
| Encryption Policy |
180428 |
/its/aboutus/itspoliciesguidelines/encryptionpolicy/ |
| GDPR Data Protection Privacy Notice |
180458 |
/its/aboutus/itspoliciesguidelines/gdprdataprotectionprivacynotice/ |
| Hardware-Software Purchase Policy |
180429 |
/its/aboutus/itspoliciesguidelines/hardware-softwarepurchasepolicy/ |
| HIPAA Information |
180459 |
/its/aboutus/itspoliciesguidelines/hipaainformation/ |
| The 18 HIPAA Identifiers |
180460 |
/its/aboutus/itspoliciesguidelines/hipaainformation/the18hipaaidentifiers/ |
| Incident Response Plan |
180430 |
/its/aboutus/itspoliciesguidelines/incidentresponseplan/ |
| Incident Response Plan - Appendix |
180431 |
/its/aboutus/itspoliciesguidelines/incidentresponseplan-appendix/ |
| Key & Badge Access Policy |
180433 |
/its/aboutus/itspoliciesguidelines/keybadgeaccesspolicy/ |
| Log Management Standard |
180434 |
/its/aboutus/itspoliciesguidelines/logmanagementstandard/ |
| Macintosh Computer Policy |
180435 |
/its/aboutus/itspoliciesguidelines/macintoshcomputerpolicy/ |
| Microsoft 365 Policy |
180976 |
/its/services/microsoft365/microsoft365policy/ |
| Network Firewall Policy |
180409 |
/its/aboutus/itspoliciesguidelines/networkfirewallpolicy/ |
| Network Firewall Standard |
180436 |
/its/aboutus/itspoliciesguidelines/networkfirewallstandard/ |
| Network Policy Issues |
180437 |
/its/aboutus/itspoliciesguidelines/networkpolicyissues/ |
| Online Harassment |
180410 |
/its/aboutus/itspoliciesguidelines/onlineharassment/ |
| Ownership and Use of Data |
180438 |
/its/aboutus/itspoliciesguidelines/ownershipanduseofdata/ |
| Password Standards |
180439 |
/its/aboutus/itspoliciesguidelines/passwordstandards/ |
| Peer-to-Peer File Sharing |
180411 |
/its/aboutus/itspoliciesguidelines/peer-to-peerfilesharing/ |
| Personal Information Protection |
180441 |
/its/aboutus/itspoliciesguidelines/personalinformationprotection/ |
| Physical Security of Loyola Protected and Sensitive Data |
180442 |
/its/aboutus/itspoliciesguidelines/physicalsecurityofloyolaprotectedandsensitivedata/ |
| Policy for Blocking E-Mail |
180443 |
/its/aboutus/itspoliciesguidelines/policyforblockinge-mail/ |
| Privacy Policy |
180462 |
/its/aboutus/itspoliciesguidelines/privacypolicy/ |
| Privileged Access Policy |
180444 |
/its/aboutus/itspoliciesguidelines/privilegedaccesspolicy/ |
| Protected & Sensitive Data Policy |
180445 |
/its/aboutus/itspoliciesguidelines/protectedsensitivedatapolicy/ |
| Proper Use of Tech Resources |
180412 |
/its/aboutus/itspoliciesguidelines/properuseoftechresources/ |
| Rights and Responsibilities When Using Electronic University Resources |
180446 |
/its/aboutus/itspoliciesguidelines/rightsandresponsibilitieswhenusingelectronicuniversityresources/ |
| Router & Switch Security Standard |
180447 |
/its/aboutus/itspoliciesguidelines/routerswitchsecuritystandard/ |
| Secure Deletion Procedure |
180413 |
/its/aboutus/itspoliciesguidelines/securedeletionprocedure/ |
| Security Awareness Policy |
180448 |
/its/aboutus/itspoliciesguidelines/securityawarenesspolicy/ |
| Security Policy |
180463 |
/its/aboutus/itspoliciesguidelines/securitypolicy/ |
| Security Policies |
180414 |
/its/aboutus/itspoliciesguidelines/securitypolicies/ |
| Security Policy for Technology Professionals |
180449 |
/its/aboutus/itspoliciesguidelines/securitypolicyfortechnologyprofessionals/ |
| Server Security Standard |
180450 |
/its/aboutus/itspoliciesguidelines/serversecuritystandard/ |
| Student Worker PeopleSoft Access |
180451 |
/its/aboutus/itspoliciesguidelines/studentworkerpeoplesoftaccess/ |
| Supported Operating Systems |
180415 |
/its/aboutus/itspoliciesguidelines/supportedoperatingsystems/ |
| Unapproved Information Technology Governance |
180453 |
/its/aboutus/itspoliciesguidelines/unapprovedinformationtechnologygovernance/ |
| Use of Computing Services |
180454 |
/its/aboutus/itspoliciesguidelines/useofcomputingservices/ |
| Use of Electronic Mail Systems |
180455 |
/its/aboutus/itspoliciesguidelines/useofelectronicmailsystems/ |
| Use of Systems for Mass Communication |
180456 |
/its/aboutus/itspoliciesguidelines/useofsystemsformasscommunication/ |
| Vendor Access to Internal Systems |
180416 |
/its/aboutus/itspoliciesguidelines/vendoraccesstointernalsystems/ |
| Vendor VPN Access Procedure |
180417 |
/its/aboutus/itspoliciesguidelines/vendorvpnaccessprocedure/ |
| Vulnerability Assessment Policy |
180457 |
/its/aboutus/itspoliciesguidelines/vulnerabilityassessmentpolicy/ |
| Vulnerability Risk Ranking Procedure |
180418 |
/its/aboutus/itspoliciesguidelines/vulnerabilityriskrankingprocedure/ |
| Wireless Access Points Policy |
180440 |
/its/aboutus/itspoliciesguidelines/wirelessaccesspointspolicy/ |
| ITS Service Desk |
181114 |
/its/aboutus/itsservicedesk/ |
| Introducing TeamDynamix |
201613 |
/its/aboutus/itsservicedesk/introducingteamdynamix/ |
| LOCUS Access Requests |
181121 |
/its/aboutus/itsservicedesk/locusaccessrequests/ |
| PDF Repository |
181122 |
/its/aboutus/itsservicedesk/pdfrepository/ |
| ITS Service Desk WIP |
206119 |
/its/aboutus/itsservicedeskwip/ |
| Teams |
181472 |
/its/aboutus/teams/ |
| ITS Projects |
201336 |
/its/aboutus/projects/ |
| Introducing Asana |
201643 |
/its/aboutus/projects/introducingasana/ |
| ERP Project Updates (example) |
202385 |
/its/aboutus/projects/erpprojectupdatesexample/ |
| Digital Transformation Initiative |
207352 |
https://www.luc.edu/its/aboutus/projects/dti/ |
| Annual Info & Tech Showcase |
191314 |
/its/aboutus/infotechshowcase/ |
| Program |
204383 |
/its/infotechshowcase/program/ |
| FY26 Technology Report |
205563 |
/its/aboutus/fy26technologyreport/ |
| Message from the CIO |
205564 |
/its/aboutus/fy26technologyreport/messagefromthecio/ |
| Strategic Initiatives |
205566 |
/its/aboutus/fy26technologyreport/strategicinitiatives/ |
| FY25 Technology Report |
198500 |
/its/aboutus/fy25technologyreport/ |
| Message from the CIO |
199094 |
/its/aboutus/fy25technologyreport/messagefromthecio/ |
| ITS Organization Chart Updates |
199284 |
/its/aboutus/fy25technologyreport/itsorganizationchartupdates/ |
| New Governance Structure |
199554 |
/its/aboutus/fy25technologyreport/newgovernancestructure/ |
| Strategic Initiatives |
199292 |
/its/aboutus/fy25technologyreport/strategicinitiatives/ |
| ITS Special Updates |
199572 |
/its/aboutus/fy25technologyreport/itsspecialupdates/ |
| PDF |
203578 |
/its/aboutus/fy25technologyreport/pdf/ |
| Employment |
180800 |
/its/aboutus/employment/ |
| Get Support |
163510 |
/its/aboutus/getsupport/ |
| Mission & Vision |
177835 |
/its/aboutus/missionvision/ |
| Digital Media Services |
159752 |
/its/dms/ |
| right_column |
185645 |
/its/dms/rightcolumn/ |
| About DMS |
197940 |
/its/dms/aboutdms/ |
| Hours |
177877 |
/its/dms/aboutdms/hours/ |
| Multimedia Lab Hours |
182176 |
/its/dms/aboutdms/hours/multimedialabhours/ |
| What's New |
197930 |
/its/dms/aboutdms/whatsnew/ |
| AY24-25 |
197931 |
/its/dms/aboutdms/whatsnew/ay24-25/ |
| AY22-23 |
182182 |
/its/dms/aboutdms/whatsnew/ay22-23/ |
| AY21-22 |
169031 |
/its/dms/aboutdms/whatsnew/ay21-22/ |
| AY20-21 |
169030 |
/its/dms/aboutdms/whatsnew/ay20-21/ |
| News Archive |
169026 |
/its/dms/aboutdms/whatsnew/newsarchive/ |
| Equipment Loan |
169016 |
/its/dms/equipmentloan/ |
| Browse Equipment |
185705 |
/its/dms/equipmentloan/browseequipment/ |
| List of Resources |
201575 |
/its/dms/equipmentloan/browseequipment/listofresources/ |
| Adapters and Cables |
177382 |
/its/dms/equipmentloan/browseequipment/adaptersandcables/ |
| Audio Mixers and Interfaces |
177383 |
/its/dms/equipmentloan/browseequipment/audiomixersandinterfaces/ |
| Focusrite Scarlett 8i6 Audio Interface |
177929 |
/its/dms/equipmentloan/browseequipment/audiomixersandinterfaces/focusritescarlett8i6audiointerface/ |
| Whirlwind 12-Channel XLR PressBox |
198268 |
/its/dms/equipmentloan/browseequipment/audiomixersandinterfaces/whirlwind12-channelxlrpressbox/ |
| Audio Recorders |
177384 |
/its/dms/equipmentloan/browseequipment/audiorecorders/ |
| Sony ICD-UX560 4GB Audio Recorder |
177942 |
/its/dms/equipmentloan/browseequipment/audiorecorders/sonyicd-ux5604gbaudiorecorder/ |
| Zoom H5 Handy Recorder |
177944 |
/its/dms/equipmentloan/browseequipment/audiorecorders/zoomh5handyrecorder/ |
| Zoom H6 Audio Recorder |
177945 |
/its/dms/equipmentloan/browseequipment/audiorecorders/zoomh6audiorecorder/ |
| Zoom PodTrak P4 Podcast Recorder |
204122 |
/its/dms/equipmentloan/browseequipment/audiorecorders/zoompodtrakp4podcastrecorder/ |
| Bluetooth Speakers |
177385 |
/its/dms/equipmentloan/browseequipment/bluetoothspeakers/ |
| Bose SoundLink Revolve+ |
177946 |
/its/dms/equipmentloan/browseequipment/bluetoothspeakers/bosesoundlinkrevolve/ |
| Calculators |
177386 |
/its/dms/equipmentloan/browseequipment/calculators/ |
| BA II Plus (Finance) |
177948 |
/its/dms/equipmentloan/browseequipment/calculators/baiiplusfinance/ |
| TI-30Xa (Scientific) |
177947 |
/its/dms/equipmentloan/browseequipment/calculators/ti-30xascientific/ |
| TI-84 Plus (Graphing) |
177949 |
/its/dms/equipmentloan/browseequipment/calculators/ti-84plusgraphing/ |
| Cameras |
186969 |
/its/dms/equipmentloan/browseequipment/cameras/ |
| Aladdin A-Lite On-Camera LED |
187127 |
/its/dms/equipmentloan/browseequipment/cameras/aladdina-liteon-cameraled/ |
| Anton Bauer Titon Base Kit |
197935 |
/its/dms/equipmentloan/browseequipment/cameras/antonbauertitonbasekit/ |
| Blackmagic Design Pocket Cinema Camera 6K |
187048 |
/its/dms/equipmentloan/browseequipment/cameras/blackmagicdesignpocketcinemacamera6k/ |
| Canon EOS 5D Mark III |
187124 |
/its/dms/equipmentloan/browseequipment/cameras/canoneos5dmarkiii/ |
| Canon EOS 5D Mark IV |
187125 |
/its/dms/equipmentloan/browseequipment/cameras/canoneos5dmarkiv/ |
| Canon EOS Mirrorless |
187123 |
/its/dms/equipmentloan/browseequipment/cameras/canoneosmirrorless/ |
| Canon EOS R5 C Mirrorless Camera |
187115 |
/its/dms/equipmentloan/browseequipment/cameras/canoneosr5cmirrorlesscamera/ |
| Hoodman HoodLoupe Outdoor LCD Viewfinder for 3.2" Screens |
187752 |
/its/dms/equipmentloan/browseequipment/cameras/hoodmanhoodloupeoutdoorlcdviewfinderfor32screens/ |
| Nikon ZFC Mirrorless Camera |
187126 |
/its/dms/equipmentloan/browseequipment/cameras/nikonzfcmirrorlesscamera/ |
| Panasonic HC-VX981K 4K |
197936 |
/its/dms/equipmentloan/browseequipment/cameras/panasonichc-vx981k4k/ |
| Panasonic HC-VX981K 4K |
197936 |
/its/dms/equipmentloan/browseequipment/cameras/panasonichc-vx981k4k/ |
| Rokinon Cine DS Lens Bundle |
187122 |
/its/dms/equipmentloan/browseequipment/cameras/rokinoncinedslensbundle/ |
| Sony FDR-AX100 (4K) |
187117 |
/its/dms/equipmentloan/browseequipment/cameras/sonyfdr-ax1004k/ |
| Sunpak PZ42X TTL Flash |
187128 |
/its/dms/equipmentloan/browseequipment/cameras/sunpakpz42xttlflash/ |
| ZOOM Q2n-4K Video Recorder |
187121 |
/its/dms/equipmentloan/browseequipment/cameras/zoomq2n-4kvideorecorder/ |
| Canon Speedlite EL-5 Flash |
204120 |
/its/dms/equipmentloan/browseequipment/cameras/canonspeedliteel-5flash/ |
| Deity TC-SL1 Wireless Timecode Smart Slate |
204123 |
/its/dms/equipmentloan/browseequipment/cameras/deitytc-sl1wirelesstimecodesmartslate/ |
| Elvid 7" 4K On-Camera Monitor |
204125 |
/its/dms/equipmentloan/browseequipment/cameras/elvid74kon-cameramonitor/ |
| Graphics Tablets |
177390 |
/its/dms/equipmentloan/browseequipment/graphicstablets/ |
| Wacom Intuos Pro Graphics Tablet (Large) |
177973 |
/its/dms/equipmentloan/browseequipment/graphicstablets/wacomintuosprographicstabletlarge/ |
| Wacom Intuos Pro Creative Pen Tablet (Medium) |
177974 |
/its/dms/equipmentloan/browseequipment/graphicstablets/wacomintuosprocreativepentabletmedium/ |
| Hard Drives and Memory Cards |
177391 |
/its/dms/equipmentloan/browseequipment/harddrivesandmemorycards/ |
| SanDisk 1TB SSD G-Drive |
178671 |
/its/dms/equipmentloan/browseequipment/harddrivesandmemorycards/sandisk1tbssdg-drive/ |
| Headphones and Headsets |
177392 |
/its/dms/equipmentloan/browseequipment/headphonesandheadsets/ |
| Bose QuietComfort Wireless Headphones |
197932 |
/its/dms/equipmentloan/browseequipment/headphonesandheadsets/bosequietcomfortwirelessheadphones/ |
| Logitech G PRO X Gaming Headset |
177980 |
/its/dms/equipmentloan/browseequipment/headphonesandheadsets/logitechgproxgamingheadset/ |
| Logitech H540 Wired Headset |
187139 |
/its/dms/equipmentloan/browseequipment/headphonesandheadsets/logitechh540wiredheadset/ |
| Sony MDR-1AM2 Circumaural Headphones |
187749 |
/its/dms/equipmentloan/browseequipment/headphonesandheadsets/sonymdr-1am2circumauralheadphones/ |
| Laptops and Accessories |
177393 |
/its/dms/equipmentloan/browseequipment/laptopsandaccessories/ |
| Apple MacBook Air (Mac) |
177983 |
/its/dms/equipmentloan/browseequipment/laptopsandaccessories/applemacbookairmac/ |
| Lenovo Thinkpad E490 (PC) |
177984 |
/its/dms/equipmentloan/browseequipment/laptopsandaccessories/lenovothinkpade490pc/ |
| CZUR ET16 Plus Book Scanner |
190970 |
/its/dms/equipmentloan/browseequipment/laptopsandaccessories/czuret16plusbookscanner/ |
| Elgato Cam Link 4K |
177988 |
/its/dms/equipmentloan/browseequipment/laptopsandaccessories/elgatocamlink4k/ |
| Elgato Game Capture HD60 S |
177987 |
/its/dms/equipmentloan/browseequipment/laptopsandaccessories/elgatogamecapturehd60s/ |
| Lenovo Ultraslim USB DVD Writer |
177986 |
/its/dms/equipmentloan/browseequipment/laptopsandaccessories/lenovoultraslimusbdvdwriter/ |
| Logitech Litra Glow Bi-Color LED Light Panel |
187747 |
/its/dms/equipmentloan/browseequipment/laptopsandaccessories/logitechlitraglowbi-colorledlightpanel/ |
| Logitech M510 Wireless USB Mouse |
177985 |
/its/dms/equipmentloan/browseequipment/laptopsandaccessories/logitechm510wirelessusbmouse/ |
| Logitech R800 Presentation Remote |
187137 |
/its/dms/equipmentloan/browseequipment/laptopsandaccessories/logitechr800presentationremote/ |
| ViewSonic VG1655 Portable IPS Monitor |
188005 |
/its/dms/equipmentloan/browseequipment/laptopsandaccessories/viewsonicvg1655portableipsmonitor/ |
| Lighting |
177394 |
/its/dms/equipmentloan/browseequipment/lighting/ |
| Aladdin A-Lite 2-Point Light Kits |
177992 |
/its/dms/equipmentloan/browseequipment/lighting/aladdina-lite2-pointlightkits/ |
| Manfrotto Lumimuse 8 2-Point Light Kit |
177995 |
/its/dms/equipmentloan/browseequipment/lighting/manfrottolumimuse82-pointlightkit/ |
| Godox Flexible LED 2-Light Kit |
201081 |
/its/dms/equipmentloan/browseequipment/lighting/godoxflexibleled2-lightkit/ |
| Godox LED RGB Light Stick LC500R |
186086 |
/its/dms/equipmentloan/browseequipment/lighting/godoxledrgblightsticklc500r/ |
| GVM 800D-RGB LED Studio 2-Video Light Kit |
186087 |
/its/dms/equipmentloan/browseequipment/lighting/gvm800d-rgbledstudio2-videolightkit/ |
| GVM LED Ring Light |
177993 |
/its/dms/equipmentloan/browseequipment/lighting/gvmledringlight/ |
| Rogue Flashbender 2 Reflector |
177999 |
/its/dms/equipmentloan/browseequipment/lighting/rogueflashbender2reflector/ |
| Sunpak PZ42X TTL Flash |
177991 |
/its/dms/equipmentloan/browseequipment/lighting/sunpakpz42xttlflash/ |
| Westcott Illuminator-Reflector |
177998 |
/its/dms/equipmentloan/browseequipment/lighting/westcottilluminator-reflector/ |
| Westcott Illuminator-Reflector |
177998 |
/its/dms/equipmentloan/browseequipment/lighting/westcottilluminator-reflector/ |
| Hobolite Mini Bi-Color LED Light Creator Kit |
198185 |
/its/dms/equipmentloan/browseequipment/lighting/hoboliteminibi-colorledlightcreatorkit/ |
| FotodioX Bi-Color Ring Light Kit |
204121 |
/its/dms/equipmentloan/browseequipment/lighting/fotodioxbi-colorringlightkit/ |
| Microphones |
177395 |
/its/dms/equipmentloan/browseequipment/microphones/ |
| Audio-Technica AT897 Shotgun XLR Microphone |
178018 |
/its/dms/equipmentloan/browseequipment/microphones/audio-technicaat897shotgunxlrmicrophone/ |
| Blue Yeti USB Microphone |
178008 |
/its/dms/equipmentloan/browseequipment/microphones/blueyetiusbmicrophone/ |
| MXL AC-424 Conference Mic |
178009 |
/its/dms/equipmentloan/browseequipment/microphones/mxlac-424conferencemic/ |
| Rode NT USB Microphone |
191814 |
/its/dms/equipmentloan/browseequipment/microphones/rodentusbmicrophone/ |
| Rode Wireless Go II 2-Person Lavalier Receiver |
178013 |
/its/dms/equipmentloan/browseequipment/microphones/rodewirelessgoii2-personlavalierreceiver/ |
| Rode Charging Case for Wireless GO II |
201379 |
/its/dms/equipmentloan/browseequipment/microphones/rodechargingcaseforwirelessgoii/ |
| RodeLink Wireless Lavalier Kit |
178014 |
/its/dms/equipmentloan/browseequipment/microphones/rodelinkwirelesslavalierkit/ |
| Sony ECM-44B XLR Wired Lavalier |
178015 |
/its/dms/equipmentloan/browseequipment/microphones/sonyecm-44bxlrwiredlavalier/ |
| Shure SM58S Vocal Microphone |
197952 |
/its/dms/equipmentloan/browseequipment/microphones/shuresm58svocalmicrophone/ |
| Shure VP83F LensHopper Shotgun Microphone |
178017 |
/its/dms/equipmentloan/browseequipment/microphones/shurevp83flenshoppershotgunmicrophone/ |
| Auray Telescoping Desktop Mic Stand |
198179 |
/its/dms/equipmentloan/browseequipment/microphones/auraytelescopingdesktopmicstand/ |
| E-Image 4-Section Microphone Boompole |
198183 |
/its/dms/equipmentloan/browseequipment/microphones/e-image4-sectionmicrophoneboompole/ |
| Boyalink 2-Person Wireless Microphone System |
204127 |
/its/dms/equipmentloan/browseequipment/microphones/boyalink2-personwirelessmicrophonesystem/ |
| MIDI Controllers and MIDI Keyboards |
177396 |
/its/dms/equipmentloan/browseequipment/midicontrollersandmidikeyboards/ |
| Teenage Engineering OP-1 |
178019 |
/its/dms/equipmentloan/browseequipment/midicontrollersandmidikeyboards/teenageengineeringop-1/ |
| Akai LPK25 Midi Controller |
178022 |
/its/dms/equipmentloan/browseequipment/midicontrollersandmidikeyboards/akailpk25midicontroller/ |
| Portable Power |
188076 |
/its/dms/equipmentloan/browseequipment/portablepower/ |
| Jackery Explorer 1000 Portable Power Station |
197937 |
/its/dms/equipmentloan/browseequipment/portablepower/jackeryexplorer1000portablepowerstation/ |
| Omnicharge Portable Power Bank |
188077 |
/its/dms/equipmentloan/browseequipment/portablepower/omnichargeportablepowerbank/ |
| Projectors and Screens |
177398 |
/its/dms/equipmentloan/browseequipment/projectorsandscreens/ |
| Epson 1264 PowerLite Projector |
178025 |
/its/dms/equipmentloan/browseequipment/projectorsandscreens/epson1264powerliteprojector/ |
| Da-Lite 6ft x 8ft Projector Screen |
178026 |
/its/dms/equipmentloan/browseequipment/projectorsandscreens/da-lite6ftx8ftprojectorscreen/ |
| Elgato Retractable Green Screen |
178027 |
/its/dms/equipmentloan/browseequipment/projectorsandscreens/elgatoretractablegreenscreen/ |
| Tripods and Stabilization |
177399 |
/its/dms/equipmentloan/browseequipment/tripodsandstabilization/ |
| Clampazzo 10in Clamp Bracket |
178034 |
/its/dms/equipmentloan/browseequipment/tripodsandstabilization/clampazzo10inclampbracket/ |
| Insta360 Flow Smartphone Gimbal Stabilizer |
198210 |
/its/dms/equipmentloan/browseequipment/tripodsandstabilization/insta360flowsmartphonegimbalstabilizer/ |
| Insta360 Flow Smartphone Gimbal Stabilizer |
198210 |
/its/dms/equipmentloan/browseequipment/tripodsandstabilization/insta360flowsmartphonegimbalstabilizer/ |
| Manfrotto 290 Monopod |
178031 |
/its/dms/equipmentloan/browseequipment/tripodsandstabilization/manfrotto290monopod/ |
| Manfrotto 755XB (80cm) Tripod |
178029 |
/its/dms/equipmentloan/browseequipment/tripodsandstabilization/manfrotto755xb80cmtripod/ |
| Manfrotto Element MII Travel Tripod |
186123 |
/its/dms/equipmentloan/browseequipment/tripodsandstabilization/manfrottoelementmiitraveltripod/ |
| Proaim Overhead Photo and Video Camera Boom Pole |
187992 |
/its/dms/equipmentloan/browseequipment/tripodsandstabilization/proaimoverheadphotoandvideocameraboompole/ |
| Revo SR-1000 Shoulder Support Rig |
187750 |
/its/dms/equipmentloan/browseequipment/tripodsandstabilization/revosr-1000shouldersupportrig/ |
| Smartphone Tripod and Selfie Stick |
198180 |
/its/dms/equipmentloan/browseequipment/tripodsandstabilization/smartphonetripodandselfiestick/ |
| Steadicam Air 15 Monopod |
178032 |
/its/dms/equipmentloan/browseequipment/tripodsandstabilization/steadicamair15monopod/ |
| Webcams |
177400 |
/its/dms/equipmentloan/browseequipment/webcams/ |
| AVerMedia Cam 313 |
178038 |
/its/dms/equipmentloan/browseequipment/webcams/avermediacam313/ |
| Logitech Brio 4K |
178036 |
/its/dms/equipmentloan/browseequipment/webcams/logitechbrio4k/ |
| Logitech C920 Pro HD |
178037 |
/its/dms/equipmentloan/browseequipment/webcams/logitechc920prohd/ |
| OBSBOT Tiny 2 4K Webcam |
204124 |
/its/dms/equipmentloan/browseequipment/webcams/obsbottiny24kwebcam/ |
| Wireless Hotspots |
186970 |
/its/dms/equipmentloan/browseequipment/wirelesshotspots/ |
| Franklin T10 Mobile Wi-Fi Hotspot |
187130 |
/its/dms/equipmentloan/browseequipment/wirelesshotspots/franklint10mobilewi-fihotspot/ |
| [INTERNAL] BOE Type Icons |
188239 |
/its/dms/equipmentloan/browseequipment/internalboetypeicons/ |
| Equipment Authorizations |
177377 |
/its/dms/equipmentloan/equipmentauthorizations/ |
| Loan Program Policies |
177378 |
/its/dms/equipmentloan/loanprogrampolicies/ |
| Introduction |
177919 |
/its/dms/equipmentloan/loanprogrampolicies/introduction/ |
| Policy Changelog |
177920 |
/its/dms/equipmentloan/loanprogrampolicies/introduction/policychangelog/ |
| Accessing the Program |
178066 |
/its/dms/equipmentloan/loanprogrampolicies/accessingtheprogram/ |
| Acceptable Use |
178067 |
/its/dms/equipmentloan/loanprogrampolicies/acceptableuse/ |
| Circulation Limits |
178068 |
/its/dms/equipmentloan/loanprogrampolicies/circulationlimits/ |
| Loan Communications |
178069 |
/its/dms/equipmentloan/loanprogrampolicies/loancommunications/ |
| Reservations & Renewals |
178070 |
/its/dms/equipmentloan/loanprogrampolicies/reservationsrenewals/ |
| Check-Out & Agreement |
178071 |
/its/dms/equipmentloan/loanprogrampolicies/check-outagreement/ |
| During Your Loan |
178072 |
/its/dms/equipmentloan/loanprogrampolicies/duringyourloan/ |
| Outside Vendors |
178075 |
/its/dms/equipmentloan/loanprogrampolicies/duringyourloan/outsidevendors/ |
| Check-Ins & Returns |
178073 |
/its/dms/equipmentloan/loanprogrampolicies/check-insreturns/ |
| Overdue & Unreturned Equipment |
178074 |
/its/dms/equipmentloan/loanprogrampolicies/overdueunreturnedequipment/ |
| Fines & Payments |
178076 |
/its/dms/equipmentloan/loanprogrampolicies/finespayments/ |
| Daily Fine Rates |
178081 |
/its/dms/equipmentloan/loanprogrampolicies/finespayments/dailyfinerates/ |
| Fine Appeals |
178077 |
/its/dms/equipmentloan/loanprogrampolicies/fineappeals/ |
| Copyright |
178078 |
/its/dms/equipmentloan/loanprogrampolicies/copyright/ |
| WebCheckout |
177380 |
/its/dms/equipmentloan/webcheckout/ |
| ITS Office Hoteling Spaces |
190819 |
/its/dms/equipmentloan/webcheckout/itsofficehotelingspaces/ |
| right_column |
191256 |
/its/dms/equipmentloan/webcheckout/itsofficehotelingspaces/rightcolumn/ |
| WebCheckout Reservations |
177376 |
/its/dms/equipmentloan/webcheckout/webcheckoutreservations/ |
| WebCheckout Renewals |
182466 |
/its/dms/equipmentloan/webcheckout/webcheckoutrenewals/ |
| Manufacturer Support |
187185 |
/its/dms/equipmentloan/manufacturersupport/ |
| Equipment Loan BACKUP |
199277 |
/its/dms/equipmentloan/equipmentloanbackup/ |
| Computer Labs & Software |
169017 |
/its/dms/computerlabssoftware/ |
| Lab Locations |
177878 |
/its/dms/computerlabssoftware/lablocations/ |
| HSC Computer Labs |
177882 |
/its/dms/computerlabssoftware/lablocations/hsccomputerlabs/ |
| LSC Computer Labs |
196435 |
/its/dms/computerlabssoftware/lablocations/lsccomputerlabs/ |
| WTC Computer Labs |
196436 |
/its/dms/computerlabssoftware/lablocations/wtccomputerlabs/ |
| LUREC & JRFC Computer Labs |
196437 |
/its/dms/computerlabssoftware/lablocations/lurecjrfccomputerlabs/ |
| Lab Policies |
177881 |
/its/dms/computerlabssoftware/labpolicies/ |
| Scanning |
177880 |
/its/dms/computerlabssoftware/scanning/ |
| Software Applications |
177879 |
/its/dms/computerlabssoftware/softwareapplications/ |
| Printing & Posters |
169018 |
/its/dms/printingposters/ |
| MobilePrint |
177887 |
/its/dms/printingposters/mobileprint/ |
| Printer Troubleshooting |
182605 |
/its/dms/printingposters/mobileprint/printertroubleshooting/ |
| Printing Costs |
177884 |
/its/dms/printingposters/printingcosts/ |
| Sustainability |
177875 |
/its/dms/printingposters/sustainability/ |
| Posters |
177888 |
/its/dms/printingposters/posters/ |
| HSC Poster Printing |
196321 |
/its/dms/printingposters/posters/hscposterprinting/ |
| Policies |
177889 |
/its/dms/printingposters/posters/policies/ |
| Creating Posters |
177890 |
/its/dms/printingposters/posters/creatingposters/ |
| Export to PDF |
177893 |
/its/dms/printingposters/posters/creatingposters/exporttopdf/ |
| Tabloid Printing |
182603 |
/its/dms/printingposters/tabloidprinting/ |
| Buttons, Magnets & Keychain Making |
182613 |
/its/dms/printingposters/buttonmaking/ |
| Button, Magnet, and Keychain Policies |
182614 |
/its/dms/printingposters/buttonmaking/buttonmagnetandkeychainpolicies/ |
| Templates and Tips |
182615 |
/its/dms/printingposters/buttonmaking/templatesandtips/ |
| Submission Form |
182616 |
/its/dms/printingposters/buttonmaking/submissionform/ |
| Start of Semester Printing Tips |
182602 |
/its/dms/printingposters/startofsemesterprintingtips/ |
| right_column |
204186 |
/its/dms/printingposters/rightcolumn/ |
| Media Production Studios |
169019 |
/its/dms/mediaproductionstudios/ |
| Features |
182473 |
/its/dms/mediaproductionstudios/features/ |
| Examples Of Service |
182474 |
/its/dms/mediaproductionstudios/examplesofservice/ |
| Editing Provided Footage |
200399 |
/its/dms/mediaproductionstudios/editingprovidedfootage/ |
| One Button Studio |
206411 |
/its/dms/mediaproductionstudios/onebuttonstudio/ |
| Lightboard |
182476 |
/its/dms/mediaproductionstudios/lightboard/ |
| Self-Guided Media Production |
182475 |
/its/dms/mediaproductionstudios/self-guidedmediaproduction/ |
| Vocal Booth |
169020 |
/its/dms/vocalbooth/ |
| Features |
182467 |
/its/dms/vocalbooth/features/ |
| Recording Instructions |
182468 |
/its/dms/vocalbooth/recordinginstructions/ |
| Guidelines & Policies |
182469 |
/its/dms/vocalbooth/guidelinespolicies/ |
| TechConnect |
169021 |
/its/dms/techconnect/ |
| Loyola Mobile App |
178399 |
/its/dms/techconnect/loyolamobileapp/ |
| Media Libraries |
178400 |
/its/dms/techconnect/medialibraries/ |
| Webinars |
169022 |
/its/dms/webinars/ |
| right_column |
187187 |
/its/dms/webinars/rightcolumn/ |
| Webinars & Meeting Rooms |
178440 |
/its/dms/webinars/webinarsmeetingrooms/ |
| Webinar-like Meetings |
178441 |
/its/dms/webinars/webinar-likemeetings/ |
| Live Events with a Virtual Audience |
178442 |
/its/dms/webinars/liveeventswithavirtualaudience/ |
| Webinar Minimum Requirements |
178443 |
/its/dms/webinars/webinarminimumrequirements/ |
| Preparing for your Zoom Webinar |
178444 |
/its/dms/webinars/preparingforyourzoomwebinar/ |
| Pre-Event Checklist |
178446 |
/its/dms/webinars/preparingforyourzoomwebinar/pre-eventchecklist/ |
| Zoom Registration Benefits |
178445 |
/its/dms/webinars/zoomregistrationbenefits/ |
| St Alberts Day Posters |
198251 |
/its/dms/stalbertsday/ |
| URES Posters |
199703 |
/its/dms/uresposters/ |
| Information Security |
160506 |
/its/informationsecurity/ |
| Awareness |
169005 |
/its/informationsecurity/awareness/ |
| Loyola Aware |
180551 |
/its/informationsecurity/awareness/loyolaaware/ |
| Annual ITS HR and OEC Compliance Training Schedule |
180560 |
/its/informationsecurity/awareness/loyolaaware/annualitshrandoeccompliancetrainingschedule/ |
| Blog |
180561 |
http://blogs.luc.edu/uiso |
| Past Newsletters |
180554 |
/its/informationsecurity/awareness/pastnewsletters/ |
| Protect Yourself |
180555 |
/its/informationsecurity/awareness/protectyourself/ |
| Patches and Updates |
180563 |
/its/informationsecurity/awareness/protectyourself/patchesandupdates/ |
| Strong Passwords |
180564 |
/its/informationsecurity/awareness/protectyourself/strongpasswords/ |
| Phishing |
180565 |
/its/informationsecurity/awareness/protectyourself/phishing/ |
| Identify Job Scams |
180566 |
/its/informationsecurity/awareness/protectyourself/identifyjobscams/ |
| National Cyber Security Awareness Month |
180556 |
/its/informationsecurity/awareness/nationalcybersecurityawarenessmonth/ |
| Cyber Tips |
180567 |
/its/informationsecurity/awareness/nationalcybersecurityawarenessmonth/cybertips/ |
| National Cyber Security Awareness Month |
180568 |
/its/informationsecurity/awareness/nationalcybersecurityawarenessmonth/nationalcybersecurityawarenessmonth/ |
| Week 1: If You Connect It, Protect It; Fishing & Phising |
180569 |
/its/informationsecurity/awareness/nationalcybersecurityawarenessmonth/nationalcybersecurityawarenessmonth2020/week1ifyouconnectitprotectitfishingphising/ |
| Week 2: Securing Devices at Home & Work, Many Forms of Malware |
180570 |
/its/informationsecurity/awareness/nationalcybersecurityawarenessmonth/nationalcybersecurityawarenessmonth2020/week2securingdevicesathomeworkmanyformsofmalware/ |
| Week 2: Securing Devices at Home & Work, Many Forms of Malware |
180570 |
/its/informationsecurity/awareness/nationalcybersecurityawarenessmonth/nationalcybersecurityawarenessmonth2020/week2securingdevicesathomeworkmanyformsofmalware/ |
| Week 3: Securing Internet-Connected Devices in Healthcare; Social Engineering |
180571 |
/its/informationsecurity/awareness/nationalcybersecurityawarenessmonth/nationalcybersecurityawarenessmonth2020/week3securinginternet-connecteddevicesinhealthcaresocialengineering/ |
| Week 4: The Future of Connected Devices; Your Data is Valuable, Protect It |
180572 |
/its/informationsecurity/awareness/nationalcybersecurityawarenessmonth/nationalcybersecurityawarenessmonth2020/week4thefutureofconnecteddevicesyourdataisvaluableprotectit/ |
| Data Privacy Month |
180557 |
/its/informationsecurity/awareness/dataprivacymonth/ |
| Compliance |
169006 |
/its/informationsecurity/compliance/ |
| Digital Millennium Copyright Act |
180533 |
/its/informationsecurity/compliance/digitalmillenniumcopyrightact/ |
| DMCA Test |
180534 |
/its/informationsecurity/compliance/digitalmillenniumcopyrightact/dmcatest/ |
| Payment Card Industry |
180535 |
/its/informationsecurity/compliance/paymentcardindustry/ |
| Personally Identifiable Information |
180536 |
/its/informationsecurity/compliance/personallyidentifiableinformation/ |
| Spirion |
180538 |
/its/informationsecurity/compliance/personallyidentifiableinformation/spirion/ |
| How to Scan and Remediate |
180539 |
/its/informationsecurity/compliance/personallyidentifiableinformation/spirion/howtoscanandremediate/ |
| Troubleshooting |
180542 |
/its/informationsecurity/compliance/personallyidentifiableinformation/spirion/troubleshooting/ |
| Data Stewards |
180543 |
/its/informationsecurity/compliance/personallyidentifiableinformation/spirion/datastewards/ |
| PCI Glossary of Terms |
180537 |
/its/informationsecurity/compliance/pciglossaryofterms/ |
| Policies |
169007 |
/its/informationsecurity/policies/ |
| Finance Policies |
180528 |
/finance/policies.shtml |
| University Policies |
180529 |
/policy/category.shtml |
| Faculty Handbook |
180530 |
/academicaffairs/facultyaffairs/facultyhandbook/ |
| Resources |
169008 |
/its/informationsecurity/resources/ |
| Loyola Secure Access |
180513 |
/its/informationsecurity/resources/loyolasecureaccess/ |
| Loyola Secure Access FAQ |
180520 |
/its/informationsecurity/resources/loyolasecureaccess/loyolasecureaccessfaq/ |
| GlobalProtect |
180521 |
/its/informationsecurity/resources/loyolasecureaccess/globalprotect/ |
| Request Access to LSA |
180522 |
/its/informationsecurity/resources/loyolasecureaccess/requestaccesstolsa/ |
| Mobile |
180523 |
/its/informationsecurity/resources/loyolasecureaccess/mobile/ |
| Loyola Secure Transfer |
180514 |
/its/informationsecurity/resources/loyolasecuretransfer/ |
| Troubleshooting |
180524 |
https://securetransfer.luc.edu/help |
| Outlook Plugin |
180525 |
/its/informationsecurity/resources/loyolasecuretransfer/outlookplugin/ |
| Loyola Secure Transfer Instructions |
180526 |
/its/informationsecurity/resources/loyolasecuretransfer/loyolasecuretransferinstructions/ |
| Antivirus |
180515 |
/its/informationsecurity/resources/antivirus/ |
| Personal Firewall |
180516 |
/its/informationsecurity/resources/personalfirewall/ |
| Full-Disk Encryption |
180517 |
/its/informationsecurity/resources/full-diskencryption/ |
| Password Managers |
180518 |
/its/informationsecurity/resources/passwordmanagers/ |
| Windows Defender |
180519 |
/its/informationsecurity/resources/windowsdefender/ |
| CrowdStrike |
185702 |
/its/informationsecurity/resources/crowdstrike/ |
| Leaked Credentials |
202049 |
/its/informationsecurity/resources/leakedcredentials/ |
| Services |
169009 |
/its/informationsecurity/services/ |
| Training |
180506 |
/its/informationsecurity/services/training/ |
| Risk Assessment |
180507 |
/its/informationsecurity/services/riskassessment/ |
| Vulnerability Reviews |
180508 |
/its/informationsecurity/services/vulnerabilityreviews/ |
| Thank You |
180509 |
/its/informationsecurity/services/thankyou/ |
| Contact ISC |
169010 |
/its/informationsecurity/contactisc/ |
| Report an Incident |
180495 |
/its/informationsecurity/contacttheuiso/report.shtml |
| Report Anonymously |
180496 |
/its/informationsecurity/contacttheuiso/report_anon.shtml |
| About Us |
180497 |
/its/informationsecurity/contacttheuiso/aboutus/ |
| Ask A Question |
180499 |
/its/informationsecurity/contacttheuiso/askaquestion/ |
| Thank You |
180498 |
/its/informationsecurity/contacttheuiso/thank_you.shtml |
| Policy Test |
180494 |
/its/informationsecurity/policytest/ |
| Learning Technologies & Innovation |
201624 |
/its/learningtechnologies/ |
| social media |
199707 |
/its/learningtechnologies/socialmedia/ |
| right_column |
199911 |
/its/learningtechnologies/rightcolumn/ |
| D2L Brightspace |
199912 |
/its/learningtechnologies/d2lbrightspace/ |
| Generative AI Feature Catalog |
202447 |
/its/learningtechnologies/generativeaifeaturecatalog/ |
| Learning Technologies |
199914 |
/its/learningtechnologies/learningtechnologies/ |
| Sakai |
199916 |
/its/learningtechnologies/learningtechnologies/sakai/ |
| Administrative Schedule |
199917 |
/its/learningtechnologies/learningtechnologies/sakai/administrativeschedule/ |
| Retention Policies |
199918 |
/its/learningtechnologies/learningtechnologies/sakai/retentionpolicies/ |
| Browser FAQ |
199920 |
/its/learningtechnologies/learningtechnologies/sakai/browserfaq/ |
| Project Site FAQs |
199921 |
/its/learningtechnologies/learningtechnologies/sakai/projectsitefaqs/ |
| Simple Syllabus |
201319 |
/its/learningtechnologies/learningtechnologies/simplesyllabus/ |
| Microsoft Copilot |
205818 |
/its/learningtechnologies/learningtechnologies/microsoftcopilot/ |
| Zoom |
199931 |
/its/learningtechnologies/learningtechnologies/zoom/ |
| Panopto |
199935 |
/its/learningtechnologies/learningtechnologies/panopto/ |
| Panopto Retention Policies |
199936 |
/its/learningtechnologies/learningtechnologies/panopto/panoptoretentionpolicies/ |
| Elai |
202570 |
/its/learningtechnologies/learningtechnologies/panopto/elai/ |
| VoiceThread |
199937 |
/its/learningtechnologies/learningtechnologies/voicethread/ |
| Gradescope |
199947 |
/its/learningtechnologies/learningtechnologies/gradescope/ |
| Respondus LockDown Browser |
199942 |
/its/learningtechnologies/learningtechnologies/responduslockdownbrowser/ |
| Labster |
199940 |
/its/learningtechnologies/learningtechnologies/labster/ |
| Top Hat |
199943 |
/its/learningtechnologies/learningtechnologies/tophat/ |
| Learning Cloud |
199939 |
/its/learningtechnologies/learningtechnologies/learningcloud/ |
| Piazza |
199944 |
/its/learningtechnologies/learningtechnologies/piazza/ |
| Extended Reality (XR) |
199948 |
/its/learningtechnologies/learningtechnologies/extendedrealityxr/ |
| Turnitin |
199941 |
/its/learningtechnologies/learningtechnologies/turnitin/ |
| Scantron |
199946 |
/its/learningtechnologies/learningtechnologies/scantron/ |
| Mailman Listserv |
199938 |
/its/learningtechnologies/learningtechnologies/mailmanlistserv/ |
| Start of School Webinar Series |
190305 |
/its/learningtechnologies/startofschoolwebinarseries/ |
| Academic Research Technologies |
199949 |
/its/learningtechnologies/academicresearchtechnologies/ |
| ArcGIS |
199950 |
/its/learningtechnologies/academicresearchtechnologies/arcgis/ |
| IBM SPSS Modeler |
199952 |
/its/learningtechnologies/academicresearchtechnologies/ibmspssmodeler/ |
| IBM SPSS Statistics |
199953 |
/its/learningtechnologies/academicresearchtechnologies/ibmspssstatistics/ |
| Mathematica |
199955 |
/its/learningtechnologies/academicresearchtechnologies/mathematica/ |
| Matlab |
199956 |
/its/learningtechnologies/academicresearchtechnologies/matlab/ |
| Minitab |
199957 |
/its/learningtechnologies/academicresearchtechnologies/minitab/ |
| QSR NVivo |
199959 |
/its/learningtechnologies/academicresearchtechnologies/qsrnvivo/ |
| Qualtrics |
199960 |
/its/learningtechnologies/academicresearchtechnologies/qualtrics/ |
| R |
199963 |
/its/learningtechnologies/academicresearchtechnologies/r/ |
| R Studio |
199964 |
/its/learningtechnologies/academicresearchtechnologies/rstudio/ |
| REDCap |
199965 |
/its/learningtechnologies/academicresearchtechnologies/redcap/ |
| SAS |
199966 |
/its/learningtechnologies/academicresearchtechnologies/sas/ |
| STATA |
199967 |
/its/learningtechnologies/academicresearchtechnologies/stata/ |
| SYSTAT |
199968 |
/its/learningtechnologies/academicresearchtechnologies/systat/ |
| Learning Analytics |
199979 |
/its/learningtechnologies/learninganalytics/ |
| Health Sciences Innovation |
199977 |
/its/learningtechnologies/healthsciencesinnovation/ |
| Digital Accessibility |
199980 |
/its/learningtechnologies/digitalaccessibility/ |
| Meet With Us |
199982 |
/its/learningtechnologies/meetwithus/ |
| Stay Connected |
199981 |
/its/learningtechnologies/stayconnected/ |
| Thank You |
202236 |
/its/learningtechnologies/thankyou/ |
| RCS |
160501 |
/its/rcs/ |
| Clinical Research Resources |
177828 |
/its/rcs/clinicalresearchresources/ |
| CAPriCORN (PCORI Clinical Data Network) |
180621 |
/its/rcs/clinicalresearchresources/capricornpcoriclinicaldatanetwork/ |
| The Clinical Research Database (CRDB) |
180622 |
/its/rcs/clinicalresearchresources/theclinicalresearchdatabasecrdb/ |
| Healthcare Costs and Utilization Project (HCUP) |
180623 |
/its/rcs/clinicalresearchresources/healthcarecostsandutilizationprojecthcup/ |
| Clinical and Translational Science Award (CTSA) |
180624 |
/its/rcs/clinicalresearchresources/clinicalandtranslationalscienceawardctsa/ |
| Leaf |
187037 |
/its/rcs/clinicalresearchresources/clinicalandtranslationalscienceawardctsa/leaf/ |
| COVID-19 Resources |
180625 |
/its/rcs/clinicalresearchresources/covid-19resources/ |
| NCATS-N3C |
180626 |
/its/rcs/clinicalresearchresources/covid-19resources/ncats-n3c/ |
| PCORnet COVID-19-CDM |
180627 |
/its/rcs/clinicalresearchresources/covid-19resources/pcornetcovid-19-cdm/ |
| Computational Resources |
177829 |
/its/rcs/computationalresources/ |
| Data Collection and Analysis |
177830 |
/its/rcs/datacollectionandanalysis/ |
| REDCap |
180619 |
/its/rcs/datacollectionandanalysis/redcap/ |
| CRO Biostatistics |
180628 |
https://hsd.luc.edu/cro/biostatistics/ |
| cNAE/cNIE (NLP) |
180620 |
/its/rcs/datacollectionandanalysis/cnaecnienlp/ |
| VDI |
207357 |
/its/rcs/datacollectionandanalysis/vdi/ |
| Research Reference Datasets |
177831 |
/its/rcs/researchreferencedatasets/ |
| cNAE/cNIE (NLP) |
189615 |
/its/rcs/cnaecnienlp/ |
| Specialized Research Support Services |
177832 |
/its/rcs/specializedresearchsupportservices/ |
| Clinical Research Office |
180631 |
https://hsd.luc.edu/cro/ |
| Activity Metrics |
177833 |
/its/rcs/activitymetrics/ |
| Activity Metrics Descriptions |
180618 |
/its/rcs/activitymetrics/activitymetricsdescriptions/ |
| right_column |
180633 |
/its/rcs/rightcolumn/ |
| Services |
162144 |
/its/services/ |
| Blogs |
180786 |
/its/services/blogs/ |
| Business Intelligence |
163509 |
/its/services/businessintelligence/ |
| About BI |
180607 |
/its/services/businessintelligence/aboutbi/ |
| Mission & Vision |
180611 |
/its/services/businessintelligence/aboutbi/missionvision/ |
| Contact the BI Team |
180612 |
/its/services/businessintelligence/aboutbi/contactthebiteam/ |
| Learn |
180608 |
/its/services/businessintelligence/learn/ |
| What is BI? |
180613 |
/its/services/businessintelligence/learn/whatisbi/ |
| What is a Data Warehouse? |
180614 |
/its/services/businessintelligence/learn/whatisadatawarehouse/ |
| What data is in our Data Warehouse? |
180615 |
/its/services/businessintelligence/learn/whatdataisinourdatawarehouse/ |
| Enterprise Data Warehouse (EDW) |
180609 |
/its/services/businessintelligence/enterprisedatawarehouseedw/ |
| Data Warehouse Wiki |
180617 |
https://wiki.luc.edu/login.action;jsessionid=803CF26C606CACB7444C972ED346217A?os_destination=%2Fdisplay%2FDWH%2FLUC%2BDW%2BTechnical%2BTeam%2BMeeting%2BMinutes |
| right_column |
185603 |
/its/services/businessintelligence/rightcolumn/ |
| Classroom Technologies |
177821 |
/its/services/classroomtechnologies/ |
| HyFlex Classrooms |
180838 |
/its/services/classroomtechnologies/hyflexclassrooms/ |
| Health Sciences Campus |
180839 |
/its/services/classroomtechnologies/healthsciencescampus/ |
| Lake Shore Campus |
180840 |
/its/services/classroomtechnologies/lakeshorecampus/ |
| Water Tower Campus |
180841 |
/its/services/classroomtechnologies/watertowercampus/ |
| Digital Signage |
180842 |
/its/services/classroomtechnologies/digitalsignage/ |
| Lake Shore Campus - old |
180844 |
/its/services/classroomtechnologies/lakeshorecampus-old/ |
| Water Tower Campus - old |
180845 |
/its/services/classroomtechnologies/watertowercampus-old/ |
| About Us |
180847 |
/its/services/classroomtechnologies/aboutus/ |
| CTS Hours |
180849 |
/its/services/classroomtechnologies/aboutus/ctshours/ |
| Employment |
180850 |
/its/services/classroomtechnologies/aboutus/employment/ |
| AV Vendors |
180848 |
/its/services/classroomtechnologies/avvendors/ |
| LUREC |
201642 |
/its/services/classroomtechnologies/lurec/ |
| Communication & Collaboration |
180778 |
/its/services/communicationcollaboration/ |
| cPanel Platform |
180787 |
/its/services/cpanelplatform/ |
| Data Loss Prevention |
169000 |
/its/loyoladigitalexperience/datalossprevention/ |
| right_column |
180751 |
/its/loyoladigitalexperience/datalossprevention/rightcolumn/ |
| DLP Overview Video |
177894 |
/its/loyoladigitalexperience/datalossprevention/dlpoverviewvideo/ |
| DLP Application Uses Video |
177895 |
/its/loyoladigitalexperience/datalossprevention/dlpapplicationusesvideo/ |
| Data Loss Prevention FAQs |
177896 |
/its/loyoladigitalexperience/datalossprevention/datalosspreventionfaqs/ |
| Desktop Laptop & Mobile Devices |
168985 |
/its/services/desktoplaptopmobiledevices/ |
| Network Printers |
180853 |
/its/services/desktoplaptopmobiledevices/networkprinters/ |
| Network Printers on macOS |
180854 |
/its/services/desktoplaptopmobiledevices/networkprinters/networkprintersonmacos/ |
| Mobile Devices |
180855 |
/its/services/desktoplaptopmobiledevices/mobiledevices/ |
| Mobile Device Management |
180856 |
/its/services/desktoplaptopmobiledevices/mobiledevices/mobiledevicemanagement/ |
| MDM Getting Started |
180857 |
/its/services/desktoplaptopmobiledevices/mobiledevices/mobiledevicemanagement/mdmgettingstarted/ |
| MDM Apple iOS Setup Guide |
180858 |
/its/services/desktoplaptopmobiledevices/mobiledevices/mobiledevicemanagement/mdmappleiossetupguide/ |
| MDM Android Setup Guide |
180859 |
/its/services/desktoplaptopmobiledevices/mobiledevices/mobiledevicemanagement/mdmandroidsetupguide/ |
| MDM FAQs |
180860 |
/its/services/desktoplaptopmobiledevices/mobiledevices/mobiledevicemanagement/mdmfaqs/ |
| Respecting Privacy and Personal Data |
180861 |
/its/services/desktoplaptopmobiledevices/mobiledevices/mobiledevicemanagement/respectingprivacyandpersonaldata/ |
| Mobile Device Discounts |
180879 |
/its/services/desktoplaptopmobiledevices/mobiledevices/mobiledevicediscounts/ |
| Mobile Device FAQs |
180880 |
/its/services/desktoplaptopmobiledevices/mobiledevices/mobiledevicefaqs/ |
| Adobe Creative Cloud At-Home Access |
180862 |
/its/services/desktoplaptopmobiledevices/adobecreativecloudat-homeaccess/ |
| Technology Purchases |
180863 |
/its/services/desktoplaptopmobiledevices/technologypurchases/ |
| Personal Technology Purchases |
180864 |
/its/services/desktoplaptopmobiledevices/technologypurchases/personaltechnologypurchases/ |
| Personal Purchase Recommendations |
180865 |
/its/services/desktoplaptopmobiledevices/technologypurchases/personaltechnologypurchases/personalpurchaserecommendations/ |
| Departmental Technology Purchases |
180866 |
/its/services/desktoplaptopmobiledevices/technologypurchases/departmentaltechnologypurchases/ |
| Hardware Software Review Process |
180867 |
/its/services/desktoplaptopmobiledevices/technologypurchases/hardwaresoftwarereviewprocess/ |
| PC Refresh Program |
180868 |
/its/services/desktoplaptopmobiledevices/pcrefreshprogram/ |
| Guidelines |
180869 |
/its/services/desktoplaptopmobiledevices/pcrefreshprogram/guidelines/ |
| Remote Desktop Connection |
180871 |
/its/services/desktoplaptopmobiledevices/remotedesktopconnection/ |
| Apporto |
180875 |
/its/services/desktoplaptopmobiledevices/apporto/ |
| Jamf |
180876 |
/its/services/desktoplaptopmobiledevices/jamf/ |
| Enterprise Content Management |
185618 |
/its/services/enterprisecontentmanagement/ |
| Overview |
185619 |
/its/services/enterprisecontentmanagement/overview/ |
| How does DocFinity work? |
185621 |
/its/services/enterprisecontentmanagement/overview/howdoesdocfinitywork/ |
| LUC's ECM Team |
185622 |
/its/services/enterprisecontentmanagement/overview/lucsecmteam/ |
| Testimonials |
185623 |
/its/services/enterprisecontentmanagement/overview/testimonials/ |
| Tools & Resources |
185620 |
/its/services/enterprisecontentmanagement/toolsresources/ |
| Recommended Scanners |
185626 |
/its/services/enterprisecontentmanagement/toolsresources/recommendedscanners/ |
| DocFinity User Training Guides |
185627 |
/its/services/enterprisecontentmanagement/toolsresources/docfinityusertrainingguides/ |
| DocFinity How-to Video Tutorials |
185628 |
/its/services/enterprisecontentmanagement/toolsresources/docfinityhow-tovideotutorials/ |
| Frequently Asked Questions |
185629 |
/its/services/enterprisecontentmanagement/toolsresources/frequentlyaskedquestions/ |
| Outsourcing Your Scanning and Indexing |
185630 |
/its/services/enterprisecontentmanagement/toolsresources/outsourcingyourscanningandindexing/ |
| Enterprise Learning Hub |
168986 |
/its/services/enterpriselearninghub/ |
| Event Planning |
180790 |
/its/services/eventplanning/ |
| Event Requests |
181118 |
/its/services/eventplanning/eventrequests/ |
| Email - Microsoft Outlook |
168987 |
/its/services/email-microsoftoutlook/ |
| Exchange Online FAQs |
180780 |
/its/services/exchangeonline-email/exchangeonlinefaqs/ |
| HSC Physician FAQs |
180781 |
/its/services/exchangeonline-email/hscphysicianfaqs/ |
| Email Protection and Anti-Spam |
180782 |
/its/services/exchangeonline-email/emailprotectionandanti-spam/ |
| Junk Mail Filters |
180783 |
/its/services/exchangeonline-email/emailprotectionandanti-spam/junkmailfilters/ |
| Reporting Junk Mail |
180784 |
/its/services/exchangeonline-email/emailprotectionandanti-spam/reportingjunkmail/ |
| Reporting Erroneous Junk Mail |
180785 |
/its/services/exchangeonline-email/emailprotectionandanti-spam/reportingerroneousjunkmail/ |
| File Storage |
180791 |
/its/services/filestorage/ |
| LOCUS Upgrade |
169002 |
/its/loyoladigitalexperience/locusupgrade/ |
| right_column |
178455 |
/its/loyoladigitalexperience/locusupgrade/rightcolumn/ |
| LOCUS Fluid |
178454 |
/its/loyoladigitalexperience/locusupgrade/locusfluid/ |
| Loyola Software |
168988 |
/its/services/loyolasoftware/ |
| Adobe Creative Cloud (CC) Update |
180898 |
/its/services/loyolasoftware/adobecreativecloudccupdate/ |
| Adobe Creative Cloud Sign-In Instructions |
180899 |
/its/services/loyolasoftware/adobecreativecloudccupdate/adobecreativecloudsign-ininstructions/ |
| Adobe Sign |
205196 |
/its/services/loyolasoftware/adobesign/ |
| Apporto |
180904 |
/its/services/desktoplaptopmobiledevices/apporto/ |
| End Note |
180789 |
/its/services/loyolasoftware/endnote/ |
| Lab/Classroom Software Applications |
180901 |
/its/dms/computerlabssoftware/softwareapplications/ |
| MATLAB |
180900 |
/its/services/loyolasoftware/matlab/ |
| Software Installation Requests |
180903 |
/its/services/loyolasoftware/softwareinstallationrequests/ |
| Microsoft 365 |
168989 |
/its/services/microsoft365/ |
| About Microsoft 365 |
180890 |
/its/services/microsoft365/aboutmicrosoft365/ |
| Updated Login - Microsoft 365 Services |
180891 |
/its/services/microsoft365/updatedlogin-microsoft365services/ |
| Microsoft 365 Policy |
180892 |
/its/services/microsoft365/microsoft365policy/ |
| Microsoft Outlook |
201615 |
https://outlook.office.com/ |
| OneDrive |
180893 |
/its/services/microsoft365/onedrive/ |
| SharePoint |
180894 |
/its/services/microsoft365/sharepoint/ |
| Teams |
180895 |
/its/services/microsoft365/teams/ |
| Planned Office Upgrade to Microsoft 365 |
188355 |
/its/services/microsoft365/plannedupgradem365/ |
| Microsoft Office |
180792 |
/its/services/microsoftoffice/ |
| Microsoft Self Service Password Reset |
201622 |
/its/services/microsoftselfservicepasswordreset/ |
| First Time Setup |
180984 |
/its/services/microsoftselfservicepasswordreset/firsttimesetup/ |
| Second Factor Setup |
180987 |
/its/services/microsoftselfservicepasswordreset/secondfactorsetup/ |
| Password Reset |
180985 |
/its/services/microsoftselfservicepasswordreset/passwordreset/ |
| Unlock Account |
180986 |
/its/services/microsoftselfservicepasswordreset/unlockaccount/ |
| Password Reset FAQs |
180983 |
/its/services/microsoftselfservicepasswordreset/passwordresetfaqs/ |
| right_column |
201623 |
/its/services/microsoftselfservicepasswordreset/rightcolumn/ |
| Networking |
180793 |
/its/services/networking/ |
| Using The Network |
181116 |
/its/services/networking/usingthenetwork/ |
| Loyola NetReg - Register Now |
181123 |
/its/services/networking/usingthenetwork/loyolanetreg-registernow/ |
| Guest Wifi |
181124 |
/its/services/networking/usingthenetwork/guestwifi/ |
| Wi-Fi Calling |
181125 |
/its/services/networking/usingthenetwork/wi-ficalling/ |
| Password Management |
168990 |
/its/services/passwordmanagement/ |
| First Time Setup |
180993 |
/its/services/passwordmanagement/firsttimesetup/ |
| Password Self-Service |
180992 |
/its/services/passwordmanagement/passwordself-service/ |
| Password Reset - Next Steps |
180990 |
/its/services/passwordmanagement/passwordreset-nextsteps/ |
| Resetting Your Password from Off-Campus |
180991 |
/its/services/passwordmanagement/resettingyourpasswordfromoff-campus/ |
| Password Management |
180988 |
/its/services/passwordmanagement/passwordmanagement/ |
| Multi-Factor Authentication |
168999 |
/its/loyoladigitalexperience/multi-factorauthentication/ |
| MFA Getting Started |
181041 |
/its/loyoladigitalexperience/multi-factorauthentication/mfagettingstarted/ |
| MFA Detailed Instructions |
181042 |
/its/loyoladigitalexperience/multi-factorauthentication/mfadetailedinstructions/ |
| Multi-Factor Authentication FAQs |
181035 |
/its/loyoladigitalexperience/multi-factorauthentication/multi-factorauthenticationfaqs/ |
| MFA Supported Technology |
181044 |
/its/loyoladigitalexperience/multi-factorauthentication/mfasupportedtechnology/ |
| MFA for LOCUS |
206290 |
/its/services/passwordmanagement/multi-factorauthentication/mfaforlocus/ |
| First Time Setup |
181045 |
/its/loyoladigitalexperience/multi-factorauthentication/firsttimesetup/ |
| Option 1: Authenticator App Pop-Up |
181046 |
/its/loyoladigitalexperience/multi-factorauthentication/option1authenticatorapppop-up/ |
| Option 2: Text |
181047 |
/its/loyoladigitalexperience/multi-factorauthentication/option2text/ |
| Option 3: Call |
181048 |
/its/loyoladigitalexperience/multi-factorauthentication/option3call/ |
| right_column |
204414 |
/its/services/passwordmanagement/rightcolumn/ |
| Printing |
180794 |
/its/services/printing/ |
| PrinterLogic by Vasion |
197074 |
/its/services/printing/printerlogic/ |
| Project Central |
168991 |
/its/services/projectcentral/ |
| Project Management |
168996 |
/its/services/projectmanagement/ |
| Resources |
181586 |
/its/services/projectmanagement/resources/ |
| Project Management Articles |
181608 |
/its/services/projectmanagement/resources/projectmanagementarticles/ |
| PM Knowledge Sources |
181609 |
/its/services/projectmanagement/resources/pmknowledgesources/ |
| Web Project Page Templates |
181616 |
/its/services/projectmanagement/resources/webprojectpagetemplates/ |
| right_column |
181589 |
/its/services/projectmanagement/rightcolumn/ |
| PMO Mission & Vision |
204265 |
/its/services/projectmanagement/pmomissionvision/ |
| Research |
180795 |
/its/services/research/ |
| Service Status |
180801 |
/its/services/servicestatus/ |
| Student Technology Resources |
180796 |
/its/services/studenttechnologyresources/ |
| Teaching and Learning |
180797 |
/its/services/teachingandlearning/ |
| Technology Guide To Remote Work |
168993 |
/its/services/technologyguidetoremotework/ |
| Technology Roadmap |
168994 |
/its/services/technologyroadmap/ |
| New Students |
181542 |
/its/services/technologyroadmap/newstudents/ |
| Stage 1 |
181543 |
/its/services/technologyroadmap/newstudents/stage1/ |
| Changing Your Password |
181549 |
/its/services/technologyroadmap/newstudents/stage1/changingyourpassword/ |
| Logging Into LOCUS |
181550 |
/its/services/technologyroadmap/newstudents/stage1/loggingintolocus/ |
| LOCUS Student Homepage Overview |
181551 |
/its/services/technologyroadmap/newstudents/stage1/locusstudenthomepageoverview/ |
| Check your Email |
181552 |
/its/services/technologyroadmap/newstudents/stage1/checkyouremail/ |
| Stage 2 |
181544 |
/its/services/technologyroadmap/newstudents/stage2/ |
| Managing your Personal Info on LOCUS |
181554 |
/its/services/technologyroadmap/newstudents/stage2/managingyourpersonalinfoonlocus/ |
| Student FERPA, Parent/Guest Access, and Privacy Settings on LOCUS |
181555 |
/its/services/technologyroadmap/newstudents/stage2/studentferpaparentguestaccessandprivacysettingsonlocus/ |
| Entering Immunizations in LOCUS |
181556 |
/its/services/technologyroadmap/newstudents/stage2/enteringimmunizationsinlocus/ |
| Stage 3 |
181545 |
/its/services/technologyroadmap/newstudents/stage3/ |
| Enrolling in Classes through LOCUS |
181557 |
/its/services/technologyroadmap/newstudents/stage3/enrollinginclassesthroughlocus/ |
| Enrollment Tips & Tricks |
181558 |
/its/services/technologyroadmap/newstudents/stage3/enrollmenttipstricks/ |
| Stage 4 |
181546 |
/its/services/technologyroadmap/newstudents/stage4/ |
| Campus Finances Overview and Account Summary |
181559 |
/its/services/technologyroadmap/newstudents/stage4/campusfinancesoverviewandaccountsummary/ |
| Electronic Billing and the iPlan |
181560 |
/its/services/technologyroadmap/newstudents/stage4/electronicbillingandtheiplan/ |
| Student Health Insurance |
181561 |
/its/services/technologyroadmap/newstudents/stage4/studenthealthinsurance/ |
| How to Setup Direct Deposit |
181562 |
/its/services/technologyroadmap/newstudents/stage4/howtosetupdirectdeposit/ |
| Wireless |
181563 |
/its/services/technologyroadmap/newstudents/stage4/wireless/ |
| Supplemental |
181547 |
/its/services/technologyroadmap/newstudents/supplemental/ |
| Digital Media Services |
181564 |
/its/services/technologyroadmap/newstudents/supplemental/digitalmediaservices/ |
| Sakai |
181565 |
/its/services/technologyroadmap/newstudents/supplemental/sakai/ |
| Campus Downloading |
181566 |
/its/services/technologyroadmap/newstudents/supplemental/campusdownloading/ |
| Loyola Alert |
181567 |
/its/services/technologyroadmap/newstudents/supplemental/loyolaalert/ |
| Microsoft 365 |
181568 |
/its/services/technologyroadmap/newstudents/supplemental/microsoft365/ |
| Complete Map for New Students |
181548 |
/its/services/technologyroadmap/newstudents/completemapfornewstudents/ |
| Telecommunications |
168995 |
/its/services/telecommunications/ |
| Call Forwarding vs Avaya Softphone |
181532 |
/its/services/telecommunications/callforwardingvsavayasoftphone/ |
| Conference Calling |
181533 |
/its/services/telecommunications/conferencecalling/ |
| On-Campus Telephones |
181534 |
/its/services/telecommunications/on-campustelephones/ |
| Res Hall Networks & Phones |
180981 |
/its/services/telecommunications/reshallnetworksphones/ |
| Res Hall Wiring Configurations |
181536 |
/its/services/telecommunications/reshallwiringconfigurations/ |
| Telephone System Replacement |
201593 |
/its/services/networking/usingthenetwork/telephonesystemreplacement/ |
| Voicemail Instructions |
181535 |
/its/services/telecommunications/voicemailinstructions/ |
| Terminal Four - T4 |
180776 |
https://www.luc.edu/t4/ |
| Wireless Connect |
168997 |
/its/services/wirelessconnect/ |
| Wireless FAQ |
180641 |
/its/services/wirelessconnect/wirelessfaq/ |
| Android Wireless |
181086 |
/its/services/wirelessconnect/wirelessfaq/androidwireless/ |
| Chromebook Wireless |
181087 |
/its/services/wirelessconnect/wirelessfaq/chromebookwireless/ |
| Google Pixel Wireless |
181088 |
/its/services/wirelessconnect/wirelessfaq/googlepixelwireless/ |
| iPhone Wireless |
181089 |
/its/services/wirelessconnect/wirelessfaq/iphonewireless/ |
| Mac Wireless |
181090 |
/its/services/wirelessconnect/wirelessfaq/macwireless/ |
| Windows Wireless |
181093 |
/its/services/wirelessconnect/wirelessfaq/windowswireless/ |
| Gaming Consoles, TVs, Printers, and other Devices |
180643 |
/its/services/wirelessconnect/gamingconsolestvsprintersandotherdevices/ |
| Eduroam |
180644 |
/its/services/wirelessconnect/eduroam/ |
| News |
185918 |
/its/news/ |
| ITS News Archive |
185970 |
/its/news/itsnewsarchive/ |
| Adobe Updates |
200406 |
/its/news/adobeupdates/ |
| LOCUS |
203398 |
/its/news/locus/ |
| Microsoft Outlook & Email |
188425 |
/its/news/microsoftoutlookemail/ |
| Phishing & Spam |
192345 |
/its/news/phishingspam/ |
| Zoom Updates |
185974 |
/its/news/zoom/ |
| right_column |
207429 |
/its/news/rightcolumn/ |
| Support |
185642 |
/its/support/ |
| Lawson & Employee Self-Service |
185643 |
/its/support/lawson-support.shtml |
| Lawson Under Maintenance |
185644 |
/its/support/lawsonemployeeself-service/lawsonundermaintenance.shtml |
| UKG Ready |
205767 |
/its/support/ukg-ready.shtml/ |
| Onboarding For New Staff & Faculty |
194217 |
/its/onboarding/ |
| UVID Information |
181577 |
/its/uvidinformation/ |
| Internal Information |
182133 |
/its/internal.shtml |
| Loyola Digital Experience |
159747 |
/its/loyoladigitalexperience/ |
| Enterprise Learning Hub |
204196 |
https://www.luc.edu/its/services/enterpriselearninghub/ |
| Multi-Factor Authentication |
206656 |
/its/services/passwordmanagement/multi-factorauthentication/ |
| Windows 11 Migration |
203084 |
/its/windows11 |
| Footer |
159740 |
/its/footer/ |
| I Links |
159742 |
/its/ilinks/ |
| site_logo |
159739 |
/its/sitelogo/ |
| social media |
159743 |
/its/socialmedia/ |
| Digital Transformation Initiative |
206081 |
/its/aboutus/projects/dti/ |
| site_logo |
206083 |
/its-dev/aboutus/projects/dti/sitelogo/ |
| Footer |
206084 |
/its-dev/aboutus/projects/dti/footer/ |
| cta |
206085 |
/its-dev/aboutus/projects/dti/cta/ |
| social media |
206087 |
/its-dev/aboutus/projects/dti/socialmedia/ |
| modules-programming |
206088 |
/its-dev/aboutus/projects/dti/modules-programming/ |
| About |
206109 |
/its-dev/aboutus/projects/dti/about/ |
| Leadership Team |
206110 |
/its-dev/aboutus/projects/dti/about/leadershipteam/ |
| FAQs |
206111 |
/its-dev/aboutus/projects/dti/about/faqs/ |
| Glossary |
206112 |
/its-dev/aboutus/projects/dti/glossary/ |
| Projects Overview |
206113 |
/its-dev/aboutus/projects/dti/projectsoverview/ |
| Workday Implementation |
206114 |
/its-dev/aboutus/projects/dti/projectsoverview/workdayimplementation/ |
| Student Information System Revitalization |
206116 |
/its-dev/aboutus/projects/dti/projectsoverview/studentinformationsystemrevitalization/ |
| Cayuse Implementation |
206117 |
/its-dev/aboutus/projects/dti/projectsoverview/cayuseimplementation/ |
| Enterprise Portal |
206118 |
/its-dev/aboutus/projects/dti/projectsoverview/enterpriseportal/ |
| Salesforce Ascend |
206115 |
/its-dev/aboutus/projects/dti/projectsoverview/salesforceascend/ |
| Inside Loyola |
36112 |
/il/ |
| site_logo |
185492 |
/il/sitelogo/ |
| Footer |
185493 |
/il/footer/ |
| Desktop |
63160 |
/il/desktop/ |
| Stories |
185490 |
/il/stories/ |
| archive |
185494 |
/il/stories/archive/ |
| right_column |
185495 |
/il/stories/rightcolumn/ |
| Inspired |
167361 |
/inspired/ |
| site_logo |
167362 |
/inspired/sitelogo/ |
| Footer |
167363 |
/inspired/footer/ |
| cta |
167365 |
/inspired/cta/ |
| social media |
167366 |
/inspired/socialmedia/ |
| modules-programming |
167719 |
/inspired/modules-programming/ |
| About |
167367 |
/inspired/about/ |
| Program Overview |
167368 |
/inspired/about/programoverview/ |
| Mission and Goals |
167369 |
/inspired/about/missionandgoals/ |
| Meet the Team |
167370 |
/inspired/about/meettheteam/ |
| Contact Us |
167374 |
/inspired/about/contactus/ |
| Programs |
168214 |
/inspired/programs/ |
| Faculty Advocates |
168215 |
/inspired/programs/facultyadvocates/ |
| Faculty Workload Equity Project |
168216 |
/inspired/programs/facultyworkloadequityproject/ |
| INSPIRED Micro-Grants |
168217 |
/inspired/programs/inspiredmicro-grants/ |
| Magis Faculty Leadership Program |
168218 |
/inspired/programs/magisfacultyleadershipprogram/ |
| Peer Mentoring Circles |
168219 |
/inspired/programs/peermentoringcircles/ |
| How-To Series |
183834 |
/inspired/programs/how-toseries/ |
| Events |
167381 |
/inspired/events/ |
| In the News |
167379 |
/inspired/events/inthenews/ |
| Resources |
167411 |
/inspired/resources/ |
| Faculty Network |
167419 |
/inspired/resources/facultynetwork/ |
| Muna Aryal |
168213 |
/inspired/resources/facultynetwork/munaaryal/ |
| Rasha Abbasi |
177350 |
/inspired/resources/facultynetwork/rashaabbasi/ |
| Loyola Resources |
167418 |
/inspired/resources/loyolaresources/ |
| Micro-Grants Program |
198685 |
/inspired/resources/micro-grantsprogram/ |
| Faculty Advocates |
198701 |
/inspired/resources/facultyadvocates/ |
| Service Workload Equity |
198702 |
/inspired/resources/serviceworkloadequity/ |
| How-To Series |
198703 |
/inspired/resources/how-toseries/ |
| Peer Mentoring Circle |
198704 |
/inspired/resources/peermentoringcircle/ |
| Magis Faculty Leadership |
198705 |
/inspired/resources/magisfacultyleadership/ |
| Institute for Racial Justice (IRJ) |
177168 |
/irj/ |
| site_logo |
177169 |
/irj/sitelogo/ |
| Footer |
177170 |
/irj/footer/ |
| cta |
177172 |
/irj/cta/ |
| social media |
204228 |
/irj/socialmedia/ |
| modules-programming |
177210 |
/irj/modules-programming/ |
| About Us |
177176 |
/irj/aboutus/ |
| Mission and Vision |
177178 |
/irj/aboutus/missionandvision/ |
| Stories |
180117 |
/irj/stories/ |
| Events |
177218 |
/irj/aboutus/events/ |
| Equitable Education in the State of Illinois |
188244 |
/irj/aboutus/events/equitableeducationinthestateofillinois/ |
| Racial Capitalism and Health Disparities |
181210 |
/irj/aboutus/events/racialcapitalismandhealthdisparities/ |
| Racial Capitalism and Food Insecurity |
181455 |
/irj/aboutus/events/racialcapitalism-foodinsecurity/ |
| Black Europe and the Mediterranean Wall |
181979 |
/irj/aboutus/events/blackeuropeandthemediterraneanwall/ |
| Leading for Good with Heather McGhee |
182288 |
/irj/aboutus/events/leadingforgoodwithheathermcghee/ |
| Black Europe Symposium |
182298 |
/irj/aboutus/events/blackeuropesymposium/ |
| Racial Capitalism and Quality-of-Life Policing |
182601 |
/irj/aboutus/events/racialcapitalismandquality-of-lifepolicing/ |
| IRJ Research Showcase and Team Celebration |
186972 |
/irj/aboutus/events/irjresearchshowcaseandteamcelebration/ |
| Decolonizing the Future: Creating Brave New Worlds |
185563 |
/irj/aboutus/events/decolonizingthefuturecreatingbravenewworlds/ |
| South to America – The Long Quest for Racial Justice with Imani Perry |
187302 |
/irj/aboutus/events/southtoamericathelongquestforracialjusticewithimaniperry/ |
| Current Projects |
206410 |
/irj/currentprojects/ |
| Rethinking TIF Districts |
207017 |
/irj/currentprojects/rethinkingtifdistricts/ |
| Why Chicago’s TIF System Isn’t Working for South Side Neighborhoods |
206903 |
/irj/ourprojects/tif-district-report-dev/whychicagostifsystemisntworkingforsouthsideneighborhoods/ |
| Hope in Increments: The Elusive Promise of TIF in Chicago |
206904 |
/irj/ourprojects/tif-district-report-dev/hopeinincrementstheelusivepromiseoftifinchicago/ |
| Whitewashed ll Report |
207042 |
/irj/ourprojects/whitewashedllreport/ |
| A culture of Harm |
207043 |
/irj/ourprojects/whitewashedllreport/acultureofharm/ |
| Fares Qaedan |
207044 |
/irj/ourprojects/whitewashedllreport/faresqaedan/ |
| Community Engaged Design Lab |
206420 |
/irj/currentprojects/communityengageddesignlab/ |
| Session One: Migration |
206524 |
/irj/currentprojects/communityengageddesignlab/sessiononemigration/ |
| Session Two: Grounds for Play |
206573 |
/irj/currentprojects/communityengageddesignlab/sessiontwogroundsforplay/ |
| Landscape of Black Student Trajectories and Experiences in Illinois |
207270 |
/irj/currentprojects/landscapeofblackstudenttrajectoriesandexperiencesinillinois/ |
| Academics |
187783 |
/irj/academics/ |
| Our Projects |
177182 |
/irj/ourprojects/ |
| Featured Projects |
177185 |
/irj/ourcurrentprojects/featuredprojects/ |
| Men of Math (M2) Fellowship |
177186 |
/irj/ourcurrentprojects/featuredprojects/menofmathm2fellowship/ |
| Leading for DEI |
178065 |
https://www.luc.edu/baumhartcenter/education/leadingfordei/ |
| Chicago-Torino Lab |
184534 |
/irj/ourcurrentprojects/chicago-torinolab/ |
| Chicago Urban League "State of Black Chicago" Report |
186903 |
/irj/ourcurrentprojects/chicagourbanleaguestateofblackchicagoreport/ |
| Postdoctoral Fellows |
191083 |
/irj/ourcurrentprojects/postdoctoralfellows/ |
| Current Fellows |
191084 |
/irj/ourcurrentprojects/postdoctoralfellows/currentfellows/ |
| Rethinking TIF Districts for Racial Justice |
206781 |
/irj/ourprojects/tif-district-report-dev/ |
| Our People |
177202 |
/irj/ourpeople/ |
| Leadership |
177204 |
/irj/ourpeople/leadership/ |
| Meet the Team |
177205 |
/irj/ourpeople/meettheteam/ |
| Directory |
178082 |
/irj/ourpeople/meettheteam/directory/ |
| Faculty Affiliates |
193789 |
/irj/ourpeople/facultyaffiliates/ |
| Get Involved |
177211 |
/irj/getinvolved/ |
| As a Student |
177212 |
/irj/getinvolved/asastudent/ |
| As a Post-Doc |
177213 |
/irj/getinvolved/asapost-doc/ |
| As a Faculty Member |
177214 |
/irj/getinvolved/asafacultymember/ |
| As a Community Partner |
177215 |
/irj/getinvolved/asacommunitypartner/ |
| Make a Gift |
178687 |
https://securelb.imodules.com/s/1548/alumni/giving.aspx?sid=1548&gid=2&pgid=497&cid=1256&appealcode=23Y03&dids=426&bledit=1 |
| Stories |
196419 |
/irj/stories/ |
| archive |
196420 |
/irj/stories/archive/ |
| Strengthening Skills and Building Community Among Students and Teachers Underrepresented in STEM |
179575 |
/irj/stories/strengtheningskillsandbuildingcommunityamongstudentsandteachersunderrepresentedinstem/ |
| Creating Pathways to STEM Careers for Black and Latinx Students |
179783 |
/irj/stories/creatingpathwaystostemcareersforblackandlatinxstudents/ |
| The Black Europe Symposium 2023: Who Defines Blackness? |
185120 |
/irj/stories/theblackeuropesymposium2023whodefinesblackness/ |
| Driving Innovation and Economic Equity for a Better World at Leading for Good 2023 |
186000 |
/irj/stories/drivinginnovationandeconomicequityforabetterworldatleadingforgood2023/ |
| Postdoctoral Fellow Profile: Kwabena Krah |
188249 |
/irj/stories/postdoctoralfellowprofilekwabenakrah/ |
| Postdoctoral Fellow Profile: Meghna Chandra |
188264 |
/irj/stories/postdoctoralfellowprofilemeghnachandra/ |
| Postdoctoral Fellow Profile: Farzaneh Khayat |
188598 |
/irj/stories/postdoctoralfellowprofilefarzanehkhayat/ |
| Institute of Pastoral Studies |
16045 |
/ips/ |
| site_logo |
16046 |
/ips/sitelogo/ |
| Footer |
198552 |
/ips/footer/ |
| I Links |
198554 |
/ips/ilinks/ |
| social media |
198555 |
/ips/socialmedia/ |
| About Us |
16052 |
/ips/about/ |
| About Us |
16052 |
/ips/about/ |
| Welcome Message |
34589 |
/ips/about/welcomemessage/ |
| Accreditation and Membership |
16055 |
/ips/about/affiliations/ |
| IPS Mission and Vision |
53436 |
/ips/about/ipsmissionandvision/ |
| Building Bridges North-South |
178091 |
/ips/about/ipsmissionandvision/buildingbridges/ |
| Facts, Figures, & Effectiveness |
126812 |
/ips/about/factsfigureseffectiveness/ |
| Faculty & Staff |
16057 |
/ips/about/faculty/ |
| right_column |
33829 |
/ips/about/faculty/rightcolumn/ |
| Emeriti Faculty |
70129 |
/ips/about/faculty/emeritae/ |
| Profiles |
202629 |
/ips/about/faculty/adjunctfacultyandemeritae/profiles/ |
| Profiles |
202627 |
/ips/about/faculty/profiles/ |
| News & Events |
43059 |
/ips/stories/ |
| archive |
43060 |
/ips/stories/archive/ |
| Blog |
34630 |
http://blogs.luc.edu/ips/ |
| Newsletter |
78297 |
/ips/ipsnewsletter/ |
| right_column |
80261 |
/ips/ipsnewsletter/rightcolumn/ |
| Events |
83920 |
/ips/stories/events/ |
| IPS 50th Anniversary Celebration |
70335 |
/ips/stories/events/ips50thanniversarycelebration/ |
| right_column |
70337 |
/ips/stories/events/ips50thanniversarycelebration/rightcolumn/ |
| IPS 2015 Commissioning and Graduation Party |
77865 |
/ips/stories/events/ips2015commissioningandgraduationparty/ |
| IPS Student Party |
73268 |
/ips/stories/events/ipsstudentparty/ |
| IPS Family Holiday Gathering |
72504 |
/ips/stories/events/ipsfamilyholidaygathering/ |
| Student & Alumni Stories |
205560 |
/ips/stories/studentalumnistories/ |
| Alexandra Ortega |
205578 |
/ips/stories/studentalumnistories/alexandraortega/ |
| Location |
79378 |
/ips/about/location/ |
| right_column |
83637 |
/ips/about/location/rightcolumn/ |
| Alumni |
68371 |
/ips/alumni/ |
| archive |
68372 |
/ips/alumni/archive/ |
| Degree Programs |
16116 |
/ips/degrees/ |
| right_column |
33804 |
/ips/degrees/rightcolumn/ |
| MA in Pastoral Counseling |
198581 |
https://gpem.luc.edu/portal/program?name=pastoralcounselingma |
| MA in Counseling for Ministry |
198582 |
https://gpem.luc.edu/portal/program?name=counselingforministryma |
| MA in Pastoral Studies - General & Four Concentrations |
198583 |
https://gpem.luc.edu/portal/program?name=pastoralstudiesma |
| Pastoral Studies Online Bilingual MA |
198585 |
https://gpem.luc.edu/portal/program?name=pastoralstudiesonlinebilingualma |
| Pastoral Studies Online Bilingual MA |
198585 |
https://gpem.luc.edu/portal/program?name=pastoralstudiesonlinebilingualma |
| MA in Social Justice - General & Social Enterprise Concentration |
198586 |
https://gpem.luc.edu/portal/program?name=socialjusticema |
| MA in Christian Spirituality - General & Spiritual Direction Concentration |
198587 |
https://gpem.luc.edu/portal/program?name=christianspiritualityma |
| MDiv (Master of Divinity) - General & Two Concentrations |
198588 |
https://gpem.luc.edu/portal/program?name=divinitymdiv |
| Dual Degree Programs |
37315 |
/ips/dual-degree-programs/ |
| Graduate Certificates |
83328 |
/ips/graduate-certificates/ |
| right_column |
33812 |
/ips/graduate-certificates/rightcolumn/ |
| Pastoral Counseling Certificate |
198592 |
https://gpem.luc.edu/portal/program?name=pastoralcounselingcertificate |
| Pastoral Leadership Certificate |
198593 |
https://gpem.luc.edu/portal/program?name=pastoralleadershipcertificate |
| Church Management Certificate |
198594 |
https://gpem.luc.edu/portal/program?name=churchmanagementcertificate |
| Religious Education Certificate |
198595 |
https://gpem.luc.edu/portal/program?name=religiouseducationcertificate |
| Christian Spirituality Certificate |
198596 |
https://gpem.luc.edu/portal/program?name=christianspiritualitycertificate |
| Spiritual Direction Certificate |
198597 |
https://gpem.luc.edu/portal/program?name=spiritualdirectioncertificate |
| Social Justice Certificate |
198598 |
https://gpem.luc.edu/portal/program?name=socialjusticecertificate |
| Certificate with Degree |
108164 |
/ips/graduate-certificates/certificatewithdegree/ |
| Noncredit Courses |
31431 |
/ips/graduate-certificates/noncredit-courses/ |
| Continuing Education |
94813 |
/ips/continuing-education/ |
| Pilgrimage Program |
94902 |
/ips/continuing-education/pilgrimageprogram/ |
| IPS Scripture School |
98997 |
/ips/continuing-education/ipsscriptureschool/ |
| Scripture School Programs |
204301 |
/ips/continuing-education/ipsscriptureschool/scriptureschoolprograms/ |
| EVENTS |
147261 |
/ips/continuing-education/ipsscriptureschool/events/ |
| Escuela de Sagrada Escritura del Instituto de Estudios Pastorales (IPS-ESE) / IPS Scripture Studies in Spanish |
94980 |
/ips/continuing-education/ipsbiblia |
| Certificate in Pastoral Ministry for the United Kingdom |
104533 |
/ips/continuing-education/certificateinpastoralministryfortheunitedkingdom/ |
| Certificate in Restorative Justice Ministry |
120608 |
/ips/continuing-education/certificateinrestorativejusticeministry/ |
| Ignatian Wisdom Fellowship |
120644 |
/ips/continuing-education/iwf/ |
| Parish Leadership and Management Programs |
65326 |
/ips/parish-leadership-programs/ |
| Education and Training |
65820 |
/ips/parish-leadership-programs/education-training/ |
| Contact |
65939 |
/ips/parish-leadership-programs/contact/ |
| right_column |
70824 |
/ips/parish-leadership-programs/rightcolumn/ |
| IPS Cursos Biblicos en Español / IPS Bible Studies in Spanish |
86313 |
/ips/parish-leadership-programs/ipscursosbiblicosenespaolipsbiblestudiesinspanish/ |
| Integrated Classrooms |
190868 |
/ips/continuing-education/integratedclassrooms/ |
| Lecture Series |
206833 |
/ips/continuing-education/lectureseries/ |
| Admission |
16192 |
/ips/admission/ |
| Visit Us |
16198 |
/ips/admission/visit/ |
| Which Program is Right for Me |
100666 |
/ips/admission/whichprogramisrightforme/ |
| Application Process |
198600 |
https://gpem.luc.edu/portal/admission?tab=admission-process |
| FAQs |
198601 |
https://gpem.luc.edu/portal/admission?tab=faq |
| Financial Aid |
16199 |
/ips/admission/finaid/ |
| Request Information |
61879 |
/ips/rfi/index.cfm |
| Thank you for your request |
61880 |
/ips/rfi/success/index.shtml |
| Advanced Standing |
31280 |
/ips/admission/advancedstandingtransfercredit/ |
| Advanced Standing for Deacons |
54660 |
/ips/admission/advancedstandingtransfercredit/advancedstandingfordeacons/ |
| Advanced Standing for CCSS |
55957 |
/ips/admission/advancedstandingtransfercredit/advancedstandingforccss/ |
| Transfer Credit |
96201 |
/ips/admission/transfercredit/ |
| Financial Aid |
112638 |
/ips/admission/finaid-test/ |
| Resources |
83329 |
/ips/resources/ |
| right_column |
83573 |
/ips/resources/rightcolumn/ |
| Academic Policies |
16112 |
/ips/resources/procedures/ |
| Chaplaincy Preparation |
16214 |
/ips/resources/chaplaincy/ |
| Contextual Education |
35737 |
/ips/resources/contextualeducation/ |
| Clinical Pastoral Education (CPE) |
16213 |
/ips/resources/cpe/ |
| right_column |
33855 |
/ips/resources/cpe/rightcolumn/ |
| Master of Arts in Pastoral Counseling (MAPC) |
66164 |
/ips/resources/contextualeducation/masterofartsinpastoralcounselingmapc/ |
| MAPC Student Handbook |
122728 |
/ips/resources/contextualeducation/masterofartsinpastoralcounselingmapc/mapcstudenthandbook/ |
| MAPC Forms and Internship Resources |
85119 |
/ips/resources/contextualeducation/masterofartsinpastoralcounselingmapc/mapcformsandinternshipresources/ |
| MAPC Practicum-Internship Resource |
122588 |
/ips/resources/contextualeducation/masterofartsinpastoralcounselingmapc/mapcformsandinternshipresources/mapcpracticum-internshipresource/ |
| MAPC Clinical Practicum_Internship Agreement Form |
122589 |
/ips/resources/contextualeducation/masterofartsinpastoralcounselingmapc/mapcformsandinternshipresources/mapcclinicalpracticuminternshipagreementform/ |
| MAPC Fall Practicum-Internship Evaluation Form |
122590 |
/ips/resources/contextualeducation/masterofartsinpastoralcounselingmapc/mapcformsandinternshipresources/mapcfallpracticum-internshipevaluationform/ |
| MAPC Spring Practicum-Intersnhip Evaluation Form |
122591 |
/ips/resources/contextualeducation/masterofartsinpastoralcounselingmapc/mapcformsandinternshipresources/mapcspringpracticum-intersnhipevaluationform/ |
| Master of Arts in Counseling for Ministry |
103585 |
/ips/resources/contextualeducation/masterofartsincounselingforministry/ |
| Master of Arts in Pastoral Studies (MAPS) |
66165 |
/ips/resources/contextualeducation/masterofartsinpastoralstudiesmaps/ |
| Master of Arts in Social Justice (MASJ) |
66166 |
/ips/resources/contextualeducation/masterofartsinsocialjusticemasj/ |
| Master of Arts in Christian Spirituality (MACS) |
83177 |
/ips/resources/contextualeducation/masterofartsinchristianspiritualitymacs/ |
| Master of Divinity (MDiv) |
66163 |
/ips/resources/contextualeducation/masterofdivinitymdiv/ |
| CE Forms |
85117 |
/ips/resources/contextualeducation/ceforms/ |
| Contextual Education Site Agreement Form |
122770 |
/ips/resources/contextualeducation/ceforms/contextualeducationsiteagreementform/ |
| CE Mid-Year Evaluation Form |
122771 |
/ips/resources/contextualeducation/ceforms/cemid-yearevaluationform/ |
| CE End-of Year Evaluation Form |
122772 |
/ips/resources/contextualeducation/ceforms/ceend-ofyearevaluationform/ |
| Possible CE Sites |
54839 |
/ips/resources/contextualeducation/possiblecesites/ |
| Courses |
83331 |
/ips/resources/courses/ |
| Schedule of Required Courses |
82514 |
/ips/resources/courses/course-rotation-schedule/ |
| IPS Syllabus Project |
68868 |
/ips/resources/courses/ipssyllabusproject/ |
| Other Resources |
83671 |
/ips/resources/otherresources/ |
| Grad Student Life |
76084 |
/ips/resources/otherresources/gradstudentlife/ |
| Writing Center |
71629 |
/ips/resources/otherresources/writingcenter/ |
| Libraries Distance Education |
66260 |
/ips/resources/otherresources/librariesdistanceeducation/ |
| Libraries |
66610 |
/ips/resources/otherresources/libraries/ |
| Useful Links for New Students |
64330 |
/ips/resources/otherresources/usefullinksfornewstudents/ |
| Transfer Credit & Advanced Standing |
37630 |
/ips/admission/advancedstandingtransfercredit/ |
| Forms |
16343 |
/ips/resources/otherresources/forms/ |
| Graduation Application |
33694 |
/ips/resources/otherresources/forms/graduationapplication/ |
| section_info |
33695 |
/ips/resources/otherresources/forms/graduationapplication/sectioninfo/ |
| Support for Student Travel and Conference Expenses |
33699 |
/ips/resources/otherresources/forms/supportforstudenttravelandconferenceexpenses/ |
| section_info |
33700 |
/ips/resources/otherresources/forms/supportforstudenttravelandconferenceexpenses/sectioninfo/ |
| Graduate Student Worker Application |
33701 |
/ips/resources/otherresources/forms/graduatestudentworkerapplication/ |
| section_info |
33702 |
/ips/resources/otherresources/forms/graduatestudentworkerapplication/sectioninfo/ |
| Integration Project Proposal Guidelines |
33714 |
/ips/resources/otherresources/forms/integrationprojectproposalguidelines/ |
| section_info |
33715 |
/ips/resources/otherresources/forms/integrationprojectproposalguidelines/sectioninfo/ |
| Inter-Program Course Enrollment |
33717 |
/ips/resources/otherresources/forms/inter-programcourseenrollment/ |
| section_info |
33718 |
/ips/resources/otherresources/forms/inter-programcourseenrollment/sectioninfo/ |
| Leave of Absence |
33719 |
/ips/resources/otherresources/forms/leaveofabsence/ |
| section_info |
33720 |
/ips/resources/otherresources/forms/leaveofabsence/sectioninfo/ |
| Reinstatement Request Form |
84966 |
/ips/resources/otherresources/forms/reinstatementrequestform/ |
| Change of Program |
66067 |
/ips/resources/otherresources/forms/changeofprogram/ |
| Advanced Standing |
66259 |
/ips/resources/otherresources/forms/advancedstanding/ |
| Transfer Credit |
68264 |
/ips/resources/otherresources/forms/transfercredit/ |
| Application for Course Substitution |
88536 |
/ips/resources/otherresources/forms/applicationforcoursesubstitution/ |
| IPS Research and Writing site |
89005 |
/ips/resources/otherresources/ipsresearchandwritingsite/ |
| New Student Orientation |
89471 |
/ips/resources/otherresources/newstudentorientation/ |
| Resourceful Links |
92617 |
/ips/resources/resourcefullinks/ |
| Study in Rome |
69776 |
/ips/resources/studyabroad/ |
| right_column |
69777 |
/ips/resources/studyabroad/rightcolumn/ |
| Frequently Asked Questions |
69780 |
/ips/resources/studyabroad/frequentlyaskedquestions/ |
| Course Descriptions |
70800 |
/ips/resources/studyabroad/coursedescriptions/ |
| Itinerary |
70699 |
/ips/resources/studyabroad/itinerary/ |
| Academic Policies Archives |
104285 |
/ips/resources/academicpoliciesarchives/ |
| New Student Hub |
103820 |
/ips/resources/newstudenthub/ |
| International Student Hub |
107441 |
/ips/resources/internationalstudenthub/ |
| Current Student Hub |
103821 |
/ips/resources/currentstudenthub/ |
| Online Learning Hub |
103822 |
/ips/resources/onlinelearninghub/ |
| Spiritual Formation |
106008 |
/ips/resources/spiritualformation/ |
| SPIRITUAL FORMATION EVENTS |
107404 |
/ips/resources/spiritualformation/spiritualformationevents/ |
| Curriculum Planning Worksheets |
187945 |
/ips/resources/curriculumplanningworksheets/ |
| Job Openings |
190366 |
/ips/resources/openings/ |
| Prayer Requests |
204393 |
/ips/resources/prayerrequests/ |
| Documents |
99715 |
/ips/documents/ |
| CCSS English & Español - Registration |
104456 |
/ips/ccssenglishespaol-registration/ |
| CCSS English & Español |
104460 |
/ips/ccssenglishespaol/ |
| CENTERS: Synodality |
206190 |
/ips/centerssynodality/ |
| Institutional Review Board |
181380 |
/irb/ |
| site_logo |
181397 |
/irb/sitelogo/ |
| Footer |
181398 |
/irb/footer/ |
| cta |
181399 |
/irb/cta/ |
| social media |
181400 |
/irb/socialmedia/ |
| AudienceNav |
206548 |
/irb/audiencenav/ |
| About |
181393 |
/irb/about/ |
| Commitment |
181401 |
/irb/about/commitment/ |
| Membership |
181402 |
/irb/about/membership/ |
| Schedule |
181403 |
/irb/about/schedule/ |
| Contact Us |
181404 |
/irb/about/contactus/ |
| Getting Started |
181394 |
/irb/gettingstarted/ |
| Is IRB review required? |
181405 |
/irb/gettingstarted/isirbreviewrequired/ |
| Types of Review |
181406 |
/irb/gettingstarted/typesofreview/ |
| Before applying |
181407 |
/irb/gettingstarted/beforeapplying/ |
| The Project Page |
181408 |
/irb/gettingstarted/theprojectpage/ |
| CITI Course |
181409 |
/irb/gettingstarted/citicourse/ |
| Applying |
181395 |
/irb/applying/ |
| Application Sections |
181411 |
/irb/applying/applicationsections/ |
| Risks and Benefits |
181412 |
/irb/applying/risksandbenefits/ |
| Recruitment and Participants |
181413 |
/irb/applying/recruitmentandparticipants/ |
| Informed Consent |
181414 |
/irb/applying/informedconsent/ |
| Privacy and Confidentiality |
181415 |
/irb/applying/privacyandconfidentiality/ |
| Submission and Review |
181416 |
/irb/applying/submissionandreview/ |
| Templates |
181417 |
/irb/applying/templates/ |
| Post-Approval |
181396 |
/irb/post-approval/ |
| Amendments |
181419 |
/irb/post-approval/amendments/ |
| Continuing Review |
181420 |
/irb/post-approval/continuingreview/ |
| Unanticipated Problems |
181421 |
/irb/post-approval/unanticipatedproblems/ |
| Closure |
181422 |
/irb/post-approval/closure/ |
| Interfolio Faculty180 |
178482 |
/f180/ |
| site_logo |
178483 |
/f180/sitelogo/ |
| Footer |
178484 |
/f180/footer/ |
| Training Videos - Administrators |
178614 |
/f180/trainingvideos-administrators/ |
| Training Videos - Faculty |
178650 |
/f180/trainingvideos-faculty/ |
| International Student and Scholar Services |
26885 |
/isss/index.shtml |
| site_logo |
27316 |
/isss/sitelogo/ |
| Footer |
27315 |
/isss/footer/ |
| About Us |
65204 |
/isss/aboutus/ |
| Meet Our Team |
65206 |
/isss/aboutus/meetourteam/ |
| Profiles |
199737 |
/isss/aboutus/meetourteam/profiles/ |
| Appointments & Contact Info |
65207 |
/isss/aboutus/contactus |
| right_column |
207149 |
/isss/archive/testcontactus/rightcolumn/ |
| F-1 & J-1 Students |
115099 |
/isss/f-1j-1students/ |
| Prospective Students |
26895 |
/isss/prospective.shtml |
| New Student Orientation |
115409 |
/isss/f-1j-1students/newstudentorientation/ |
| Current F-1 Students |
27306 |
/isss/currentinternationalstudents.shtml |
| J-1 Exchange Students |
120517 |
/isss/f-1j-1students/j-1exchangestudents/ |
| Nomination and Application Procedure |
109112 |
/isss/f-1j-1students/j-1exchangestudents/nominationandapplicationprocedure/ |
| Tuition and Fees |
109113 |
/isss/f-1j-1students/j-1exchangestudents/tuitionandfees/ |
| J-1 Visa Process |
109114 |
/isss/f-1j-1students/j-1exchangestudents/j-1visaprocess/ |
| Academics |
109115 |
/isss/f-1j-1students/j-1exchangestudents/academics/ |
| Housing, Dining, and Transportation |
109116 |
/isss/f-1j-1students/j-1exchangestudents/housingdiningandtransportation/ |
| Student Life |
109117 |
/isss/f-1j-1students/j-1exchangestudents/studentlife/ |
| Maintaining J-1 Status |
123000 |
/isss/f-1j-1students/j-1exchangestudents/maintainingj-1status/ |
| Student Employment |
123009 |
/isss/f-1j-1students/studentemployment/ |
| International Faculty & Staff |
26874 |
/isss/facultystaff.shtml |
| H-1B Employees |
26872 |
/isss/H-1B.shtml |
| J-1 Intern |
26875 |
/isss/j1_exchange.shtml |
| J-1 Exchange Visitor |
26877 |
/isss/faculty.shtml |
| Permanent Residency |
123010 |
/isss/permanentresidency/ |
| Required Department of Labor Notifications |
183518 |
/isss/requireddepartmentoflabornotifications/ |
| ISSS Portal |
26902 |
/isss/forms.shtml |
| Immigration and Travel Resources |
202235 |
/isss/immigrationandtravelresources/ |
| Immigration Policy Updates & Resources |
207048 |
/isss/immigrationandtravelresources/immigrationpolicyupdatesresources/ |
| International Travel |
207049 |
/isss/immigrationandtravelresources/internationaltravel/ |
| Resources |
26907 |
/isss/resources.shtml |
| ESL |
26901 |
/isss/esl.html |
| International Student Handbook |
26904 |
/isss/International_Studen1.html |
| Walk-In Hours |
26909 |
/isss/walk_in_hours.shtml |
| Stipends for Visitors |
26914 |
/isss/stipends.shtml |
| TN - Canadian or Mexican |
26915 |
/isss/tn_visa.shtml |
| H-1B temporary worker status for staff |
26882 |
/isss/H-1B_Temporary_Worke.shtml |
| International Employee |
26884 |
/isss/information_staff_faculty.shtml |
| E-3 Australian |
26912 |
/isss/e-3_aust.shtml |
| cta |
207120 |
/isss/cta/ |
| Digital Badging |
190436 |
/digitalbadging/ |
| About Digital Badging |
189851 |
/digitalbadging/aboutdigitalbadging/ |
| Terminology & Definitions |
191951 |
/digitalbadging/aboutdigitalbadging/terminologydefinitions/ |
| Governance |
190792 |
/digitalbadging/governance/ |
| Purpose & Overview |
190852 |
/digitalbadging/governance/purposeoverview/ |
| Goals & Success Metrics |
190853 |
/digitalbadging/governance/goalssuccessmetrics/ |
| Program Structure & Taxonomy |
190855 |
/digitalbadging/governance/programstructuretaxonomy/ |
| Badge Earning Criteria & Assessment Strategies |
190856 |
/digitalbadging/governance/badgeearningcriteriaassessmentstrategies/ |
| Digital Badging Review Committee |
191938 |
/digitalbadging/governance/digitalbadgingreviewcommittee/ |
| Badge Proposal & Approval Process |
190857 |
/digitalbadging/governance/badgeproposalapprovalprocess/ |
| Issuing Authority & Revisions |
191939 |
/digitalbadging/governance/issuingauthorityrevisions/ |
| Proposal Process |
189863 |
/digitalbadging/proposalprocess/ |
| Preparing Your Proposal |
191820 |
/digitalbadging/proposalprocess/preparingyourproposal/ |
| Submit Your Badge Proposal (Form) |
192343 |
https://forms.office.com/pages/responsepage.aspx?id=408fApwrJEiDeLvPnsWsy6139HwYJKNHosaJZQWQOpZUQ0szRkdMNVhaMlhXTTlDV01WTU1OWDg2NiQlQCN0PWcu |
| Next Steps |
191822 |
/digitalbadging/proposalprocess/nextsteps/ |
| Earn Badges |
189864 |
/digitalbadging/earnbadges/ |
| Earn Badges on Credly |
191824 |
https://www.credly.com/organizations/luc/badges |
| Featured Badges |
191825 |
/digitalbadging/earnbadges/featuredbadges/ |
| right_column |
198483 |
/digitalbadging/earnbadges/rightcolumn/ |
| site_logo |
190437 |
/digitalbadging/sitelogo/ |
| January Term |
4006 |
/januaryterm/index.shtml |
| site_logo |
4030 |
/januaryterm/sitelogo/ |
| Footer |
4031 |
/januaryterm/footer/ |
| social media |
201946 |
/januaryterm/socialmedia/ |
| cta |
201947 |
/januaryterm/cta/ |
| Courses and Registration |
4017 |
/januaryterm/coursesandregistration/ |
| January Term Courses |
180127 |
/januaryterm/coursesandregistration/januarytermcourselisting/ |
| University Core Courses |
188774 |
/januaryterm/coursesandregistration/j-termuniversitycoreofferings/ |
| LOCUS |
4135 |
https://www.luc.edu/locus |
| Study Abroad |
180206 |
/januaryterm/coursesandregistration/studyabroad/ |
| Registration |
4014 |
/januaryterm/coursesandregistration/registration/ |
| Loyola Students |
62232 |
/januaryterm/coursesandregistration/registration/loyolastudents/ |
| Visiting Students |
62231 |
/januaryterm/coursesandregistration/registration/visitingstudents/ |
| J-Term University Core Offerings |
188771 |
/januaryterm/coursesandregistration/j-termuniversitycoreofferings/ |
| January Term Course Listing |
180128 |
/januaryterm/coursesandregistration/januarytermcourselisting/ |
| Cost & Financial Aid |
4010 |
/januaryterm/costandfinancialaid/ |
| Tuition and Fees |
62027 |
/januaryterm/costandfinancialaid/tuitionandfees/ |
| Financial Aid |
180145 |
/januaryterm/costandfinancialaid/financialaid/ |
| Services |
4076 |
/januaryterm/services/ |
| Academic Policies |
180252 |
/januaryterm/academicpolicies/ |
| Student Services |
201957 |
/januaryterm/services/ |
| FAQs |
71423 |
/januaryterm/faqs/ |
| Contact Us |
5856 |
/januaryterm/contactus/ |
| Academic Policies |
71461 |
/januaryterm/academicpolicies/ |
| Campus Information |
61912 |
/januaryterm/campusinformation/ |
| Lake Shore Campus |
61914 |
/januaryterm/campusinformation/lakeshorecampus/ |
| Online Learning |
61917 |
/januaryterm/campusinformation/onlinelearning/ |
| Staying Warm and Safe |
69861 |
/januaryterm/campusinformation/stayingwarmandsafe/ |
| E-blast Images |
62173 |
/januaryterm/images/index.shtml |
| Jesuit First Studies Program |
193935 |
/jesuitfirststudies/ |
| About |
193937 |
/jesuitfirststudies/about/ |
| Academics |
193938 |
/jesuitfirststudies/academics/ |
| Community Life |
193939 |
/jesuitfirststudies/communitylife/ |
| Ministry |
193940 |
/jesuitfirststudies/ministry/ |
| Spiritual Life |
196431 |
/jesuitfirststudies/spirituallife/ |
| Summer Experiences |
193941 |
/jesuitfirststudies/summerexperiences/ |
| site_logo |
193964 |
/jesuitfirststudies/sitelogo/ |
| footer |
193965 |
/jesuitfirststudies/footer/ |
| social media |
193966 |
/jesuitfirststudies/socialmedia/ |
| Jesuit Heritage |
203346 |
/jesuitheritage/ |
| site_logo |
203497 |
/jesuitheritage-dev/sitelogo/ |
| Map of locations |
203386 |
/jesuitheritage/mapoflocations/ |
| St. Ignatius of Loyola |
203671 |
/jesuitheritage-dev/stignatiusofloyola/ |
| The Wolves of Loyola |
203350 |
/jesuitheritage-dev/thewolvesofloyola/ |
| Armillary Sphere |
203672 |
/jesuitheritage-dev/armillarysphere/ |
| Sacred Heart of Jesus Shrine |
203673 |
/jesuitheritage-dev/sacredheartofjesusshrine/ |
| Fr. Arnold J. Damen, S.J. |
203674 |
/jesuitheritage-dev/frarnoldjdamensj/ |
| Dumbach Hall |
203675 |
/jesuitheritage-dev/dumbachhall/ |
| Michael Cudahy Science Hall |
203676 |
/jesuitheritage-dev/michaelcudahysciencehall/ |
| Elizabeth M. Cudahy Library |
203677 |
/jesuitheritage-dev/elizabethmcudahylibrary/ |
| Mundelein Center for Fine and Performing Arts |
203678 |
/jesuitheritage-dev/mundeleincenterforfineandperformingarts/ |
| Madonna della Strada Chapel |
203679 |
/jesuitheritage-dev/madonnadellastradachapel/ |
| Mertz Hall |
203680 |
/jesuitheritage-dev/mertzhall/ |
| Edward A. Crown Center for the Humanities |
203681 |
/jesuitheritage-dev/edwardacrowncenterforthehumanities/ |
| Memorial to the Salvadoran Martyrs |
203682 |
/jesuitheritage-dev/memorialtothesalvadoranmartyrs/ |
| Ignatius House Jesuit Community |
203683 |
/jesuitheritage-dev/ignatiushousejesuitcommunity/ |
| Francis Hall |
203684 |
/jesuitheritage-dev/francishall/ |
| School of Environmental Sustainability |
203685 |
/jesuitheritage-dev/schoolofenvironmentalsustainability/ |
| Jesuit Education Map |
204224 |
/jesuitheritage/jesuiteducationmap/ |
| Jesuit Heritage Research Center |
204333 |
/cas/jesuitheritage/ |
| John & Kathy Schreiber Historic Gift |
177351 |
/schreibergift/index2.shtml |
| site_logo |
177782 |
/schreibergift/sitelogo/ |
| Announcement |
176960 |
/schreibergift/index.shtml |
| Student Profiles |
177135 |
/schreibergift/studentprofiles.shtml |
| John Felice Rome Center |
163626 |
/rome/ |
| site_logo |
163627 |
/rome/sitelogo/ |
| Footer |
163628 |
/rome/footer/ |
| I Links |
163629 |
/rome/ilinks/ |
| social media |
163631 |
/rome/socialmedia/ |
| modules-programming |
168499 |
/rome/modules-programming/ |
| About |
163639 |
/rome/about/ |
| Rome |
163647 |
/rome/about/rome/ |
| Campus |
163648 |
/rome/about/campus/ |
| Faculty & Staff |
168619 |
/rome/about/facultystaff/ |
| Faculty |
168620 |
/rome/about/facultystaff/faculty/ |
| Staff |
168623 |
/rome/about/facultystaff/staff/ |
| Alumni |
163649 |
/rome/about/alumni/ |
| right_column |
168624 |
/rome/about/alumni/rightcolumn/ |
| Get Involved |
203094 |
/rome/about/alumni/getinvolved/ |
| Spirit of Felice Award Winners |
203096 |
/rome/about/alumni/spiritoffeliceawardwinners/ |
| Janet Myers (BS '93, JFRC '89-'90) |
203146 |
/rome/about/alumni/spiritoffeliceawardwinners/janetmyersbs93jfrc89-90/ |
| Jack O’Connell (JFRC ’68–’69) |
203147 |
/rome/about/alumni/spiritoffeliceawardwinners/jackoconnelljfrc6869/ |
| Anthony F. Piazza (JFRC ’62–'63) |
203148 |
/rome/about/alumni/spiritoffeliceawardwinners/anthonyfpiazzajfrc6263/ |
| Gemma Cassaretto Allen-Nader (JFRC ’64-65, BS ’66) |
203149 |
/rome/about/alumni/spiritoffeliceawardwinners/gemmacassarettoallen-naderjfrc64-65bs66/ |
| James L. Centner Jr. (JFRC ’66–’67) |
203150 |
/rome/about/alumni/spiritoffeliceawardwinners/jameslcentnerjrjfrc6667/ |
| John J. Kurowski (JFRC ‘73–’74, BA ‘75) |
203151 |
/rome/about/alumni/spiritoffeliceawardwinners/johnjkurowskijfrc7374ba75/ |
| John J. Kurowski (JFRC ‘73–’74, BA ‘75) |
203151 |
/rome/about/alumni/spiritoffeliceawardwinners/johnjkurowskijfrc7374ba75/ |
| Katie Vogelheim (JFRC ’77–’78) |
203152 |
/rome/about/alumni/spiritoffeliceawardwinners/katievogelheimjfrc7778/ |
| Leonard P. Slotkowski Jr. (JFRC ’65–‘66, BA ’69, MEd ’72) |
203153 |
/rome/about/alumni/spiritoffeliceawardwinners/leonardpslotkowskijrjfrc6566ba69med72/ |
| Philip R. O’Connor, PhD (JFRC ’68–’69, BA ’70) |
203154 |
/rome/about/alumni/spiritoffeliceawardwinners/philiproconnorphdjfrc6869ba70/ |
| Robert (JFRC ‘66) and Maureen (JFRC ‘66-’67, BA ‘68) Schuberth |
203155 |
/rome/about/alumni/spiritoffeliceawardwinners/robertjfrc66andmaureenjfrc66-67ba68schuberth/ |
| Giancarlo Turano (BBA ‘75, JFRC ‘71-’72) |
205517 |
/rome/about/alumni/spiritoffeliceawardwinners/giancarloturanobba75jfrc71-72/ |
| FAQs |
163651 |
/rome/about/faqs/ |
| The JFRC Tradition |
168521 |
/rome/about/thejfrctradition/ |
| News & Events |
168626 |
/rome/about/newsevents/ |
| archive |
168629 |
/rome/about/newsevents/archive/ |
| Contact & Connect |
168627 |
/rome/about/contactconnect/ |
| Stories template |
182187 |
/rome/about/storiestemplate/ |
| I am a son of Poland |
182188 |
/rome/about/stories/iamasonofpoland/ |
| Meet our Italian instructors |
182233 |
/rome/about/storiestemplate/meetouritalianinstructors/ |
| Nives Valli |
190421 |
/rome/about/stories/nivesvalli/ |
| Sarantuya |
191574 |
/rome/about/stories/sarantuya/ |
| Stories |
185646 |
/rome/about/stories/ |
| Our 60-year anniversary at the John Felice Rome Center |
185647 |
/rome/about/stories/jfrcanniversary/ |
| Admission |
163640 |
/rome/admission/ |
| Rome Center Admission |
181705 |
/rome/admission/romecenteradmission/ |
| Loyola Students |
163653 |
/rome/admission/loyolastudents/ |
| Visiting Students |
163654 |
/rome/admission/visitingstudents/ |
| Tuition & Financial Aid |
163655 |
/rome/admission/tuitionfinancialaid/ |
| Scholarships |
163656 |
/rome/admission/scholarships/ |
| Transcript Request |
163657 |
/rome/admission/transcriptrequest/ |
| Academics |
163641 |
/rome/academics/ |
| Course Offerings |
163658 |
/rome/academics/courseofferings/ |
| Fall 2026 |
168725 |
/rome/academics/courseofferings/fall2026/ |
| Spring 2026 |
168723 |
/rome/academics/courseofferings/spring2026/ |
| Summer 2026 |
168724 |
/rome/academics/courseofferings/summer2026/ |
| First-Year Experience |
163660 |
/rome/academics/first-yearexperience/ |
| Engaged Learning |
163661 |
/rome/academics/engagedlearning/ |
| Service Learning |
168717 |
/rome/academics/engagedlearning/servicelearning/ |
| Internships |
189443 |
/rome/academics/engagedlearning/internships/ |
| Academic Support & Advising |
163662 |
/rome/academics/academicsupportadvising/ |
| Academic Calendar |
163663 |
/rome/academics/academiccalendar/ |
| Academic Policies |
163664 |
/rome/academics/academicpolicies/ |
| Summer Session |
181985 |
/rome/academics/summersession/ |
| Fusion Programs |
183475 |
/rome/academics/summersession/fusionprograms/ |
| Library |
182734 |
/rome/academics/library/ |
| Study Trips |
188523 |
/rome/academics/studytrips/ |
| Amalfi |
206129 |
/rome/academics/studytrips/amalfi/ |
| Graduate Programs |
207165 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/prolaw-in-rome/ |
| Campus Life |
163642 |
/rome/campuslife/ |
| Study Abroad Experience |
163634 |
/rome/campuslife/studyabroadexperience/ |
| Student Life Team |
163666 |
/rome/campuslife/studentlifeteam/ |
| Residence Life |
163667 |
/rome/campuslife/residencelife/ |
| Study Trips |
163668 |
/rome/campuslife/studytrips/ |
| Sustainability |
163669 |
/rome/campuslife/sustainability/ |
| Health & Wellness |
163670 |
/rome/campuslife/healthwellness/ |
| Campus Ministry |
163671 |
/rome/campuslife/campusministry/ |
| Homepage Sample |
180730 |
/rome/homepagesample/ |
| Land Acknowledgement Statement |
189646 |
/las/ |
| site_logo |
189647 |
/las/sitelogo/ |
| AudienceNav |
206596 |
/las/audiencenav/ |
| Language Learning Resource Center |
43692 |
/llrc/index.shtml |
| site_logo |
43763 |
/llrc/sitelogo/ |
| Footer |
43762 |
/llrc/footer/ |
| cta |
202993 |
/llrc/cta/ |
| social media |
202995 |
/llrc/socialmedia/ |
| About Us |
43693 |
/llrc/about.shtml |
| archive |
202952 |
/llrc/archive/ |
| Contact Us |
43695 |
/llrc/contactus.shtml |
| Orientation Video |
43696 |
/llrc/orientation_videos.shtml |
| Our Staff |
43698 |
/llrc/staff.shtml |
| Photo Gallery |
43699 |
/llrc/photo_gallery.shtml |
| Friendsgiving |
126805 |
/llrc/friendsgiving/ |
| 30th Anniversary of the Fall of the Berlin Wall |
126477 |
/llrc/30thanniversaryofthefalloftheberlinwall/ |
| National Costume Competition |
126340 |
/llrc/nationalcostumecompetition/ |
| International Karaoke Night |
126112 |
/llrc/karaokenightphotos |
| Polish St Andrew's Night Celebration |
126825 |
/llrc/polishstandrewsnightcelebration/ |
| Faculty/Student Reception Fall 2019 |
125976 |
/llrc/facultystudentreceptionfall2019/ |
| International Scrabble Night |
125765 |
/llrc/internationalscrabblenight/ |
| Faculty/Student Reception Spring 2019 |
121000 |
/llrc/facultystudentreceptionspring2019/ |
| MDLG Reunion 2010 |
57080 |
/llrc/photos/flickr_reunion_2010.shtml |
| Over the Years 1989-2010 |
57078 |
/llrc/photos/flickr_years.shtml |
| The Jewish New Year of Trees |
128215 |
/llrc/thejewishnewyearoftrees/ |
| Newly Renovated LLRC |
57079 |
/llrc/photos/flickr_renovated.shtml |
| Chinese Language Contest Photo Gallery 2022 |
177126 |
/llrc/chineselanguagecontestphotogallery2022/ |
| Dia De Los Muertos 2022 |
181624 |
/llrc/diadelosmuertos2022/ |
| Foreign Language Graphic Novel Contest 2022 Image Gallery |
176986 |
/llrc/foreignlanguagegraphicnovelcontest2022imagegallery/ |
| Functional Linguistic Analysis of the Quran Event 2022 |
168760 |
/llrc/functionallinguisticanalysisofthequranevent2022/ |
| Mid-Autumn Festival/ Mooncake Festival |
163873 |
/llrc/mid-autumnfestivalmooncakefestival/ |
| Polish St Andrew's Night Celebration (2021) |
167188 |
/llrc/polishstandrewsnightcelebration2021/ |
| Ramadan Talk |
201914 |
/llrc/ramadantalk/ |
| Turkish Concert in the LLRC |
180967 |
/llrc/turkishconcertinthellrc/ |
| Faculty/Student Reception |
121059 |
/llrc/facultystudentreception/ |
| International Karaoke Night |
126143 |
/llrc/internationalkaraokenight/ |
| International Karaoke 2020 |
127900 |
/llrc/internationalkaraoke2020/ |
| Functional Linguistic Analysis of the Quran Event Video Gallery |
168778 |
/llrc/functionallinguisticanalysisofthequraneventvideogallery/ |
| International Halloween Karaoke Night 2023 |
189767 |
/llrc/internationalhalloweenkaraokenight2023/ |
| Language Coaches |
121742 |
/llrc/llrcstaff.shtml |
| News & Events |
121135 |
/llrc/newsevents/ |
| Día de los Muertos |
154325 |
/llrc/newsevents/diadelosmuertos/ |
| International Karaoke Night |
154722 |
/llrc/newsevents/internationalkaraokenight/ |
| Chinese Culture Day |
205006 |
/llrc/newsevents/chinesecultureday/ |
| Columbus Day Series |
155274 |
/llrc/columbusdayseries/ |
| The History of Columbus Day |
155283 |
/llrc/columbusdayseries/thehistoryofcolumbusday/ |
| Christopher Columbus -- The Historical Figure |
155289 |
/llrc/columbusdayseries/christophercolumbus--thehistoricalfigure/ |
| Christopher Columbus Today |
155291 |
/llrc/columbusdayseries/christophercolumbustoday/ |
| Beyond Columbus: Christopher Columbus and Italian American Identity |
155301 |
/llrc/columbusdayseries/beyondcolumbuschristophercolumbusanditalianamericanidentity/ |
| LLRC Resources |
43707 |
/llrc/resources.shtml |
| A Taste of Hebrew Audio Files |
43708 |
/llrc/thaud.shtml |
| Bravo 5th Ed. Video Files |
43709 |
/llrc/b5vid.shtml |
| Conexiones 3rd Ed. Audio Files |
43710 |
/llrc/c3aud.shtml |
| Conexiones 3rd Ed. Video Files |
43711 |
/llrc/c3vid.shtml |
| conexiones 4th ed. audio files |
43712 |
/llrc/c4aud.shtml |
| Contacts 7th Ed. Audio Files |
43713 |
/llrc/c7aud.shtml |
| Deutsch: Na Klar! 5th Ed. Audio Files |
43714 |
/llrc/nk5aud.shtml |
| Deutsch: Na Klar! 5th Ed. Video Files |
43715 |
/llrc/nk5vid.shtml |
| Film & Video Catalog |
99256 |
http://lucweb.luc.edu/llrc/ |
| Genki I: An Integrated Course in Elementary Japanese, 1st Ed. Audio Files |
43719 |
/llrc/g1aud.shtml |
| Genki II: An Integrated Course in Elementary Japanese, 1st Ed. Audio Files |
43720 |
/llrc/g2aud.shtml |
| Handbuch zur deutschen Grammatik 4th Ed. Audio Files |
43721 |
/llrc/hg4aud.shtml |
| ¡Apúntate! 1st ED. audio files |
43722 |
/llrc/a1audio.shtml |
| ¡Apúntate! 1st ed./¿Qué tal? 7th Ed. Video Files |
43723 |
/llrc/q7vid.shtml |
| Integrated Chinese 3rd Edition Audio Files |
43724 |
/llrc/ic3aud.shtml |
| Interaction 6th Ed. Audio Files |
43725 |
/llrc/i6aud.shtml |
| Italian espresso 1 1st ed. audio files |
43726 |
/llrc/e1aud.shtml |
| italian espresso 2 1st ed. audio files |
43727 |
/llrc/e1audioPart2.shtml |
| Nuovo Espresso 1 |
70036 |
/llrc/nuovoespresso1/ |
| Kaleidoskop 7th Ed. Audio Files |
43728 |
/llrc/k7aud.shtml |
Kaleidoskop video files
|
43729 |
/llrc/kaleidoskopVHS.shtml |
| Nachalo 2nd Ed. Audio Files |
43730 |
/llrc/n2aud.shtml |
| Prego! 6th Ed. Audio Files |
43732 |
/llrc/p6aud.shtml |
| Prego! 6th Ed. Video Files |
43733 |
/llrc/p6vid.shtml |
| Prego! 7th ed. audio files |
43734 |
/llrc/p7aud.shtml |
| Prego! 7th Ed. Video Files |
43735 |
/llrc/p7vid.shtml |
| Print Resources |
43736 |
/llrc/print_resources.shtml |
| Satellite |
43737 |
/llrc/satellite.shtml |
| Software |
43738 |
/llrc/software.shtml |
| Elementary French Language Exercises (ELFE) |
45174 |
/llrc/ELFEmain.shtml |
| Present |
45184 |
/llrc/ELFE_Present.shtml |
| "Parler" 1st Conjugation |
106081 |
/llrc/parler1stconjugation/ |
| Passé Composé |
45185 |
/llrc/ELFE_PC.shtml |
| Imperfect |
45186 |
/llrc/ELFE_Imperfect.shtml |
| Future |
45187 |
/llrc/ELFE_Future.shtml |
| Conditional |
45188 |
/llrc/ELFE_Conditional.shtml |
| Perfect Tenses |
45189 |
/llrc/ELFE_PT.shtml |
| Simple Past |
45191 |
/llrc/ELFE_SP.shtml |
| Participles |
45192 |
/llrc/ELFE_Participles.shtml |
| Subjunctive |
45193 |
/llrc/ELFE_Subjunctive.shtml |
| Determiners |
45194 |
/llrc/ELFE_Determiners.shtml |
| Adjectives |
45195 |
/llrc/ELFE_Adjectives.shtml |
| Pronouns |
45196 |
/llrc/ELFE_Pronouns.shtml |
| Relative Pronouns |
45197 |
/llrc/ELFE_Relatives.shtml |
| Prepositions |
45198 |
/llrc/ELFE_Prepositions.shtml |
| Adverbs |
45199 |
/llrc/ELFE_Adverbs.shtml |
| Interrogatives |
45200 |
/llrc/ELFE_Interrogatives.shtml |
| Predication |
45201 |
/llrc/ELFE_Predication.shtml |
| Infinitives |
45202 |
/llrc/ELFE_Infinitives.shtml |
| Comparatives |
45203 |
/llrc/ELFE_Comparatives.shtml |
| Imperatives |
45204 |
/llrc/ELFE_Imperatives.shtml |
| Reflexives |
45205 |
/llrc/ELFE_Reflexives.shtml |
| Passives |
45206 |
/llrc/ELFE_Passives.shtml |
| Negatives |
45207 |
/llrc/ELFE_Negatives.shtml |
| Numbers |
45208 |
/llrc/ELFE_Numbers.shtml |
| Vis-à-vis 4th Ed. Video Files |
43739 |
/llrc/v4vid.shtml |
| Vis-à-vis 5th Ed. Audio Files |
43740 |
/llrc/v5audio.shtml |
| Yookoso! 2nd Edition Audio Files |
43741 |
/llrc/y2aud.shtml |
| Yookoso! 2nd Ed. Video Files |
43742 |
/llrc/y2vid.shtml |
| Yookoso! 3rd Edition Audio Files |
43743 |
/llrc/y3aud.shtml |
| Hurra!!! Po Polsku 1st Edition |
43755 |
/llrc/pp1aud.shtml |
| Bravo! 6th Edition recordings |
45173 |
/llrc/b6aud.shtml |
| Mosaicos 5th Edition - Text Audio |
59177 |
/llrc/mosaicos5thedition-textaudio/ |
| Mosaicos 5th Edition - Laboratory Audio |
59178 |
/llrc/mosaicos5thedition-laboratoryaudio/ |
| Mosaicos 5th Edition - Videos |
59624 |
/llrc/mosaicos5thedition-videos/ |
| Intrigue - Third Edition - Audio CDs |
61088 |
/llrc/intrigue-thirdedition-audiocds/ |
| Elementary Japanese - Volume One |
61093 |
/llrc/elementaryjapanese-volumeone/ |
| Tutoring Schedule |
70285 |
/llrc/tutoringschedule/ |
| Loyola Resources |
43744 |
/llrc/languageexaminfo.html |
| LUC Foreign Exams |
125716 |
https://www.luc.edu/media/lucedu/llrc/pdfs/LoyolaForeignLanguageExamsupdated2-rotated.pdf |
| Language Placement Exam |
45169 |
http://www.luc.edu/modernlang/exam.shtml |
| Modern Languages & Literatures Department |
45170 |
/modernlang/index.shtml |
| Tutoring |
74743 |
/llrc/tutoring/ |
| Online Resources |
43750 |
/llrc/iallt.html |
| Foreign Language Links |
43751 |
/llrc/links.shtml |
| IALLT |
43752 |
/llrc/iallt.html |
| Language Software |
43753 |
/llrc/instructional_software.shtml |
| Foreign Language Graphic Novel Contest |
157245 |
/llrc/foreignlanguagegraphicnovelcontest/ |
| Foreign Language Graphic Novel Contest 2022 |
176966 |
/llrc/foreignlanguagegraphicnovelcontest/foreignlanguagegraphicnovelcontest2022/ |
| Chinese Language Contest 2022 |
177370 |
/llrc/foreignlanguagegraphicnovelcontest/foreignlanguagegraphicnovelcontest2022/chineselanguagecontest2022/ |
| Alif baa Audio and video files |
43701 |
/llrc/alif_baa.shtml |
| al kitaab audio and video files |
43702 |
/llrc/alif_kitaab.shtml |
| allerlei zum lesen 2nd ed. audio files |
43703 |
/llrc/Allerleiaud1.shtml |
| Deutsch: Na Klar! 6th Ed. Audio Files |
43704 |
/llrc/nk6aud.shtml |
| espresso 2 audio files |
43705 |
/llrc/espresso2.shtml |
| Espresso 3 Digital audio files |
43706 |
/llrc/Espresso_3.shtml |
| Language Test |
106088 |
/llrc/langtest.shtml |
| Latin American and Latino Studies |
16695 |
/latinamericanstudies/index.shtml |
| Stories |
63605 |
/latinamericanstudies/stories/ |
| archive |
202149 |
/latinamericanstudies/stories/archive/ |
| About Us |
105145 |
/latinamericanstudies/aboutus/ |
| LASP's Mission Statement |
105146 |
/latinamericanstudies/aboutus/laspsmissionstatement/ |
| Requirements and Academics |
16696 |
/latinamericanstudies/academics.shtml |
| Requirements |
180054 |
/latinamericanstudies/requirements/ |
| Academic Outcomes |
108514 |
/latinamericanstudies/academicoutcomes/ |
| Double Dipping Policy |
126800 |
/latinamericanstudies/doubledippingpolicy/ |
| Faculty Directory |
16700 |
/latinamericanstudies/facultydirectory/ |
| Study Abroad |
16701 |
/latinamericanstudies/study_abroad.shtml |
| Contact Us |
16698 |
/latinamericanstudies/contact.shtml |
| Footer |
16734 |
/latinamericanstudies/footer/ |
| site_logo |
16733 |
/latinamericanstudies/site_logo/ |
| documents |
66578 |
/latinamericanstudies/documents/ |
| cta |
202122 |
/latinamericanstudies/cta/ |
| social media |
202125 |
/latinamericanstudies/socialmedia/ |
| School of Law |
192283 |
/law/ |
| site_logo |
192285 |
/law/sitelogo/ |
| Footer |
192286 |
/law/footer/ |
| cta |
192287 |
/law/cta/ |
| I Links |
192288 |
/law/ilinks/ |
| social media |
192289 |
/law/socialmedia/ |
| modules-programming |
192290 |
/law/modules-programming/ |
| AudienceNav |
206545 |
/law/audiencenav/ |
| About |
192300 |
/law/about/ |
| Mission |
192314 |
/law/about/mission/ |
| History |
192315 |
/law/about/history/ |
| Alumni |
192319 |
/law/alumni/ |
| Chicago |
192320 |
/law/about/chicago/ |
| Academic Freedom and Freedom of Expression Policy |
204148 |
/law/about/academicfreedomandfreedomofexpressionpolicy/ |
| Consumer Information (ABA Required Disclosures) |
192325 |
/law/about/abarequireddisclosures/ |
| Notice of non-discriminatory policy |
192468 |
/law/about/abarequireddisclosures/noticeofnon-discriminatorypolicy/ |
| Learning Outcomes and Competencies |
192469 |
/law/about/abarequireddisclosures/learningoutcomesandcompetencies/ |
| Diversity, Equity, and Inclusion |
207112 |
https://www.luc.edu/law/currentstudents/officeofdiversityequityandinclusion |
| Admission |
192301 |
/law/admission/ |
| Apply |
192326 |
/law/admission/apply/ |
| Juris Doctor (JD) |
192327 |
/law/admission/apply/jurisdoctorjd/ |
| Deadlines |
192328 |
/law/admission/apply/jurisdoctorjd/deadlines/ |
| Check Your Application Status |
192330 |
https://aso.lsac-unite.org/?guid=XIAzjZ3ndgg%3D |
| Financial Aid |
192331 |
/law/admission/tuition-financial-aid/jd-programs/types-of-aid/ |
| Transfers & Visitors |
192470 |
/law/admission/apply/jurisdoctorjd/transfersvisitors/ |
| FAQs |
192471 |
/law/admission/apply/jurisdoctorjd/faqs/ |
| Waitlist FAQ |
192473 |
/law/admission/apply/jurisdoctorjd/faqs/waitlistfaq/ |
| Master of Laws (LLM) |
192474 |
/law/admission/apply/masteroflawsllm/ |
| Check your application status |
192475 |
https://gpem.luc.edu/apply/ |
| Financial Aid |
192476 |
/law/admission/tuition-financial-aid/graduate-programs/ |
| Master of Jurisprudence (MJ) |
192477 |
/law/admission/apply/masterofjurisprudencemj/ |
| Check your application status |
192478 |
https://gpem.luc.edu/apply/ |
| Financial Aid |
192479 |
/law/admission/tuition-financial-aid/graduate-programs/ |
| Doctor of Juridical Science (SJD) |
192480 |
/law/admission/apply/doctorofjuridicalsciencesjd/ |
| Certificate Programs |
192484 |
/law/admission/apply/certificateprograms/ |
| Tuition & Financial Aid |
192339 |
/law/admission/tuition-financial-aid/ |
| JD Programs |
192485 |
/law/admission/tuition-financial-aid/jd-programs/ |
| Types of Aid & Resources |
192488 |
/law/admission/tuition-financial-aid/jd-programs/types-of-aid/ |
| Forms |
192487 |
/law/admission/tuition-financial-aid/jd-programs/forms/ |
| FAQs |
192486 |
/law/admission/tuition-financial-aid/jd-programs/faqs/ |
| Graduate Programs |
192515 |
/law/admission/tuition-financial-aid/graduate-programs/ |
| right_column |
194805 |
/law/admission/tuition-financial-aid/graduate-programs/rightcolumn/ |
| By The Numbers |
192340 |
/law/admission/bythenumbers/ |
| JD Admitted Students |
192516 |
/law/admission/jdadmittedstudents/ |
| Admitted Student FAQ |
192524 |
/law/admission/jdadmittedstudents/admittedstudentfaq/ |
| JD Welcome Programs |
192517 |
/law/admission/jdadmittedstudents/jdwelcomeprograms/ |
| Pay Your Deposit |
192518 |
/law/admission/jdadmittedstudents/payyourdeposit/ |
| Deadlines and Requirements |
192520 |
/law/admission/jdadmittedstudents/deadlinesandrequirements/ |
| Housing Information |
192521 |
/law/admission/jdadmittedstudents/housinginformation/ |
| Entering Student Resources |
192522 |
/law/admission/jdadmittedstudents/enteringstudentresources/ |
| Orientation |
195839 |
/law/admission/jdadmittedstudents/orientation/ |
| Academics |
192302 |
/law/academics/ |
| Degree Programs |
192525 |
/law/academics/degreeprograms/ |
| SJD in International and Comparative Law |
192567 |
/law/academics/degreeprograms/sjddegree/sjd-international-comparative-law/ |
| Juris Doctor |
192526 |
/law/academics/degreeprograms/jurisdoctor/ |
| Full-Time JD |
192527 |
/law/academics/degreeprograms/jurisdoctor/full-timejd/ |
| Weekend JD |
192529 |
/law/academics/degreeprograms/jurisdoctor/weekendjd/ |
| right_column |
192531 |
/law/academics/degreeprograms/jurisdoctor/rightcolumn/ |
| LLM Degrees |
192533 |
/law/academics/degreeprograms/llmdegrees/ |
| LLM in Compliance & Enterprise Risk Management |
192540 |
/law/academics/degreeprograms/llmdegrees/llmincomplianceenterpriseriskmanagement/ |
| right_column |
192541 |
/law/academics/degreeprograms/llmdegrees/llmincomplianceenterpriseriskmanagement/rightcolumn/ |
| LLM in Child and Family Law |
192538 |
/law/academics/degreeprograms/llmdegrees/llminchildandfamilylaw/ |
| right_column |
192539 |
/law/academics/degreeprograms/llmdegrees/llminchildandfamilylaw/rightcolumn/ |
| LLM in Health Law |
192548 |
/law/academics/degreeprograms/llmdegrees/llminhealthlaw/ |
| right_column |
192549 |
/law/academics/degreeprograms/llmdegrees/llminhealthlaw/rightcolumn/ |
| LLM for International Lawyers |
192536 |
/law/academics/degreeprograms/llmdegrees/llmforinternationallawyers/ |
| right_column |
192537 |
/law/academics/degreeprograms/llmdegrees/llmforinternationallawyers/rightcolumn/ |
| LLM in Rule of Law for Development (PROLAW) |
192534 |
/law/academics/degreeprograms/llmdegrees/llminruleoflawfordevelopmentprolaw/ |
| right_column |
192535 |
/law/academics/degreeprograms/llmdegrees/llminruleoflawfordevelopmentprolaw/rightcolumn/ |
| LLM in Tax Law |
192546 |
/law/academics/degreeprograms/llmdegrees/llmintaxlaw/ |
| right_column |
192547 |
/law/academics/degreeprograms/llmdegrees/llmintaxlaw/rightcolumn/ |
| MJ Degrees |
192550 |
/law/academics/degreeprograms/mjdegrees/ |
| MJ in Children’s Law and Policy |
192553 |
/law/academics/degreeprograms/mjdegrees/mjinchildrenslawandpolicy/ |
| right_column |
192554 |
/law/academics/degreeprograms/mjdegrees/mjinchildrenslawandpolicy/rightcolumn/ |
| MJ in Compliance and Enterprise Risk Management |
192555 |
/law/academics/degreeprograms/mjdegrees/mjincomplianceandenterpriseriskmanagement/ |
| right_column |
192556 |
/law/academics/degreeprograms/mjdegrees/mjincomplianceandenterpriseriskmanagement/rightcolumn/ |
| MJ in Health Law |
192557 |
/law/academics/degreeprograms/mjdegrees/mjinhealthlaw/ |
| right_column |
192558 |
/law/academics/degreeprograms/mjdegrees/mjinhealthlaw/rightcolumn/ |
| MJ in Rule of Law for Development (PROLAW) |
192551 |
/law/academics/degreeprograms/mjdegrees/mjinruleoflawfordevelopmentprolaw/ |
| right_column |
192552 |
/law/academics/degreeprograms/mjdegrees/mjinruleoflawfordevelopmentprolaw/rightcolumn/ |
| Dual Degrees |
192559 |
/law/academics/degreeprograms/dualdegrees/ |
| JD/MA with the Department of Political Science |
192565 |
/law/academics/degreeprograms/dualdegrees/jdmawiththedepartmentofpoliticalscience/ |
| JD/MBA with the Quinlan School of Business |
192564 |
/law/academics/degreeprograms/dualdegrees/jdmbawiththequinlanschoolofbusiness/ |
| JD/MPP with the Master of Public Policy Program |
192562 |
/law/academics/degreeprograms/dualdegrees/jdmppwiththemasterofpublicpolicyprogram/ |
| JD/MSW with the School of Social Work |
192560 |
/law/academics/degreeprograms/dualdegrees/jdmswwiththeschoolofsocialwork/ |
| MJ/MSW with the School of Social Work |
192561 |
/law/academics/degreeprograms/dualdegrees/mjmswwiththeschoolofsocialwork/ |
| right_column |
203295 |
/law/academics/degreeprograms/dualdegrees/mjmswwiththeschoolofsocialwork/rightcolumn/ |
| Areas of Study |
192569 |
/law/academics/areasofstudy/ |
| Specializations |
192570 |
/law/academics/areasofstudy/specializations/ |
| Advocacy |
192577 |
/law/academics/areasofstudy/specializations/advocacy/ |
| Child and Family Law |
192576 |
/law/academics/areasofstudy/specializations/childandfamilylaw/ |
| Competition and Consumer Protection Law |
192579 |
/law/academics/areasofstudy/specializations/competitionandconsumerprotectionlaw/ |
| Compliance Studies |
192575 |
/law/academics/areasofstudy/specializations/compliancestudies/ |
| Health Law |
192574 |
/law/academics/areasofstudy/specializations/healthlaw/ |
| International Law and Practice |
192573 |
/law/academics/areasofstudy/specializations/internationallawandpractice/ |
| Public Interest and Social Justice |
192572 |
/law/academics/areasofstudy/specializations/publicinterestandsocialjustice/ |
| Tax Law |
192571 |
/law/academics/areasofstudy/specializations/taxlaw/ |
| Transactional Law |
192580 |
/law/academics/areasofstudy/specializations/transactional-law/ |
| Online Non-JD Programs |
195763 |
/law/academics/online-graduate-legal-studies/ |
| Certificates |
192582 |
/law/academics/certificates/ |
| Certificate in Privacy Law |
192585 |
/law/academics/certificates/certificateinprivacylaw/ |
| Certificate in Conflict Management |
195751 |
/law/academics/certificates/certificateinconflictmanagement/ |
| Certificate in Cultural Competence, Inclusion, and the Law |
195758 |
/law/academics/certificates/certificateinculturalcompetenceinclusionandthelaw/ |
| Centers, Institutes, and Programs |
192586 |
/law/academics/centersinstitutesandprograms/ |
| Clinical Programs |
192893 |
/law/academics/clinical-programs/ |
| Community Law Center Clinic |
192895 |
/law/academics/clinical-programs/communitylawcenterclinic/ |
| right_column |
192896 |
/law/academics/clinical-programs/communitylawcenterclinic/rightcolumn/ |
| Veterans Practicum |
192897 |
/law/academics/clinical-programs/communitylawcenterclinic/veteranspracticum/ |
| right_column |
192898 |
/law/academics/clinical-programs/communitylawcenterclinic/veteranspracticum/rightcolumn/ |
| Legislation and Policy Clinic |
192899 |
/law/academics/clinical-programs/legislationandpolicyclinic/ |
| Civitas ChildLaw Clinic |
192900 |
/law/academics/clinical-programs/civitaschildlawclinic/ |
| Federal Tax Clinic |
192901 |
/law/academics/clinical-programs/federaltaxclinic/ |
| right_column |
192902 |
/law/academics/clinical-programs/federaltaxclinic/rightcolumn/ |
| Information for Students |
192905 |
/law/academics/clinical-programs/federaltaxclinic/information-for-students/ |
| Become a Client |
192906 |
/law/academics/clinical-programs/federaltaxclinic/become-a-client/ |
| Business Law Clinic |
192909 |
/law/academics/clinical-programs/businesslawclinic/ |
| Information for Students |
192913 |
/law/academics/clinical-programs/businesslawclinic/informationforstudents/ |
| Client Application |
192910 |
/law/academics/clinical-programs/businesslawclinic/clientapplication/ |
| Health Justice Project |
192915 |
/law/academics/clinical-programs/healthjusticeproject/ |
| About Us |
192916 |
/law/academics/clinical-programs/healthjusticeproject/aboutus/ |
| Student Opportunities |
192921 |
/law/academics/clinical-programs/healthjusticeproject/studentopportunities/ |
| Health Justice Fellowship Application (Loyola Law Students) |
192924 |
/law/academics/clinical-programs/healthjusticeproject/healthjusticefellowshipapplicationloyolalawstudents/ |
| HJP Report |
198213 |
https://www.luc.edu/media/lucedu/law/experiental/pdfs/hjp-report-2021-24.pdf |
| Experiential Learning |
192926 |
/law/academics/experiential-learning/ |
| Journals and Publications |
192929 |
/law/academics/journals-publications/ |
| Loyola Law Journal |
192930 |
/law/academics/journals-publications/loyolalawjournal/ |
| right_column |
192931 |
/law/academics/journals-publications/loyolalawjournal/rightcolumn/ |
| Annals of Health Law and Life Sciences |
193017 |
/law/academics/journals-publications/annalsofhealthlaw/ |
| Membership |
193018 |
/law/academics/journals-publications/annalsofhealthlaw/membership/ |
| Article Submission |
193019 |
/law/academics/journals-publications/annalsofhealthlaw/articlesubmission/ |
| Advance Directive |
193020 |
/law/academics/journals-publications/annalsofhealthlaw/advancedirective/ |
| right_column |
193021 |
/law/academics/journals-publications/annalsofhealthlaw/rightcolumn/ |
| Advance Directive - Archive |
193022 |
/law/academics/journals-publications/annalsofhealthlaw/advancedirective-archive/ |
| Volume 18, Issue 1 - Fall 2008 |
193033 |
/law/academics/journals-publications/annalsofhealthlaw/advancedirective-archive/volume18issue1-fall2008/ |
| Volume 18, Issue 2 - Spring 2009 |
193032 |
/law/academics/journals-publications/annalsofhealthlaw/advancedirective-archive/volume18issue2-spring2009/ |
| Volume 19, Issue 1 - Fall 2009 |
193031 |
/law/academics/journals-publications/annalsofhealthlaw/advancedirective-archive/volume19issue1-fall2009/ |
| Volume 19, Issue 2 - Spring 2010 |
193030 |
/law/academics/journals-publications/annalsofhealthlaw/advancedirective-archive/volume19issue2-spring2010/ |
| Volume 20, Issue 1 - Fall 2010 |
193029 |
/law/academics/journals-publications/annalsofhealthlaw/advancedirective-archive/volume20issue1-fall2010/ |
| Volume 20, Issue 2 - Spring 2011 |
193028 |
/law/academics/journals-publications/annalsofhealthlaw/advancedirective-archive/volume20issue2-spring2011/ |
| Volume 21, Issue 1 - Fall 2011 |
193027 |
/law/academics/journals-publications/annalsofhealthlaw/advancedirective-archive/volume21issue1-fall2011/ |
| Volume 21, Issue 2 - Spring 2012 |
193043 |
/law/academics/journals-publications/annalsofhealthlaw/advancedirective-archive/volume21issue2-spring2012/ |
| Volume 22, Issue 1 - Fall 2012 |
193039 |
/law/academics/journals-publications/annalsofhealthlaw/advancedirective-archive/volume22issue1-fall2012/ |
| Volume 22, Issue 2 - Spring 2013 |
193035 |
/law/academics/journals-publications/annalsofhealthlaw/advancedirective-archive/volume22issue2-spring2013/ |
| Advance Directive Previous Volumes |
193041 |
/law/academics/journals-publications/annalsofhealthlaw/advancedirective-archive/advancedirectivepreviousvolumes/ |
| Volume 23, Issue 1 – Fall 2013 |
193040 |
/law/academics/journals-publications/annalsofhealthlaw/advancedirective-archive/volume23issue1fall2013/ |
| Volume 23, Issue 2 – Spring 2014 |
193038 |
/law/academics/journals-publications/annalsofhealthlaw/advancedirective-archive/volume23issue2spring2014/ |
| Volume 24, Issue 1 - Fall 2014 |
193042 |
/law/academics/journals-publications/annalsofhealthlaw/advancedirective-archive/volume24issue1-fall2014/ |
| Volume 24, Issue 2 - Spring 2015 |
193037 |
/law/academics/journals-publications/annalsofhealthlaw/advancedirective-archive/volume24issue2-spring2015/ |
| Volume 25, Issue 1 – Fall 2015 |
193024 |
/law/academics/journals-publications/annalsofhealthlaw/advancedirective-archive/volume25issue1fall2015/ |
| Volume 25, Issue 2 – Spring 2016 |
193026 |
/law/academics/journals-publications/annalsofhealthlaw/advancedirective-archive/volume25issue2spring2016/ |
| Volume 26, Issue 1 – Fall 2016 |
193036 |
/law/academics/journals-publications/annalsofhealthlaw/advancedirective-archive/volume26issue1fall2016/ |
| Volume 26, Issue 2 – Fall 2017 |
193023 |
/law/academics/journals-publications/annalsofhealthlaw/advancedirective-archive/volume26issue2fall2017/ |
| Volume 27, Issue 1 – Fall 2017 |
193034 |
/law/academics/journals-publications/annalsofhealthlaw/advancedirective-archive/volume27issue1fall2017/ |
| Archive |
193044 |
/law/academics/journals-publications/annalsofhealthlaw/archive/ |
| Volume 1 (1992) |
193066 |
/law/academics/journals-publications/annalsofhealthlaw/archive/volume11992/ |
| Volume 2 (1993) |
193065 |
/law/academics/journals-publications/annalsofhealthlaw/archive/volume21993/ |
| Volume 3 (1994) |
193064 |
/law/academics/journals-publications/annalsofhealthlaw/archive/volume31994/ |
| Volume 4 (1995) |
193063 |
/law/academics/journals-publications/annalsofhealthlaw/archive/volume41995/ |
| Volume 5 (1996) |
193062 |
/law/academics/journals-publications/annalsofhealthlaw/archive/volume51996/ |
| Volume 6 (1997) |
193061 |
/law/academics/journals-publications/annalsofhealthlaw/archive/volume61997/ |
| Volume 7 (1998) |
193060 |
/law/academics/journals-publications/annalsofhealthlaw/archive/volume71998/ |
| Volume 8 (1999) |
193059 |
/law/academics/journals-publications/annalsofhealthlaw/archive/volume81999/ |
| Volume 9 (2000) |
193058 |
/law/academics/journals-publications/annalsofhealthlaw/archive/volume92000/ |
| Volume 10 (2001) |
193057 |
/law/academics/journals-publications/annalsofhealthlaw/archive/volume102001/ |
| Volume 11 (2002) |
193056 |
/law/academics/journals-publications/annalsofhealthlaw/archive/volume112002/ |
| Volume 12 (2002-2003) |
193055 |
/law/academics/journals-publications/annalsofhealthlaw/archive/volume122002-2003/ |
| Volume 13 (2003-2004) |
193054 |
/law/academics/journals-publications/annalsofhealthlaw/archive/volume132003-2004/ |
| Volume 14 (2004-2005) |
193053 |
/law/academics/journals-publications/annalsofhealthlaw/archive/volume142004-2005/ |
| Volume 15 (2005-2006) |
193052 |
/law/academics/journals-publications/annalsofhealthlaw/archive/volume152005-2006/ |
| Volume 16 (2006-2007) |
193051 |
/law/academics/journals-publications/annalsofhealthlaw/archive/volume162006-2007/ |
| Volume 17 (2007-2008) |
193050 |
/law/academics/journals-publications/annalsofhealthlaw/archive/volume172007-2008/ |
| Volume 18 (2008-2009) |
193049 |
/law/academics/journals-publications/annalsofhealthlaw/archive/volume182008-2009/ |
| Volume 19 (2009-2010) |
193048 |
/law/academics/journals-publications/annalsofhealthlaw/archive/volume192009-2010/ |
| Volume 20 (2010-2011) |
193047 |
/law/academics/journals-publications/annalsofhealthlaw/archive/volume202010-2011/ |
| Volume 21 (2011-2012) |
193068 |
/law/academics/journals-publications/annalsofhealthlaw/archive/volume212011-2012/ |
| Volume 22 (2013) |
193067 |
/law/academics/journals-publications/annalsofhealthlaw/archive/volume222013/ |
| Volume 23 (2014) |
193046 |
/law/academics/journals-publications/annalsofhealthlaw/archive/volume232014/ |
| Volume 24 (2015) |
193045 |
/law/academics/journals-publications/annalsofhealthlaw/archive/volume242015/ |
| Children's Legal Rights Journal |
193069 |
/law/academics/journals-publications/childrenslegalrightsjournal/ |
| Submission of Articles |
193070 |
/law/academics/journals-publications/childrenslegalrightsjournal/submissionofarticles/ |
| Call for Papers |
193071 |
/law/academics/journals-publications/childrenslegalrightsjournal/callforpapers/ |
| International Law Review |
193073 |
/law/academics/journals-publications/internationallawreview/ |
| Submitting Manuscripts |
193093 |
/law/academics/journals-publications/internationallawreview/submittingmanuscripts/ |
| Print Publications |
193074 |
/law/academics/journals-publications/internationallawreview/printpublications/ |
| Volume 1 Issue 1 |
193075 |
/law/academics/journals-publications/internationallawreview/printpublications/volume1issue1/ |
| Volume 1 Issue 2 |
193076 |
/law/academics/journals-publications/internationallawreview/printpublications/volume1issue2/ |
| Volume 2 Issue 1 |
193077 |
/law/academics/journals-publications/internationallawreview/printpublications/volume2issue1/ |
| Volume 2 Issue 2 |
193078 |
/law/academics/journals-publications/internationallawreview/printpublications/volume2issue2/ |
| Volume 3 Issue 1 |
193079 |
/law/academics/journals-publications/internationallawreview/printpublications/volume3issue1/ |
| Volume 3 Issue 2 |
193080 |
/law/academics/journals-publications/internationallawreview/printpublications/volume3issue2/ |
| Volume 4 Issue 1 |
193081 |
/law/academics/journals-publications/internationallawreview/printpublications/volume4issue1/ |
| Volume 4 Issue 2 |
193082 |
/law/academics/journals-publications/internationallawreview/printpublications/volume4issue2/ |
| Volume 5 Issue 1 |
193083 |
/law/academics/journals-publications/internationallawreview/printpublications/volume5issue1/ |
| Volume 5 Issue 2 |
193084 |
/law/academics/journals-publications/internationallawreview/printpublications/volume5issue2/ |
| Volume 6 Issue 1 |
193085 |
/law/academics/journals-publications/internationallawreview/printpublications/volume6issue1/ |
| Volume 6 Issue 2 |
193086 |
/law/academics/journals-publications/internationallawreview/printpublications/volume6issue2/ |
| Volume 7 Issue 1 |
193087 |
/law/academics/journals-publications/internationallawreview/printpublications/volume7issue1/ |
| Volume 7 Issue 2 |
193088 |
/law/academics/journals-publications/internationallawreview/printpublications/volume7issue2/ |
| Volume 8 Issue 1 |
193089 |
/law/academics/journals-publications/internationallawreview/printpublications/volume8issue1/ |
| Volume 8 Issue 2 |
193090 |
/law/academics/journals-publications/internationallawreview/printpublications/volume8issue2/ |
| Volume 9 Issue 1 |
193091 |
/law/academics/journals-publications/internationallawreview/printpublications/volume9issue1/ |
| Volume 9 Issue 2 |
193092 |
/law/academics/journals-publications/internationallawreview/printpublications/volume9issue2/ |
| Journal of Regulatory Compliance |
193094 |
/law/academics/journals-publications/journalofregulatorycompliance/ |
| Loyola Consumer Law Review |
193095 |
/law/academics/journals-publications/loyolaconsumerlawreview/ |
| Submitting an Article or Idea |
193097 |
/law/academics/journals-publications/loyolaconsumerlawreview/submittinganarticleoridea/ |
| Past Issues |
193096 |
/law/academics/journals-publications/loyolaconsumerlawreview/pastissues/ |
| Public Interest Law Reporter |
193098 |
/law/academics/journals-publications/publicinterestlawreporter/ |
| Library |
200529 |
/law/currentstudents/lawlibrary/ |
| Academic Support & Advising |
193120 |
/law/academics/academic-support-advising/ |
| Continuing Legal Education (CLE) |
204264 |
/law/academics/continuinglegaleducationcle/ |
| Faculty |
109961 |
/law/faculty/ |
| Directory |
189954 |
/law/faculty/directory/ |
| Faculty and Administration Profiles |
114497 |
/law/faculty/facultyandadministrationprofiles/ |
| right_column |
190451 |
/law/faculty/facultyandadministrationprofiles/rightcolumn/ |
| Esteemed Faculty |
192368 |
/law/faculty/esteemed-faculty/ |
| Faculty Conferences, Workshops, and Presentations |
125662 |
/law/faculty/recent-faculty-conferences/ |
| Research Highlights |
193126 |
/law/faculty/research-highlights/ |
| Law Faculty Policies |
110878 |
/law/faculty/lawfacultypolicies/ |
| Student Life |
192304 |
/law/studentlife/ |
| Study Abroad |
192371 |
/law/studentlife/studyabroad/ |
| Rome Program |
192372 |
/law/studentlife/studyabroad/romeprogram/ |
| right_column |
201635 |
/law/studentlife/studyabroad/rightcolumn/ |
| Organizations |
192374 |
/law/studentlife/organizations/ |
| General Info |
192431 |
/law/studentlife/organizations/generalinfo/ |
| Lecture Series |
192432 |
/law/studentlife/organizations/lectures/ |
| American Constitution Society |
199797 |
/law/studentlife/organizations/acs/ |
| right_column |
199798 |
/law/studentlife/organizations/acs/rightcolumn/ |
| Art Law Society |
192377 |
/law/studentlife/organizations/art_law/ |
| right_column |
194820 |
/law/studentlife/organizations/art_law/rightcolumn/ |
| Asian Pacific American Law Students Association (APALSA) |
192378 |
/law/studentlife/organizations/asian_american/ |
| right_column |
194821 |
/law/studentlife/organizations/asian_american/rightcolumn/ |
| Black Law Students Association (BLSA) |
192379 |
/law/studentlife/organizations/blsa/ |
| BLSA Board Member Bios |
192380 |
/law/studentlife/organizations/blsa/blsaboardmemberbios/ |
| right_column |
194822 |
/law/studentlife/organizations/blsa/rightcolumn/ |
| Business Law Society |
192381 |
/law/studentlife/organizations/business_law/ |
| right_column |
194823 |
/law/studentlife/organizations/business_law/rightcolumn/ |
| Criminal Law Union |
199850 |
/law/studentlife/organizations/criminal-law-union/ |
| right_column |
199851 |
/law/studentlife/organizations/criminal-law-union/rightcolumn/ |
| Disabled Law Student Collective (DLSC) |
192386 |
/law/studentlife/organizations/disabled_law_student_collective/ |
| right_column |
194827 |
/law/studentlife/organizations/disabled_law_student_collective/rightcolumn/ |
| Education Law and Policy Society |
192387 |
/law/studentlife/organizations/educationlawandpolicysociety/ |
| right_column |
194828 |
/law/studentlife/organizations/educationlawandpolicysociety/rightcolumn/ |
| Environmental Law Society |
192388 |
/law/studentlife/organizations/environmental/ |
| right_column |
194829 |
/law/studentlife/organizations/environmental/rightcolumn/ |
| Federal Bar Association |
192390 |
/law/studentlife/organizations/federalbarassociation/ |
| right_column |
194831 |
/law/studentlife/organizations/federalbarassociation/rightcolumn/ |
| Federalist Society |
199770 |
/law/studentlife/organizations/federalist-society/ |
| right_column |
199771 |
/law/studentlife/organizations/federalist-society/rightcolumn/ |
| First Generation Law Students (FGLS) |
192391 |
/law/studentlife/organizations/firstgenerationlawstudents/ |
| right_column |
194837 |
/law/studentlife/organizations/firstgenerationlawstudents/rightcolumn/ |
| Health Law Society |
192392 |
/law/studentlife/organizations/healthlawsociety/ |
| right_column |
194845 |
/law/studentlife/organizations/healthlawsociety/rightcolumn/ |
| Immigrants' Rights Coalition |
192395 |
/law/studentlife/organizations/immigrants_rights/ |
| right_column |
194848 |
/law/studentlife/organizations/immigrants_rights/rightcolumn/ |
| Intellectual Property Law Society |
192396 |
/law/studentlife/organizations/intellectual/ |
| right_column |
194849 |
/law/studentlife/organizations/intellectual/rightcolumn/ |
| International Law Society |
192397 |
/law/studentlife/organizations/international/ |
| right_column |
194850 |
/law/studentlife/organizations/international/rightcolumn/ |
| Irish Law Student Association |
199667 |
/law/studentlife/organizations/irish-lsa/ |
| right_column |
199796 |
/law/studentlife/organizations/irish-lsa/rightcolumn/ |
| Jewish Law Student Association (Decalogue Society) |
192385 |
/law/studentlife/organizations/decalogue/ |
| right_column |
194851 |
/law/studentlife/organizations/decalogue/rightcolumn/ |
| Labor & Employment Law Society |
192399 |
/law/studentlife/organizations/labor/ |
| right_column |
194853 |
/law/studentlife/organizations/labor/rightcolumn/ |
| Latine Law Students Association (LLSA) |
192400 |
/law/studentlife/organizations/lalsa/ |
| right_column |
194854 |
/law/studentlife/organizations/lalsa/rightcolumn/ |
| Loyola Defense Coalition |
192402 |
/law/studentlife/organizations/loyola-defense-coalition/ |
| right_column |
194859 |
/law/studentlife/organizations/loyola-defense-coalition/rightcolumn/ |
| Loyola Law School Democrats |
192403 |
/law/studentlife/organizations/law_democrats/ |
| right_column |
194861 |
/law/studentlife/organizations/law_democrats/rightcolumn/ |
| MENALSA |
204059 |
/law/studentlife/organizations/menalsa/ |
| right_column |
204060 |
/law/studentlife/organizations/menalsa/rightcolumn/ |
| Muslim Law Students Association (MLSA) |
192404 |
/law/studentlife/organizations/muslim/ |
| right_column |
194863 |
/law/studentlife/organizations/muslim/rightcolumn/ |
| National Lawyers Guild |
192405 |
/law/studentlife/organizations/national/ |
| right_column |
194874 |
/law/studentlife/organizations/national/rightcolumn/ |
| OUTLaw |
192408 |
/law/studentlife/organizations/outlaw/ |
| right_column |
194878 |
/law/studentlife/organizations/outlaw/rightcolumn/ |
| Public Interest Law Society (PILS) |
192414 |
/law/studentlife/organizations/public_interest/ |
| right_column |
194880 |
/law/studentlife/organizations/public_interest/rightcolumn/ |
| Real Estate and Construction Law Society (RECLS) |
192415 |
/law/studentlife/organizations/real-estate-and-construction-law-society/ |
| right_column |
194881 |
/law/studentlife/organizations/real-estate-and-construction-law-society/rightcolumn/ |
| Sports and Entertainment Law Society |
192429 |
/law/studentlife/organizations/sports/ |
| right_column |
194882 |
/law/studentlife/organizations/sports/rightcolumn/ |
| Student Bar Association (SBA) |
192418 |
/law/studentlife/organizations/studentbarassociation/ |
| right_column |
194884 |
/law/studentlife/organizations/studentbarassociation/rightcolumn/ |
| SUFEO (Stand Up For Each Other!) |
192425 |
/law/studentlife/organizations/sufeostandupforeachother/ |
| right_column |
194885 |
/law/studentlife/organizations/sufeostandupforeachother/rightcolumn/ |
| Trust & Estate Law Society |
198713 |
/law/studentlife/organizations/trust-estate-law-society/ |
| Veteran and Military Law Society |
192426 |
/law/studentlife/organizations/veteranandmilitarylawsociety/ |
| Weekend JD Law Students Association |
192428 |
/law/studentlife/organizations/wjd-law-students-association/ |
| right_column |
194886 |
/law/studentlife/organizations/wjd-law-students-association/rightcolumn/ |
| Women's Law Society |
192427 |
/law/studentlife/organizations/women/ |
| right_column |
194887 |
/law/studentlife/organizations/women/rightcolumn/ |
| Competitions |
192434 |
/law/studentlife/competitions/ |
| Wellness |
192436 |
/law/studentlife/wellness/ |
| Career Services |
192439 |
/law/studentlife/career-services/ |
| Outcomes |
192442 |
/law/studentlife/outcomes/ |
| Contact Us |
193128 |
/law/contactus/ |
| Thank You |
193129 |
/law/contactus/thankyou.shtml |
| Visit Us |
192332 |
/law/visitus/ |
| Visit Us-JD |
192333 |
/law/visitus/visitus-jd/ |
| Road to Loyola Series |
192335 |
/law/visitus/visitus-jd/roadtoloyolaseries/ |
| JD Recruitment Events |
192336 |
/law/visitus/visitus-jd/jdrecruitmentevents/ |
| Visit Us - Graduate Programs |
192337 |
/law/visitus/visitus-graduateprograms/ |
| Graduate Program Events |
192338 |
/law/visitus/visitus-graduateprograms/visit-us-graduate-events/ |
| Request for Information |
193130 |
/law/requestforinformation/ |
| Graduate Programs |
193131 |
/law/requestforinformation/graduateprograms/ |
| Thank you for your interest! |
193132 |
/law/rfi/success/index.shtml |
| Non-JD Programs Referral Program |
203145 |
/law/requestforinformation/non-jdprogramsreferralprogram/ |
| Current Students |
193133 |
/law/currentstudents/ |
| Resources |
193134 |
/law/currentstudents/resources.shtml |
| Law School Computing Services |
193229 |
/law/currentstudents/lawschoolcomputingservices/ |
| right_column |
193231 |
/law/currentstudents/lawschoolcomputingservices/rightcolumn/ |
| ExamSoft |
206589 |
/law/currentstudents/lawschoolcomputingservices/examsoft/ |
| ITS |
206607 |
https://www.luc.edu/its |
| Events |
193135 |
/law/currentstudents/events/ |
| Planning an Event |
193136 |
/law/currentstudents/events/planninganevent/ |
| right_column |
195107 |
/law/currentstudents/events/planninganevent/rightcolumn/ |
| Events Directory |
114498 |
/law/currentstudents/events/eventsdirectory/ |
| archive |
119475 |
/law/currentstudents/events/eventsdirectory/archive/ |
| Wiet Life Science Law Scholars Conference |
116156 |
/law/currentstudents/events/eventsdirectory/archive/wietlifesciencelawscholarsconference/ |
| 2018 Wing-Tat Lee Lecture in International Law |
117211 |
/law/events/wing-tat-lee-lecture/ |
| Wiet Life Science Law Scholars Workshop |
121210 |
/law/wiet-life-science/ |
| 2022 SALT Teaching Conference & Junior Faculty Development Workshop |
178692 |
/law/currentstudents/events/eventsdirectory/salt-annual-conference/ |
| 9th Annual Education Law: A Year in Review |
178043 |
/law/currentstudents/events/eventsdirectory/annual-education-law-a-year-in-review/ |
| Annual Rule of Law Institute Symposium |
184905 |
/law/currentstudents/events/eventsdirectory/annual-rule-of-law-institute-symposium/ |
| Beazley Symposium on Health Care Law and Policy |
116148 |
/law/events/beazley-symposium/ |
| Children's Rights in the Time of COVID-19 |
156667 |
/law/currentstudents/events/eventsdirectory/childrens-rights-in-the-time-of-covid-19/ |
| Constitutional Law Colloquium |
115936 |
/law/events/constitution-law-colloquium/ |
| Registration Information |
115937 |
/law/events/constitution-law-colloquium/registrationinformation/ |
| Presenters |
115938 |
/law/events/constitution-law-colloquium/presenters/ |
| Consumer Law Review Symposium 2022 |
168129 |
/law/currentstudents/events/eventsdirectory/consumer-law-review-symposium-2022/ |
| Education Law: A Year in Review |
122765 |
/law/events/education-law-year-in-review/ |
| Financial Regulators Under Siege |
184543 |
/law/currentstudents/events/eventsdirectory/financial-regulators-under-siege/ |
| Law Journal 2022 Symposium on Religious Liberty |
168193 |
/law/currentstudents/events/eventsdirectory/law-journal-symposium-on-religious-liberty-2022/ |
| Loyola University Chicago International Law Colloquium |
119809 |
/law/international-law-colloquium/ |
| Representing Students in Bullying Cases: A Primer for Attorneys |
195176 |
/law/currentstudents/events/eventsdirectory/representing-students-in-bullying-cases/ |
| Rule of Law in the 2030 Sustainable Development Agenda |
119472 |
/law/sustainable-development-agenda/ |
| The Children’s Legal Rights Journal Annual Symposium |
159319 |
/law/currentstudents/events/eventsdirectory/childrens-legal-rights-journal-annual-symposium/ |
| The Practice of Law in an AI World |
197029 |
/law/currentstudents/events/eventsdirectory/thepracticeoflawinanaiworld/ |
| Mission-Driven Course Innovation |
199293 |
/law/currentstudents/events/eventsdirectory/mission-drivencourseinnovation/ |
| Conference on Global Migration and the Rule of Law |
201793 |
/law/currentstudents/events/eventsdirectory/conferenceonglobalmigrationandtheruleoflaw/ |
| Competitions |
193194 |
/law/currentstudents/competitions/ |
| National Moot Court Competition Teams |
193195 |
/law/currentstudents/competitions/nationalmootcourtcompetitionteams/ |
| Alternates for Moot Court Teams |
193199 |
/law/currentstudents/competitions/nationalmootcourtcompetitionteams/alternatesformootcourtteams/ |
| American Bar Association Team |
193213 |
/law/currentstudents/competitions/nationalmootcourtcompetitionteams/americanbarassociationteam/ |
| Anderson Center Seventh Circuit Moot Court Competition |
193214 |
/law/currentstudents/competitions/nationalmootcourtcompetitionteams/andersoncenterseventhcircuitmootcourtcompetition/ |
| Appellate Lawyers Association Moot Court Competition |
193212 |
/law/currentstudents/competitions/nationalmootcourtcompetitionteams/appellatelawyersassociationmootcourtcompetition/ |
| Chicago Bar Association Moot Court Competition |
193211 |
/law/currentstudents/competitions/nationalmootcourtcompetitionteams/chicagobarassociationmootcourtcompetition/ |
| Federal Bar Association Thurgood Marshall Memorial Moot Court Competition |
202642 |
/law/currentstudents/competitions/nationalmootcourtcompetitionteams/federalbarassociationthurgoodmarshallmemorialmootcourtcompetition/ |
| Hispanic National Bar Association Moot Court Team |
193206 |
/law/currentstudents/competitions/nationalmootcourtcompetitionteams/hispanicnationalbarassociationmootcourtteam/ |
| Houston Invitational Team |
193200 |
/law/currentstudents/competitions/nationalmootcourtcompetitionteams/houstoninvitationalteam/ |
| Jessup International Law Moot Court Team |
193209 |
/law/currentstudents/competitions/nationalmootcourtcompetitionteams/jessupinternationallawmootcourtteam/ |
| The Judge Thomas Tang and Dr. Pearl Tang Moot Court Competition |
193202 |
/law/currentstudents/competitions/nationalmootcourtcompetitionteams/thejudgethomastanganddrpearltangmootcourtcompetition/ |
| National Child Welfare and Adoption Law Moot Court Team |
193208 |
/law/currentstudents/competitions/nationalmootcourtcompetitionteams/nationalchildwelfareandadoptionlawmootcourtteam/ |
| National Health Law Moot Court Team |
193207 |
/law/currentstudents/competitions/nationalmootcourtcompetitionteams/nationalhealthlawmootcourtteam/ |
| National Moot Court Competition |
193205 |
/law/currentstudents/competitions/nationalmootcourtcompetitionteams/nationalmootcourtcompetition/ |
| Saul Lefkowitz Moot Court Competition |
193203 |
/law/currentstudents/competitions/nationalmootcourtcompetitionteams/saullefkowitzmootcourtcompetition/ |
| Seigenthaler-Sutherland Cup National First Amendment Moot Court Competition |
193198 |
/law/currentstudents/competitions/nationalmootcourtcompetitionteams/seigenthaler-sutherlandcupnationalfirstamendmentmootcourtcompetition/ |
| Thurgood Marshall Moot Court Team |
193210 |
/law/currentstudents/competitions/nationalmootcourtcompetitionteams/thurgoodmarshallmootcourtteam/ |
| Wagner National Labor and Employment Law Moot Court Competition |
193201 |
/law/currentstudents/competitions/nationalmootcourtcompetitionteams/wagnernationallaborandemploymentlawmootcourtcompetition/ |
| Loyola Mock Trial Teams |
193215 |
/law/currentstudents/competitions/loyolamocktrialteams/ |
| The Corboy Fellows |
193220 |
/law/currentstudents/competitions/loyolamocktrialteams/thecorboyfellows/ |
| The Civil Law Mock Trial Team |
193217 |
/law/currentstudents/competitions/loyolamocktrialteams/thecivillawmocktrialteam/ |
| The Constance Baker Motley Mock Trial Team |
193219 |
/law/currentstudents/competitions/loyolamocktrialteams/theconstancebakermotleymocktrialteam/ |
| The Criminal Law Mock Trial Team |
193218 |
/law/currentstudents/competitions/loyolamocktrialteams/thecriminallawmocktrialteam/ |
| National Health Law Transactional Competition |
193221 |
/law/currentstudents/competitions/nationalhealthlawtransactionalcompetition/ |
| Loyola Dispute Resolution Competition Teams |
193222 |
/law/currentstudents/competitions/loyoladisputeresolutioncompetitionteams/ |
| ABA Negotiation Competition Team |
193223 |
/law/currentstudents/competitions/loyoladisputeresolutioncompetitionteams/abanegotiationcompetitionteam/ |
| INADR International Law School Mediation Team |
193224 |
/law/currentstudents/competitions/loyoladisputeresolutioncompetitionteams/inadrinternationallawschoolmediationteam/ |
| ABA Client Counseling Team |
193225 |
/law/currentstudents/competitions/loyoladisputeresolutioncompetitionteams/abaclientcounselingteam/ |
| Willem C. Vis International Moot Arbitration Competition |
193226 |
/law/currentstudents/competitions/loyoladisputeresolutioncompetitionteams/willemcvisinternationalmootarbitrationcompetition/ |
| Clara Barton International Humanitarian Law Competition (IHL) |
193227 |
/law/currentstudents/competitions/loyoladisputeresolutioncompetitionteams/clarabartoninternationalhumanitarianlawcompetitionihl/ |
| Sports Law Negotiation Competition Team |
193228 |
/law/currentstudents/competitions/loyoladisputeresolutioncompetitionteams/sportslawnegotiationcompetitionteam/ |
| School of Law Policies |
193235 |
/law/currentstudents/schooloflawpolicies/ |
| Pages |
193238 |
/law/currentstudents/pages.shtml |
| Office of Diversity, Equity, and Inclusion |
193340 |
/law/currentstudents/officeofdiversityequityandinclusion/ |
| right_column |
193341 |
/law/currentstudents/officeofdiversityequityandinclusion/rightcolumn/ |
| Our Journey Toward Inclusivity |
207125 |
/law/currentstudents/officeofdiversityequityandinclusion/ourjourneytowardinclusivity/ |
| Data, Resources and Reports |
193344 |
/law/currentstudents/officeofdiversityequityandinclusion/dataresourcesandreports/ |
| Office of Institutional Diversity, Equity, and Inclusion |
207111 |
https://www.luc.edu/diversityandinclusion/ |
| Reporting Discrimination or Sexual Misconduct |
193346 |
https://www.luc.edu/equity/ |
| Externships |
193313 |
/law/currentstudents/externships/ |
| Criminal Law Practicum |
193315 |
/law/currentstudents/externships/criminallawpracticum/ |
| Career Services |
193280 |
/law/currentstudents/careerservices/ |
| Students |
193281 |
/law/currentstudents/careerservices/students/ |
| right_column |
195114 |
/law/currentstudents/careerservices/students/rightcolumn/ |
| Diversity Resources |
193283 |
/law/currentstudents/careerservices/students/diversityresources/ |
| On Campus Interviewing |
193282 |
/law/currentstudents/careerservices/students/oncampusinterviewing/ |
| Alumni |
193286 |
/law/currentstudents/careerservices/alumni/ |
| right_column |
202295 |
/law/currentstudents/careerservices/alumni/rightcolumn/ |
| Employers |
193287 |
/law/currentstudents/careerservices/employers/ |
| Recruit with Loyola |
193290 |
/law/currentstudents/careerservices/employers/recruit-with-loyola/ |
| Recruiting Policies |
193292 |
/law/currentstudents/careerservices/employers/recruitingpolicies/ |
| right_column |
202294 |
/law/currentstudents/careerservices/employers/rightcolumn/ |
| Patent Program |
193309 |
/law/currentstudents/careerservices/patentprogram/ |
| Pearson Login |
193312 |
/law/currentstudents/careerservices/pearsonlogin/ |
| Registrar |
193316 |
/law/currentstudents/registrar/ |
| right_column |
193336 |
/law/currentstudents/registrar/rightcolumn/ |
| Academic Calendars |
193326 |
/law/currentstudents/registrar/academiccalendars/ |
| right_column |
195121 |
/law/currentstudents/registrar/academiccalendars/rightcolumn/ |
| Fall Academic Calendars |
201616 |
/law/currentstudents/registrar/academiccalendars/fallacademiccalendars/ |
| Summer Academic Calendars |
201620 |
/law/currentstudents/registrar/academiccalendars/summeracademiccalendars/ |
| Spring Academic Calendars |
201618 |
/law/currentstudents/registrar/academiccalendars/springacademiccalendars/ |
| Weekend JD Program Academic Calendar |
193331 |
/law/currentstudents/registrar/academiccalendars/weekendjdprogramacademiccalendar/ |
| Online Academic Calendar |
193330 |
/law/currentstudents/registrar/academiccalendars/onlineacademiccalendar/ |
| PROLAW Academic Calendars |
193327 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/academics/academiccalendar/ |
| Registration Planning |
193317 |
/law/currentstudents/registrar/registrationplanning/ |
| right_column |
195122 |
/law/currentstudents/registrar/registrationplanning/rightcolumn/ |
| Degree Requirements |
193318 |
/law/currentstudents/registrar/registrationplanning/degreerequirements/ |
| Course Classification by Term |
197956 |
/law/currentstudents/registrar/registrationplanning/courseclassificationbyterm/ |
| Registrar Policies |
193320 |
/law/currentstudents/registrar/registrationplanning/registrarpolicies/ |
| Curriculum Planning |
193321 |
/law/currentstudents/registrar/registrationplanning/curriculumplanning/ |
| Course Descriptions |
193322 |
/law/currentstudents/registrar/registrationplanning/coursedescriptions/ |
| Bar Information |
193334 |
/law/currentstudents/registrar/barinformation/ |
| Graduation Information |
193323 |
/law/currentstudents/registrar/graduationinformation/ |
| Awards and Honors |
193332 |
/law/currentstudents/registrar/awardsandhonors/ |
| Examination Procedures |
193337 |
/law/currentstudents/registrar/examinationprocedures/ |
| Records and Forms |
193325 |
/law/currentstudents/registrar/recordsandforms/ |
| Transcript Request |
193324 |
/law/currentstudents/registrar/transcriptrequest/ |
| documents |
193338 |
/law/currentstudents/registrar/documents/ |
| Wellbeing and Support Resources |
193352 |
/law/currentstudents/wellbeingandsupportresources/ |
| Stories |
194368 |
/law/stories/ |
| Sample Story Page - Full Width |
197009 |
/law/stories/samplepage1/ |
| Sample Story Page - with Right Column |
197024 |
/law/stories/samplepage2/ |
| right_column |
197010 |
/law/stories/samplepage2/rightcolumn/ |
| Banner |
194369 |
/law/stories/banner/ |
| custom_css |
196469 |
/law/stories/banner/customcss/ |
| custom_js |
196470 |
/law/stories/banner/customjs/ |
| Advocating for parents and children |
194615 |
/law/stories/banner/advocatingforparentsandchildren/ |
| Changemakers in action |
195147 |
/law/stories/banner/changemakers-in-action/ |
| Community - Strengthening the rule of law |
194698 |
/law/stories/banner/strengthening-the-rule-of-law/ |
| Community - Strengthening their resolve |
194695 |
/law/stories/banner/strengthening-their-resolve/ |
| Leading the way in rule of law |
156925 |
/law/stories/banner/barry-mccabe-leading-the-way-in-rule-of-law/ |
| right column |
156926 |
/law/stories/banner/barry-mccabe-leading-the-way-in-rule-of-law/rightcolumn/ |
| left column |
156927 |
/law/stories/banner/barry-mccabe-leading-the-way-in-rule-of-law/leftcolumn/ |
| Strengthening the rule of law |
168125 |
/law/stories/banner/strengthening-the-rule-of-law/ |
| left column |
168127 |
/law/stories/banner/strengthening-the-rule-of-law/leftcolumn/ |
| Strengthening their resolve |
188506 |
/law/stories/banner/strengthening-their-resolve/ |
| right column |
188507 |
/law/stories/banner/strengthening-their-resolve/rightcolumn/ |
| left column |
188508 |
/law/stories/banner/strengthening-their-resolve/leftcolumn/ |
| Faculty Research 2024-2025 |
198718 |
/law/stories/banner/faculty-research-2024/ |
| Samuel D. Brunson |
198924 |
/law/stories/banner/faculty-research-2024/samuel-d-brunson/ |
| Blanche Bong Cook |
198929 |
/law/stories/banner/faculty-research-2024/blanche-bong-cook/ |
| Adam Crepelle |
198930 |
/law/stories/banner/faculty-research-2024/adam-crepelle/ |
| James Thuo Gathii |
198931 |
/law/stories/banner/faculty-research-2024/james-thuo-gathii/ |
| Carmen G. Gonzalez |
198932 |
/law/stories/banner/faculty-research-2024/carmen-g-gonzalez/ |
| Cynthia Ho |
198933 |
/law/stories/banner/faculty-research-2024/cynthia-ho/ |
| Jordan Paradise |
198934 |
/law/stories/banner/faculty-research-2024/jordan-paradise/ |
| Stephen Rushin |
198935 |
/law/stories/banner/faculty-research-2024/stephen-rushin/ |
| Nadia N. Sawicki |
198936 |
/law/stories/banner/faculty-research-2024/nadia-n-sawicki/ |
| Barry Sullivan |
198937 |
/law/stories/banner/faculty-research-2024/barry-sullivan/ |
| Charlotte Tschider |
198938 |
/law/stories/banner/faculty-research-2024/charlotte-tschider/ |
| Spencer Weber Waller |
198939 |
/law/stories/banner/faculty-research-2024/spencer-weber-waller/ |
| Tax savvy |
199372 |
/law/stories/banner/tax-savvy/ |
| Weekend plans |
200912 |
/law/stories/banner/weekend-plans/ |
| Meet the class of 2027 |
201621 |
/law/stories/banner/meettheclassof2027/ |
| High stakes |
202474 |
/law/stories/banner/highstakes/ |
| Street smart |
203296 |
/law/stories/banner/streetsmart/ |
| Year in review 2024-2025 |
203413 |
/law/stories/banner/yearinreview2024-2025/ |
| Meet first-year law students 2026 |
206320 |
/law/stories/banner/meetfirst-yearlawstudents2026/ |
| Real world work real world impact |
206927 |
/law/stories/banner/realworldworkrealworldimpact/ |
| Our-Stories |
194383 |
/law/stories/our-stories/ |
| custom_css |
196471 |
/law/stories/our-stories/customcss/ |
| custom_js |
196472 |
/law/stories/our-stories/customjs/ |
| John and Kathy Schreiber to fund NIJC fellowship for Loyola Law grad |
194522 |
/law/stories/our-stories/nijc-fellowship/ |
| Mitchell (JD ’65) and Fran Wiet Endow Wiet Life Science Law Scholars Workshop |
189976 |
/law/stories/our-stories/mitchell-fran-wiet-workshop/ |
| New chairs appointed |
196180 |
/law/stories/our-stories/new-chairs-appointed-2024/ |
| Report on child labor trafficking is first of its kind |
194384 |
/law/stories/our-stories/report-child-labor-trafficking-first-of-its-kind/ |
| Thomas F. McInerney named executive director of Rule of Law for Development Program |
155059 |
/law/stories/our-stories/thomas-f-mcinerney-prolaw-executive-director/ |
| right column |
155060 |
/law/stories/our-stories/thomas-f-mcinerney-prolaw-executive-director/rightcolumn/ |
| left column |
155061 |
/law/stories/our-stories/thomas-f-mcinerney-prolaw-executive-director/leftcolumn/ |
| New director appointed |
197052 |
/law/stories/our-stories/sorensen-appointed-director-roli-prolaw/ |
| Health Justice Project’s Maywood MLP 2021-2024 Report |
198181 |
/law/stories/our-stories/hjp-maywood-mlp-report-2024/ |
| Grant from John Templeton Foundation to Support ICPSP |
199337 |
/law/stories/our-stories/john-templeton-foundation-icpsp/ |
| Congratulations, Class of 2025 |
202884 |
/law/stories/our-stories/congratulationsclassof2025/ |
| School of Law specialty programs 2026 |
206776 |
/law/stories/our-stories/schooloflawspecialtyprograms2026/ |
| Congratulations Class of 2026 |
207146 |
/law/stories/our-stories/congratulationsclassof2026/ |
| Alumni-Profiles |
194380 |
/law/stories/alumni-profiles/ |
| custom_css |
115640 |
/law/stories/alumni-profiles/customcss/ |
| custom_js |
115641 |
/law/stories/alumni-profiles/customjs/ |
| Community - Alumni - Alisa Muzergues Profile |
126466 |
/law/stories/alumni-profiles/alisa-muzergues-leader-positive-change/ |
| right column |
126467 |
/law/stories/alumni-profiles/alisa-muzergues-leader-positive-change/rightcolumn/ |
| left column |
126468 |
/law/stories/alumni-profiles/alisa-muzergues-leader-positive-change/leftcolumn/ |
| Community - Alumni - Buhlebenkosi Nxumalo Profile |
127131 |
/law/stories/alumni-profiles/buhlebenkosi-nxumalo-fighting-for-rule-of-law/ |
| right column |
127132 |
/law/stories/alumni-profiles/buhlebenkosi-nxumalo-fighting-for-rule-of-law/rightcolumn/ |
| left column |
127133 |
/law/stories/alumni-profiles/buhlebenkosi-nxumalo-fighting-for-rule-of-law/leftcolumn/ |
| Community - Alumni - Christina Conroy Profile |
178811 |
/law/stories/alumni-profiles/christina-conroy-preserving-war-stories/ |
| left column |
178813 |
/law/stories/alumni-profiles/christina-conroy-preserving-war-stories/leftcolumn/ |
| Community - Alumni - Curt Rodin Profile |
115530 |
/law/stories/alumni-profiles/community-alumni-curtrodinprofile/ |
| right column |
115532 |
/law/stories/alumni-profiles/community-alumni-curtrodinprofile/rightcolumn/ |
| left column |
115531 |
/law/stories/alumni-profiles/community-alumni-curtrodinprofile/leftcolumn/ |
| Community - Alumni - David Saldivar Profile |
121799 |
/law/stories/alumni-profiles/david-saldivar/ |
| right column |
121800 |
/law/stories/alumni-profiles/david-saldivar/rightcolumn/ |
| left column |
121801 |
/law/stories/alumni-profiles/david-saldivar/leftcolumn/ |
| Community - Alumni - Harrison Mbori Profile |
127597 |
/law/stories/alumni-profiles/harrison-mbori-sjd-international-comparative-law/ |
| right column |
127598 |
/law/stories/alumni-profiles/harrison-mbori-sjd-international-comparative-law/rightcolumn/ |
| left column |
127599 |
/law/stories/alumni-profiles/harrison-mbori-sjd-international-comparative-law/leftcolumn/ |
| Community - Alumni - Leslé Jansen Profile |
194702 |
/law/stories/alumni-profiles/lesle-jansen-shifting-resource-governance/ |
| Community - Alumni - Makeda Yeshaneh Profile |
157649 |
/law/stories/alumni-profiles/makeda-yeshaneh-combining-theory-and-practice/ |
| right column |
157650 |
/law/stories/alumni-profiles/makeda-yeshaneh-combining-theory-and-practice/rightcolumn/ |
| left column |
157651 |
/law/stories/alumni-profiles/makeda-yeshaneh-combining-theory-and-practice/leftcolumn/ |
| Community - Alumni - Marine Harutyunyan Profile |
186816 |
/law/stories/alumni-profiles/marine-harutyunyan-focusing-on-development/ |
| left column |
186818 |
/law/stories/alumni-profiles/marine-harutyunyan-focusing-on-development/leftcolumn/ |
| Community -Alumni - Wartime scholars |
187365 |
/law/stories/alumni-profiles/wartime-scholars/ |
| left column |
187367 |
/law/stories/alumni-profiles/wartime-scholars/leftcolumn/ |
| Loyola Law Magazine 2024 - Digging deep |
197031 |
/law/stories/alumni-profiles/digging-deep/ |
| Loyola Law Magazine 2024 - Breaking new ground in bail reform |
197039 |
/law/stories/alumni-profiles/breaking-new-ground-in-bail-reform/ |
| Loyola Law Magazine 2024 - A focus on repairing harm |
197042 |
/law/stories/alumni-profiles/a-focus-on-repairing-harm/ |
| Loyola Law Magazine 2024 - Community minded |
197043 |
/law/stories/alumni-profiles/community-minded/ |
| Loyola Law Magazine 2024 - Making a huge impact |
197044 |
/law/stories/alumni-profiles/making-a-huge-impact/ |
| Loyola Law Magazine 2024 - Recognizing outstanding service |
197045 |
/law/stories/alumni-profiles/recognizing-outstanding-service/ |
| Loyola Law Magazine 2024 - Take her to the river |
197048 |
/law/stories/alumni-profiles/take-her-to-the-river/ |
| Community - Faculty - Anu Dairkee Profile |
197137 |
/law/stories/alumni-profiles/anu-dairkee-fellow-advocate/ |
| Community - Alumni - Honoring homegrown talent |
198824 |
/law/stories/alumni-profiles/honoring-homegrown-talent/ |
| Loyola Law Magazine 2025 - A 360-degree approach to immigrant justice |
203576 |
/law/stories/alumni-profiles/loyolalawmagazine2025-a360-degreeapproachtoimmigrantjustice/ |
| Loyola Law Magazine 2025 - Team spirit |
203945 |
/law/stories/alumni-profiles/loyolalawmagazine2025-teamspirit/ |
| Loyola Law Magazine 2025 - Prep school |
203944 |
/law/stories/alumni-profiles/loyolalawmagazine2025-prepschool/ |
| Loyola Law Magazine 2025 - Celebrating excellence |
203946 |
/law/stories/alumni-profiles/loyolalawmagazine2025-celebratingexcellence/ |
| Loyola Law Magazine 2025 - Behind the label |
203947 |
/law/stories/alumni-profiles/loyolalawmagazine2025-behindthelabel/ |
| Loyola Law Magazine 2025 - A student-fueled movement |
204266 |
/law/stories/alumni-profiles/loyolalawmagazine2025-astudent-fueledmovement/ |
| Community - Alumni - Chris Karamanos Profile |
205025 |
/law/stories/alumni-profiles/community-alumni-chriskaramanosprofile/ |
| Community - Alumni - Kate Finch Profile |
205590 |
/law/stories/alumni-profiles/community-alumni-katefinchprofile/ |
| Community - Alumni - Keda Clady Profile |
206289 |
/law/stories/alumni-profiles/community-alumni-kedacladyprofile/ |
| Faculty-Profiles |
194373 |
/law/stories/faculty-profiles/ |
| custom_css |
196473 |
/law/stories/faculty-profiles/customcss/ |
| custom_js |
196474 |
/law/stories/faculty-profiles/customjs/ |
| Community - Faculty - Adrienne D. Mebane Profile |
196108 |
/law/stories/faculty-profiles/adrienne-d-mebane-preparing-students/ |
| Community - Faculty - Bill Loris Profile |
123381 |
/law/stories/faculty-profiles/bill-loris-supporting-rule-of-law/ |
| right column |
123382 |
/law/stories/faculty-profiles/bill-loris-supporting-rule-of-law/rightcolumn/ |
| left column |
123383 |
/law/stories/faculty-profiles/bill-loris-supporting-rule-of-law/leftcolumn/ |
| Community - Faculty - Charlotte Tschider Profile |
195777 |
/law/stories/faculty-profiles/charlotte-tschider-ai-expert/ |
| Community - Faculty - Cynthia M. Ho Profile |
194374 |
/law/stories/faculty-profiles/cynthia-m-ho-making-meaningful-connections/ |
| Community - Faculty - Joseph Saba Profile |
194694 |
/law/stories/faculty-profiles/joseph-saba-keeping-the-rule-of-law-strong/ |
| Community - Faculty - Michèle Alexandre Profile |
194795 |
/law/stories/faculty-profiles/michele-alexandre-meet-the-new-dean/ |
| Modal Content - Michèle Alexandre: At a Glance |
194796 |
/law/stories/faculty-profiles/michele-alexandre-meet-the-new-dean/modalcontent-michelealexandreataglance/ |
| Community - Faculty - Tyler Valeska Profile |
197060 |
/law/stories/faculty-profiles/tyler-valeska-free-speech-scholar/ |
| Community - Faculty - Ted Banks Profile |
198053 |
/law/stories/faculty-profiles/ted-banks-demystifying-compliance/ |
| Meet our new professors and endowed chairs |
198729 |
/law/stories/faculty-profiles/new-faculty-2024/ |
| Community - Faculty - Ellen Hunt Profile |
199103 |
/law/stories/faculty-profiles/ellen-hunt-risk-mitigator/ |
| Community - Faculty - Stacey Platt Profile |
199891 |
/law/stories/faculty-profiles/stacey-platt-family-advocate/ |
| Community - Faculty - Amy Thompson Profile |
200911 |
/law/stories/faculty-profiles/amy-thompson-the-defender-on-trial/ |
| Community - Faculty - Kate Mitchell Profile |
201610 |
/law/stories/faculty-profiles/community-faculty-katemitchellprofile/ |
| Spencer Weber Waller-Fair competition |
201799 |
/law/stories/faculty-profiles/spencerweberwaller-faircompetition/ |
| Faculty Research 2025 |
204306 |
/law/stories/faculty-profiles/facultyresearch2025/ |
| Stephen Rushin |
204417 |
/law/stories/faculty-profiles/facultyresearch2025/stephenrushin/ |
| Jeannine Bell |
204418 |
/law/stories/faculty-profiles/facultyresearch2025/jeanninebell/ |
| Blanche Bong Cook |
204421 |
/law/stories/faculty-profiles/facultyresearch2025/blanchebongcook/ |
| Adam Crepelle |
204422 |
/law/stories/faculty-profiles/facultyresearch2025/adamcrepelle/ |
| Tyler Valeska |
204423 |
/law/stories/faculty-profiles/facultyresearch2025/tylervaleska/ |
| Samuel D. Brunson |
204424 |
/law/stories/faculty-profiles/facultyresearch2025/samueldbrunson/ |
| Sheldon Bernard Lyke |
204425 |
/law/stories/faculty-profiles/facultyresearch2025/sheldonbernardlyke/ |
| Nadia N. Sawicki |
204426 |
/law/stories/faculty-profiles/facultyresearch2025/nadiansawicki/ |
| Barry Sullivan |
204427 |
/law/stories/faculty-profiles/facultyresearch2025/barrysullivan/ |
| Community - Faculty - Samuel D. Brunson Profile |
205913 |
/law/stories/faculty-profiles/community-faculty-samueldbrunsonprofile/ |
| Student-Profiles |
194413 |
/law/stories/student-profiles/ |
| custom_css |
196475 |
/law/stories/student-profiles/customcss/ |
| custom_js |
196476 |
/law/stories/student-profiles/customjs/ |
| Community - Students - Baiq Maesarah Profile |
124197 |
/law/stories/student-profiles/baiq-maesarah-prolaw-llm-19/ |
| left column |
124199 |
/law/stories/student-profiles/baiq-maesarah-prolaw-llm-19/leftcolumn/ |
| Community - Student - Ashton Yeh Profile |
198428 |
/law/stories/student-profiles/ashton-yeh-meet-the-president/ |
| President's Medallion - Wei Luo Profile |
199102 |
/law/stories/student-profiles/wei-luo-perseverance-pays-off/ |
| Community - Students - 2025-26 Rodin Fellows |
201082 |
/law/stories/student-profiles/socially-responsible/ |
| Community - Students - Julia Humenny |
204236 |
/law/stories/student-profiles/community-students-juliahumenny/ |
| Community - Students - Maddie Clark |
204375 |
/law/stories/student-profiles/community-students-maddieclark/ |
| Community - Students - Philip Cramer |
204495 |
/law/stories/student-profiles/community-students-philipcramer/ |
| Community - Students - Goodness Ajinomoh |
205018 |
/law/stories/student-profiles/community-students-goodnessajinomoh/ |
| Rodin Fellows 26-27 |
206123 |
/law/stories/student-profiles/rodinfellows26-27/ |
| Building community |
206520 |
/law/stories/student-profiles/buildingcommunity/ |
| Community - Meet the registrar team |
197606 |
/law/stories/meet-the-registrar-team/ |
| Community - Juliet Sorensen - Profile |
201457 |
/law/stories/juliet-sorensen-how-to-make-a-better-world |
| Community - Michael Kitzman - Profile |
204537 |
/law/stories/community-michaelkitzman-profile/ |
| Guiding students from day one |
205038 |
/law/stories/guidingstudentsfromdayone/ |
| Here to help |
205039 |
/law/stories/heretohelp/ |
| Learning from the best |
206244 |
/law/stories/learningfromthebest/ |
| Competition teams win big |
206344 |
/law/stories/competitionteamswinbig/ |
| Faculty and Staff Resources |
206807 |
/law/facultyandstaffresources/ |
| Commitment to Social Justice and Racial Equality Signature Form |
195118 |
/law/loyola-school-of-law-commitment-social-justice-racial-equality-signature-form/ |
| Commitment to Anti-Subordination & Social Justice Consistent with Jesuit Values |
195119 |
/law/loyola-school-of-law-commitment-social-justice-racial-equality/ |
| Company Recruitment |
195120 |
/law/employers/ |
| Corboy Law Center |
193354 |
/corboy/ |
| Site Map |
193719 |
/law/sitemap/ |
| documents |
195900 |
/law/documents/ |
| sandbox |
201797 |
/law/sandbox/ |
| test |
200917 |
/law/sandbox/test/ |
| draft |
201794 |
/law/sandbox/draft/ |
| Dev: WJD |
207382 |
/law/sandbox/devwjd/ |
| Dev: JD Admitted Students |
207378 |
/law/sandbox/devjdadmittedstudents/ |
| Dev: Housing Guide |
207345 |
/law/sandbox/devjdadmittedstudents/devhousingguide/ |
| Dev: Neighborhood Guide |
207376 |
/law/sandbox/devjdadmittedstudents/devneighborhoodguide/ |
| by the numbers - dev |
201858 |
/law/sandbox/bythenumbers-dev/ |
| Disclosure draft |
201859 |
/law/sandbox/disclosuredraft/ |
| School of Law Alumni |
128221 |
/law/alumni/ |
| site_logo |
128223 |
/law/alumni/sitelogo/ |
| footer |
128224 |
/law/alumni/footer/ |
| I Links |
184842 |
/law/alumni/ilinks/ |
| cta |
200647 |
/law/alumni/cta/ |
| modules-programming |
128228 |
/law/alumni/modules-programming/ |
| right_column |
120978 |
/law/alumni/rightcolumn/ |
| news |
183702 |
/law/alumni/news/ |
| Events |
127447 |
/law/alumni/events/ |
| Reunion Celebrations |
203163 |
https://web.cvent.com/event/cae34e6b-f13f-41b7-8263-86d590d4256a/summary |
| Alumni Awards & Recognition |
127449 |
/law/alumni/events/alumniawardsrecognition/ |
| Magazine |
154775 |
/law/alumni/magazine/ |
| materials |
166778 |
/law/alumni/publications/loyolalawmagazine/materials/ |
| Get Involved |
117114 |
/law/alumni/getinvolved/ |
| Ways to Get Involved |
200649 |
/law/alumni/getinvolved/waystogetinvolved/ |
| Board of Governors |
119965 |
/law/alumni/getinvolved/boardofgovernors/ |
| Alumni Services |
117115 |
/law/alumni/alumniservices/ |
| Loan Repayment Assistance Program (LRAP) |
198444 |
/law/alumni/alumniservices/lrap/ |
| A Message from Dean Alexandre |
205515 |
/law/alumni/amessagefromdeanalexandre/ |
| Message from Dean Alexandre - Feb-2026 |
206203 |
/law/alumni/messagefromdeanalexandre-feb-2026/ |
| Message from Dean Alexandre - May-2026 |
207148 |
/law/alumni/messagefromdeanalexandre-may-2026/ |
| LAW - Beazley Institute for Health Law and Policy |
192587 |
/law/academics/centersinstitutesandprograms/beazleyinstituteforhealthlawandpolicy/ |
| site_logo |
194253 |
/law/academics/centersinstitutesandprograms/beazleyinstituteforhealthlawandpolicy/sitelogo/ |
| Footer |
192609 |
/law/academics/centersinstitutesandprograms/beazleyinstituteforhealthlawandpolicy/footer/ |
| cta |
194254 |
/law/academics/centersinstitutesandprograms/beazleyinstituteforhealthlawandpolicy/cta/ |
| I Links |
194255 |
/law/academics/centersinstitutesandprograms/beazleyinstituteforhealthlawandpolicy/ilinks/ |
| social media |
194256 |
/law/academics/centersinstitutesandprograms/beazleyinstituteforhealthlawandpolicy/socialmedia/ |
| About Us |
192610 |
/law/academics/centersinstitutesandprograms/beazleyinstituteforhealthlawandpolicy/aboutus/ |
| Conferences and Events |
192612 |
/law/academics/centersinstitutesandprograms/beazleyinstituteforhealthlawandpolicy/aboutus/conferencesandevents/ |
| Benefactors |
192666 |
/law/academics/centersinstitutesandprograms/beazleyinstituteforhealthlawandpolicy/aboutus/benefactors/ |
| Faculty and Staff |
192611 |
/law/academics/centersinstitutesandprograms/beazleyinstituteforhealthlawandpolicy/aboutus/facultyandstaff/ |
| Annals of Health Law |
192668 |
/law/academics/journals-publications/annalsofhealthlaw/ |
| right_column |
192667 |
/law/academics/centersinstitutesandprograms/beazleyinstituteforhealthlawandpolicy/aboutus/rightcolumn/ |
| Compliance Studies |
204112 |
/law/academics/centersinstitutesandprograms/centerforcompliancestudies/ |
| Health Justice Project |
192676 |
/law/academics/clinical-programs/healthjusticeproject/ |
| Campus Student Resources |
192674 |
/law/academics/centersinstitutesandprograms/beazleyinstituteforhealthlawandpolicy/campusstudentresources/ |
| Online Student Resources |
192675 |
/law/academics/centersinstitutesandprograms/beazleyinstituteforhealthlawandpolicy/onlinestudentresources/ |
| Applying for Admission |
192599 |
/law/academics/centersinstitutesandprograms/beazleyinstituteforhealthlawandpolicy/applyingforadmission/ |
| right_column |
192600 |
/law/academics/centersinstitutesandprograms/beazleyinstituteforhealthlawandpolicy/applyingforadmission/rightcolumn/ |
| Request Information |
192596 |
/law/academics/centersinstitutesandprograms/beazleyinstituteforhealthlawandpolicy/requestinformation/ |
| right_column |
192598 |
/law/academics/centersinstitutesandprograms/beazleyinstituteforhealthlawandpolicy/requestinformation/rightcolumn/ |
| Stories |
192589 |
/law/academics/centersinstitutesandprograms/beazleyinstituteforhealthlawandpolicy/stories/ |
| documents |
192606 |
/law/academics/centersinstitutesandprograms/beazleyinstituteforhealthlawandpolicy/documents/ |
| LAW - Center for Business Law |
194476 |
/law/academics/centersinstitutesandprograms/centerforbusinesslaw/ |
| site_logo |
194482 |
/law/academics/centersinstitutesandprograms/centerforbusinesslaw/sitelogo/ |
| Footer |
194484 |
/law/academics/centersinstitutesandprograms/centerforbusinesslaw/footer/ |
| social media |
194486 |
/law/academics/centersinstitutesandprograms/centerforbusinesslaw/socialmedia/ |
| I Links |
194485 |
/law/academics/centersinstitutesandprograms/centerforbusinesslaw/ilinks/ |
| right_column |
195128 |
/law/academics/centersinstitutesandprograms/centerforbusinesslaw/rightcolumn/ |
| Events |
194477 |
/law/academics/centersinstitutesandprograms/centerforbusinesslaw/events/ |
| Faculty |
194478 |
/law/academics/centersinstitutesandprograms/centerforbusinesslaw/faculty/ |
| Student and Alumni Resources |
194479 |
/law/academics/centersinstitutesandprograms/centerforbusinesslaw/studentandalumniresources/ |
| Business Law Clinic |
194480 |
/law/academics/clinical-programs/businesslawclinic/ |
| Institute for Investor Protection |
194481 |
/law/academics/centersinstitutesandprograms/instituteforinvestorprotection/ |
| LAW - Center for Compliance Studies |
194526 |
/law/academics/centersinstitutesandprograms/centerforcompliancestudies/ |
| site_logo |
194534 |
/law/academics/centersinstitutesandprograms/centerforcompliancestudies/sitelogo/ |
| Footer |
194536 |
/law/academics/centersinstitutesandprograms/centerforcompliancestudies/footer/ |
| social media |
194538 |
/law/academics/centersinstitutesandprograms/centerforcompliancestudies/socialmedia/ |
| I Links |
194537 |
/law/academics/centersinstitutesandprograms/centerforcompliancestudies/ilinks/ |
| right_column |
195146 |
/law/academics/centersinstitutesandprograms/centerforcompliancestudies/rightcolumn/ |
| Publications and Events |
194527 |
/law/academics/centersinstitutesandprograms/centerforcompliancestudies/publicationsandevents/ |
| Student Resources |
194528 |
/law/academics/centersinstitutesandprograms/centerforcompliancestudies/studentresources/ |
| Faculty |
194529 |
/law/academics/centersinstitutesandprograms/centerforcompliancestudies/faculty/ |
| LAW - Center for Public Interest Law |
194469 |
/law/academics/centersinstitutesandprograms/centerforpublicinterestlaw/ |
| Footer |
194472 |
/law/academics/centersinstitutesandprograms/centerforpublicinterestlaw/footer/ |
| social media |
194473 |
/law/academics/centersinstitutesandprograms/centerforpublicinterestlaw/socialmedia/ |
| I Links |
194475 |
/law/academics/centersinstitutesandprograms/centerforpublicinterestlaw/ilinks/ |
| right_column |
195127 |
/law/academics/centersinstitutesandprograms/centerforpublicinterestlaw/rightcolumn/ |
| Loyola Summer Public Interest Stipend Program |
204761 |
/law/academics/centersinstitutesandprograms/centerforpublicinterestlaw/loyolasummerpublicintereststipendprogram/ |
| LAW - Center for the Human Rights of Children |
194506 |
/law/academics/centersinstitutesandprograms/centerforthehumanrightsofchildren/ |
| site_logo |
194516 |
/law/academics/centersinstitutesandprograms/centerforthehumanrightsofchildren/sitelogo/ |
| Footer |
194518 |
/law/academics/centersinstitutesandprograms/centerforthehumanrightsofchildren/footer/ |
| I Links |
194519 |
/law/academics/centersinstitutesandprograms/centerforthehumanrightsofchildren/ilinks/ |
| right_column |
194512 |
/law/academics/centersinstitutesandprograms/centerforthehumanrightsofchildren/rightcolumn/ |
| About Us |
194507 |
/law/academics/centersinstitutesandprograms/centerforthehumanrightsofchildren/aboutus/ |
| Events |
194509 |
/law/academics/centersinstitutesandprograms/centerforthehumanrightsofchildren/aboutus/events/ |
| Faculty |
194510 |
/law/academics/centersinstitutesandprograms/centerforthehumanrightsofchildren/faculty/ |
| Student Engagement |
194511 |
/law/academics/centersinstitutesandprograms/centerforthehumanrightsofchildren/studentengagement/ |
| Projects |
194514 |
/law/academics/centersinstitutesandprograms/centerforthehumanrightsofchildren/projects/ |
| Resources and Publications |
194513 |
/law/academics/centersinstitutesandprograms/centerforthehumanrightsofchildren/resourcesandpublications/ |
| LAW - Civitas ChildLaw Center |
194427 |
/law/academics/centersinstitutesandprograms/civitaschildlawcenter/ |
| site_logo |
194441 |
/law/academics/centersinstitutesandprograms/civitaschildlawcenter/sitelogo/ |
| social media |
194445 |
/law/academics/centersinstitutesandprograms/civitaschildlawcenter/socialmedia/ |
| I Links |
194444 |
/law/academics/centersinstitutesandprograms/civitaschildlawcenter/ilinks/ |
| right_column |
195143 |
/law/academics/centersinstitutesandprograms/civitaschildlawcenter/rightcolumn/ |
| Faculty |
194428 |
/law/academics/centersinstitutesandprograms/civitaschildlawcenter/faculty/ |
| Career Opportunities |
194429 |
/law/academics/centersinstitutesandprograms/civitaschildlawcenter/careeropportunities/ |
| JD Civitas ChildLaw Fellows Program |
194430 |
/law/academics/centersinstitutesandprograms/civitaschildlawcenter/jdcivitaschildlawfellowsprogram/ |
| Publications |
194431 |
/law/academics/centersinstitutesandprograms/civitaschildlawcenter/publications/ |
| Clinics, Institutes, and Initiatives |
194432 |
/law/academics/centersinstitutesandprograms/civitaschildlawcenter/clinicsinstitutesandinitiatives/ |
| Civitas ChildLaw Clinic |
194433 |
/law/academics/clinical-programs/civitaschildlawclinic/ |
| Civitas ChildLaw Policy Institute |
194434 |
/law/academics/centersinstitutesandprograms/civitaschildlawcenter/clinicsinstitutesandinitiatives/civitaschildlawpolicyinstitute/ |
| Children’s Health Law and Policy Initiative |
194437 |
/law/academics/centersinstitutesandprograms/civitaschildlawcenter/clinicsinstitutesandinitiatives/childrenshealthlawandpolicyinitiative/ |
| Center for the Human Rights of Children |
194438 |
https://www.luc.edu/chrc/ |
| Education Law and Policy Institute |
197947 |
https://www.luc.edu/law/academics/centersinstitutesandprograms/educationlawandpolicy/ |
| documents |
194440 |
/law/academics/centersinstitutesandprograms/civitaschildlawcenter/documents/ |
| LAW - Curt and Linda Rodin Center for Social Justice |
194453 |
/law/academics/centersinstitutesandprograms/curtandlindarodincenterforsocialjustice/ |
| site_logo |
194457 |
/law/academics/centersinstitutesandprograms/curtandlindarodincenterforsocialjustice/sitelogo/ |
| Footer |
194458 |
/law/academics/centersinstitutesandprograms/curtandlindarodincenterforsocialjustice/footer/ |
| social media |
194461 |
/law/academics/centersinstitutesandprograms/curtandlindarodincenterforsocialjustice/socialmedia/ |
| I Links |
194460 |
/law/academics/centersinstitutesandprograms/curtandlindarodincenterforsocialjustice/ilinks/ |
| Rodin Center Faculty and Advisors |
194454 |
/law/academics/centersinstitutesandprograms/curtandlindarodincenterforsocialjustice/curtandlindarodinprofessorsoflawandsocialjustice/ |
| Symposium |
191689 |
/law/academics/centersinstitutesandprograms/curtandlindarodincenterforsocialjustice/symposium/ |
| Annual Reports |
194456 |
/law/academics/centersinstitutesandprograms/curtandlindarodincenterforsocialjustice/rodincenterannualreports/ |
| Fellowship Program |
197824 |
/law/academics/centersinstitutesandprograms/curtandlindarodincenterforsocialjustice/fellowshipprogram/ |
| LAW - Dan K. Webb Center for Advocacy |
194388 |
/law/academics/centersinstitutesandprograms/dankwebbcenterforadvocacy/ |
| site_logo |
194407 |
/law/academics/centersinstitutesandprograms/dankwebbcenterforadvocacy/sitelogo/ |
| Footer |
194408 |
/law/academics/centersinstitutesandprograms/dankwebbcenterforadvocacy/footer/ |
| social media |
194411 |
/law/academics/centersinstitutesandprograms/dankwebbcenterforadvocacy/socialmedia/ |
| I Links |
194410 |
/law/academics/centersinstitutesandprograms/dankwebbcenterforadvocacy/ilinks/ |
| right_column |
194406 |
/law/academics/centersinstitutesandprograms/dankwebbcenterforadvocacy/rightcolumn/ |
| About The Center |
194389 |
/law/academics/centersinstitutesandprograms/dankwebbcenterforadvocacy/aboutthecenter/ |
| Faculty & Staff |
194390 |
/law/academics/centersinstitutesandprograms/dankwebbcenterforadvocacy/aboutthecenter/facultystaff/ |
| Competitions |
194392 |
/law/academics/centersinstitutesandprograms/dankwebbcenterforadvocacy/aboutthecenter/competitions/ |
| Scholarships and Fellowships |
194394 |
/law/academics/centersinstitutesandprograms/dankwebbcenterforadvocacy/aboutthecenter/scholarshipsandfellowships/ |
| Advocacy Mentor Program |
194395 |
/law/academics/centersinstitutesandprograms/dankwebbcenterforadvocacy/aboutthecenter/advocacymentorprogram/ |
| Competition Team Tryouts and Registration |
194396 |
/law/academics/centersinstitutesandprograms/dankwebbcenterforadvocacy/aboutthecenter/competitionteamtryoutsandregistration/ |
| Trial Advocacy |
194397 |
/law/academics/centersinstitutesandprograms/dankwebbcenterforadvocacy/trialadvocacy/ |
| Appellate Advocacy |
194398 |
/law/academics/centersinstitutesandprograms/dankwebbcenterforadvocacy/appellateadvocacy/ |
| Advocacy Requirements |
194400 |
/law/academics/centersinstitutesandprograms/dankwebbcenterforadvocacy/advocacyrequirements/ |
| Dispute Resolution |
194421 |
/law/academics/centersinstitutesandprograms/disputeresolutionprogram/ |
| LAW - Dispute Resolution Program |
194416 |
/law/academics/centersinstitutesandprograms/disputeresolutionprogram/ |
| site_logo |
194422 |
/law/academics/centersinstitutesandprograms/disputeresolutionprogram/sitelogo/ |
| Footer |
194424 |
/law/academics/centersinstitutesandprograms/disputeresolutionprogram/footer/ |
| social media |
194426 |
/law/academics/centersinstitutesandprograms/disputeresolutionprogram/socialmedia/ |
| I Links |
194425 |
/law/academics/centersinstitutesandprograms/disputeresolutionprogram/ilinks/ |
| right_column |
195131 |
/law/academics/centersinstitutesandprograms/disputeresolutionprogram/rightcolumn/ |
| Faculty |
194417 |
/law/academics/centersinstitutesandprograms/disputeresolutionprogram/faculty/ |
| Events and Competitions |
194418 |
/law/academics/centersinstitutesandprograms/disputeresolutionprogram/eventsandcompetitions/ |
| International Mediation Tournament |
194419 |
/law/academics/centersinstitutesandprograms/disputeresolutionprogram/internationalmediationtournament/ |
| Curriculum |
194420 |
/law/academics/centersinstitutesandprograms/disputeresolutionprogram/curriculum/ |
| LAW - Education Law and Policy |
194587 |
/law/academics/centersinstitutesandprograms/educationlawandpolicy/ |
| site_logo |
194610 |
/law/academics/centersinstitutesandprograms/educationlawandpolicy/sitelogo/ |
| Footer |
194612 |
/law/academics/centersinstitutesandprograms/educationlawandpolicy/footer/ |
| right_column |
195144 |
/law/academics/centersinstitutesandprograms/educationlawandpolicy/rightcolumn/ |
| Leadership and Faculty |
194589 |
/law/academics/centersinstitutesandprograms/educationlawandpolicy/leadershipandfaculty/ |
| Experiential Learning |
194588 |
/law/academics/centersinstitutesandprograms/educationlawandpolicy/experientiallearning/ |
| Educational Advocacy |
194605 |
/law/studentlife/organizations/sufeostandupforeachother/ |
| Anti-Bullying Project |
194606 |
/law/academics/centersinstitutesandprograms/educationlawandpolicy/anti-bullying-program/ |
| Events and Research |
194590 |
/law/academics/centersinstitutesandprograms/educationlawandpolicy/eventsandresearch/ |
| Blog |
194607 |
http://blogs.luc.edu/edlawinstitute/ |
| Transforming School Discipline Collaborative |
194591 |
/law/academics/centersinstitutesandprograms/educationlawandpolicy/transformingschooldisciplinecollaborative/ |
| Education Law and Policy Institute Forum |
194592 |
/law/academics/centersinstitutesandprograms/educationlawandpolicy/educationlawandpolicyinstituteforum/ |
| Volume 2010 |
194594 |
/law/academics/centersinstitutesandprograms/educationlawandpolicy/educationlawandpolicyinstituteforum/volume2010/ |
| Volume 2011 |
194595 |
/law/academics/centersinstitutesandprograms/educationlawandpolicy/educationlawandpolicyinstituteforum/volume2011/ |
| Volume 2012 |
194596 |
/law/academics/centersinstitutesandprograms/educationlawandpolicy/educationlawandpolicyinstituteforum/volume2012/ |
| Volume 2013 |
194597 |
/law/academics/centersinstitutesandprograms/educationlawandpolicy/educationlawandpolicyinstituteforum/volume2013/ |
| Volume 2014 |
194598 |
/law/academics/centersinstitutesandprograms/educationlawandpolicy/educationlawandpolicyinstituteforum/volume2014/ |
| Volume 2015 |
194599 |
/law/academics/centersinstitutesandprograms/educationlawandpolicy/educationlawandpolicyinstituteforum/volume2015/ |
| Journal of Early Education Law and Policy |
194600 |
/law/academics/centersinstitutesandprograms/educationlawandpolicy/journalofearlyeducationlawandpolicy/ |
| 2012 Journal of Early Education Law and Policy |
194601 |
/law/academics/centersinstitutesandprograms/educationlawandpolicy/journalofearlyeducationlawandpolicy/2012journalofearlyeducationlawandpolicy/ |
| 2013 Journal of Early Education Law and Policy |
194602 |
/law/academics/centersinstitutesandprograms/educationlawandpolicy/journalofearlyeducationlawandpolicy/2013journalofearlyeducationlawandpolicy/ |
| 2014 Journal of Early Education Law and Policy |
194603 |
/law/academics/centersinstitutesandprograms/educationlawandpolicy/journalofearlyeducationlawandpolicy/2014journalofearlyeducationlawandpolicy/ |
| 2015 Journal of Early Education Law and Policy |
194604 |
/law/academics/centersinstitutesandprograms/educationlawandpolicy/journalofearlyeducationlawandpolicy/2015journalofearlyeducationlawandpolicy/ |
| documents |
200988 |
/law/academics/centersinstitutesandprograms/educationlawandpolicy/documents/ |
| LAW - Holistic Immigration Hub |
203561 |
/law/academics/centersinstitutesandprograms/holisticimmigrationhub/ |
| site_logo |
203567 |
/law/academics/centersinstitutesandprograms/holisticimmigrationhub/sitelogo/ |
| Footer |
203568 |
/law/academics/centersinstitutesandprograms/holisticimmigrationhub/footer/ |
| social media |
203569 |
/law/academics/centersinstitutesandprograms/holisticimmigrationhub/socialmedia/ |
| I Links |
203570 |
/law/academics/centersinstitutesandprograms/holisticimmigrationhub/ilinks/ |
| Sacred Ground Contested Space |
205909 |
/law/academics/centersinstitutesandprograms/holisticimmigrationhub/sacredgroundcontestedspace/ |
| Fellowship |
207520 |
/law/academics/centersinstitutesandprograms/holisticimmigrationhub/fellowship/ |
| LAW - Institute for Consumer Antitrust Studies |
194547 |
/law/academics/centersinstitutesandprograms/instituteforconsumerantitruststudies/ |
| site_logo |
194557 |
/law/academics/centersinstitutesandprograms/instituteforconsumerantitruststudies/sitelogo/ |
| Footer |
194559 |
/law/academics/centersinstitutesandprograms/instituteforconsumerantitruststudies/footer/ |
| I Links |
194560 |
/law/academics/centersinstitutesandprograms/instituteforconsumerantitruststudies/ilinks/ |
| right_column |
195129 |
/law/academics/centersinstitutesandprograms/instituteforconsumerantitruststudies/rightcolumn/ |
| About the Institute |
194548 |
/law/academics/centersinstitutesandprograms/instituteforconsumerantitruststudies/abouttheinstitute/ |
| Our faculty |
204529 |
https://www.luc.edu/law/faculty/directory/?filter=lawAntitrust |
| Advisory Boards |
194550 |
/law/academics/centersinstitutesandprograms/instituteforconsumerantitruststudies/abouttheinstitute/advisoryboards/ |
| Sponsors |
194551 |
/law/academics/centersinstitutesandprograms/instituteforconsumerantitruststudies/abouttheinstitute/sponsors/ |
| Events |
194552 |
/law/academics/centersinstitutesandprograms/instituteforconsumerantitruststudies/events/ |
| ASCOLA 2025 |
197908 |
/law/academics/centersinstitutesandprograms/instituteforconsumerantitruststudies/events/ascola2025/ |
| Guiding Principles and Antidiscrimination Policies |
201522 |
/law/academics/centersinstitutesandprograms/instituteforconsumerantitruststudies/events/ascola2025/guiding-principles |
| Odyssey Navy Pier Boat Cruise Registrants |
203178 |
https://www.luc.edu/media/lucedu/law/centers/antitrust/pdfs/ascola25/boat-cruise-Informational.pdf |
| ASCOLA 5K Registrants |
203055 |
/law/academics/centersinstitutesandprograms/instituteforconsumerantitruststudies/events/ascola2025/ascola5kregistrants/ |
| Opening ceremony photos |
203399 |
https://nbattaglia.photoshelter.com/gallery/062625-ASCOLAopening/G00007ifNYHsUAGg |
| Closing ceremony photos |
203400 |
https://nbattaglia.photoshelter.com/gallery/062825-ASCOLAclosing/G0000Piyj0PpduU8 |
| Additional ASCOLA photos |
203481 |
https://loyolauniversitychicago-my.sharepoint.com/:f:/g/personal/jmarvel_luc_edu/EnyZm18F7dFFjWBeCaAp-bkBeKnywqXDQrcRJVVBNal9DQ?e=qcgt5u |
| Annual Loyola Antitrust Colloquium |
127705 |
/law/currentstudents/events/eventsdirectory/annual-loyola-antitrust-colloquium/ |
| Publications |
194553 |
/law/academics/centersinstitutesandprograms/instituteforconsumerantitruststudies/publications/ |
| Student Opportunities |
194554 |
/law/academics/centersinstitutesandprograms/instituteforconsumerantitruststudies/studentopportunities/ |
| Student Fellowship Program |
194555 |
/law/academics/centersinstitutesandprograms/instituteforconsumerantitruststudies/studentopportunities/studentfellowshipprogram/ |
| LAW - Institute for International Law and Practice |
194616 |
/law/academics/centersinstitutesandprograms/instituteforinternationallawandpractice/ |
| site_logo |
194624 |
/law/academics/centersinstitutesandprograms/instituteforinternationallawandpractice/sitelogo/ |
| Footer |
194626 |
/law/academics/centersinstitutesandprograms/instituteforinternationallawandpractice/footer/ |
| I Links |
194627 |
/law/academics/centersinstitutesandprograms/instituteforinternationallawandpractice/ilinks/ |
| right_column |
195145 |
/law/academics/centersinstitutesandprograms/instituteforinternationallawandpractice/rightcolumn/ |
| Faculty |
194617 |
/law/academics/centersinstitutesandprograms/instituteforinternationallawandpractice/faculty/ |
| Competitions |
194618 |
/law/academics/centersinstitutesandprograms/instituteforinternationallawandpractice/competitions/ |
| Student Organizations |
194619 |
/law/academics/centersinstitutesandprograms/instituteforinternationallawandpractice/studentorganizations/ |
| International Law Review |
194620 |
/law/academics/centersinstitutesandprograms/instituteforinternationallawandpractice/internationallawreview/ |
| International Summer Grants |
194621 |
/law/academics/centersinstitutesandprograms/instituteforinternationallawandpractice/internationalsummergrants/ |
| Study Abroad |
194622 |
/law/studentlife/studyabroad/ |
| LAW - Institute for Investor Protection |
194491 |
/law/academics/centersinstitutesandprograms/instituteforinvestorprotection/ |
| site_logo |
194495 |
/law/academics/centersinstitutesandprograms/instituteforinvestorprotection/sitelogo/ |
| Footer |
194498 |
/law/academics/centersinstitutesandprograms/instituteforinvestorprotection/footer/ |
| cta |
194496 |
/law/academics/centersinstitutesandprograms/instituteforinvestorprotection/cta/ |
| I Links |
194500 |
/law/academics/centersinstitutesandprograms/instituteforinvestorprotection/ilinks/ |
| right_column |
195142 |
/law/academics/centersinstitutesandprograms/instituteforinvestorprotection/rightcolumn/ |
| Events |
194492 |
/law/academics/centersinstitutesandprograms/instituteforinvestorprotection/events/ |
| Current Investor Protection Challenges |
204695 |
/law/academics/centersinstitutesandprograms/instituteforinvestorprotection/events/currentinvestorprotectionchallenges/ |
| Board of Directors & Faculty |
194493 |
/law/academics/centersinstitutesandprograms/instituteforinvestorprotection/boardofdirectorsfaculty/ |
| LAW - Intellectual Property Law Program |
194563 |
/law/academics/centersinstitutesandprograms/intellectualpropertylawprogram/ |
| site_logo |
194569 |
/law/academics/centersinstitutesandprograms/intellectualpropertylawprogram/sitelogo/ |
| Footer |
194572 |
/law/academics/centersinstitutesandprograms/intellectualpropertylawprogram/footer/ |
| I Links |
194573 |
/law/academics/centersinstitutesandprograms/intellectualpropertylawprogram/ilinks/ |
| Curriculum |
194564 |
/law/academics/centersinstitutesandprograms/intellectualpropertylawprogram/curriculum/ |
| Career Opportunities |
194565 |
/law/academics/centersinstitutesandprograms/intellectualpropertylawprogram/careeropportunities/ |
| Events |
194566 |
/law/academics/centersinstitutesandprograms/intellectualpropertylawprogram/events/ |
| Separating Myth from Reality: IP Law and Practice |
194567 |
/law/academics/centersinstitutesandprograms/intellectualpropertylawprogram/myths-from-reality/ |
| IP Bytes Blog |
194568 |
http://blogs.luc.edu/ipbytes/ |
| LAW - Library |
193239 |
/law/currentstudents/lawlibrary/ |
| site_logo |
195115 |
/law/currentstudents/lawlibrary/sitelogo/ |
| Footer |
195116 |
/law/currentstudents/lawlibrary/footer/ |
| I Links |
195125 |
/law/currentstudents/lawlibrary/ilinks/ |
| right_column |
193278 |
/law/currentstudents/lawlibrary/rightcolumn/ |
| About the Library |
193240 |
/law/currentstudents/lawlibrary/aboutthelibrary/ |
| Staff Directory |
193252 |
/law/currentstudents/lawlibrary/aboutthelibrary/staffdirectory/ |
| Policies |
193255 |
/law/currentstudents/lawlibrary/aboutthelibrary/policies/ |
| Contact Us |
193243 |
/law/currentstudents/lawlibrary/aboutthelibrary/contactus/ |
| Frequently Asked Questions |
193241 |
/law/currentstudents/lawlibrary/aboutthelibrary/frequentlyaskedquestions/ |
| Research |
193258 |
/law/currentstudents/lawlibrary/research/ |
| Databases A-Z |
193265 |
http://lawlibguides.luc.edu/az.php |
| Research Guides |
193264 |
http://lawlibguides.luc.edu/ |
| Library Catalog |
193266 |
https://luc.primo.exlibrisgroup.com/discovery/search?vid=01LUC_INST:01LUC&lang=en |
| Law eCommons |
193263 |
http://lawecommons.luc.edu/ |
| Law Scholars |
204394 |
https://lawscholars.luc.edu |
| Worldcat |
193262 |
http://flagship.luc.edu/login?url=http://newfirstsearch.oclc.org/autho=100111303;dbname=WorldCat;done=referer:FSIP/ |
| Loyola University Libraries |
193261 |
http://libraries.luc.edu/ |
| Non-Law Databases |
193260 |
http://libraries.luc.edu/databases |
| Other Law Libraries |
193267 |
/law/currentstudents/lawlibrary/research/otherlawlibraries/ |
| Library Services |
193268 |
/law/currentstudents/lawlibrary/libraryservices/ |
| For Faculty |
193272 |
http://lawlibguides.luc.edu/faculty |
| For Students |
193271 |
http://lawlibguides.luc.edu/students |
| For Alumni |
193270 |
http://lawlibguides.luc.edu/LawLibraryAlumniServicesGuide |
| Interlibrary Loan |
193269 |
https://illiad.luc.edu/illiad/JDS/logon.html |
| Help |
193273 |
/law/currentstudents/lawlibrary/help/ |
| FAQ |
193277 |
http://lawlibguides.luc.edu/FAQ |
| Video Tutorials |
193279 |
/law/currentstudents/lawlibrary/videotutorials/ |
| LAW - National Security and Civil Rights Program |
194577 |
/law/academics/centersinstitutesandprograms/nationalsecurityandcivilrightsprogram/ |
| site_logo |
194582 |
/law/academics/centersinstitutesandprograms/nationalsecurityandcivilrightsprogram/sitelogo/ |
| Footer |
194584 |
/law/academics/centersinstitutesandprograms/nationalsecurityandcivilrightsprogram/footer/ |
| I Links |
194585 |
/law/academics/centersinstitutesandprograms/nationalsecurityandcivilrightsprogram/ilinks/ |
| right_column |
195133 |
/law/academics/centersinstitutesandprograms/nationalsecurityandcivilrightsprogram/rightcolumn/ |
| Faculty |
194578 |
/law/academics/centersinstitutesandprograms/nationalsecurityandcivilrightsprogram/faculty/ |
| Events and Conferences |
194580 |
/law/academics/centersinstitutesandprograms/nationalsecurityandcivilrightsprogram/eventsandconferences/ |
| Academic Presentations & Public Appearances |
194581 |
/law/academics/centersinstitutesandprograms/nationalsecurityandcivilrightsprogram/academicpresentationspublicappearances/ |
| LAW - Rule of Law for Development Program |
194629 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/ |
| site_logo |
194689 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/sitelogo/ |
| Footer |
194691 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/footer/ |
| cta |
194690 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/cta/ |
| I Links |
194692 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/ilinks/ |
| right_column |
194685 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/rightcolumn/ |
| modules-programming |
200104 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/modules-programming/ |
| About Us |
194630 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/aboutus/ |
| Advisory Board |
194633 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/aboutus/advisoryboard/ |
| Nancy J. Anderson |
194648 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/aboutus/advisoryboard/nancyjanderson/ |
| Thomas Bianchi |
194649 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/aboutus/advisoryboard/thomasbianchi/ |
| Emmye T. Cahn |
194634 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/aboutus/advisoryboard/emmyetcahn/ |
| Scott Carlson |
194653 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/aboutus/advisoryboard/scottcarlson/ |
| Bandini Chhichhia |
194651 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/aboutus/advisoryboard/bandinichhichhia/ |
| Walter G. Coppenrath, Jr. |
194635 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/aboutus/advisoryboard/waltergcoppenrathjr/ |
| Antonello Corrado |
194637 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/aboutus/advisoryboard/antonellocorrado/ |
| Michael Davies |
194638 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/aboutus/advisoryboard/michaeldavies/ |
| Barry J. Hart |
194640 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/aboutus/advisoryboard/barryjhart/ |
| Maggie Hickey |
206532 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/aboutus/advisoryboard/maggiehickey/ |
| Craig Lundin |
194642 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/aboutus/advisoryboard/craiglundin/ |
| Barry McCabe |
194646 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/aboutus/advisoryboard/barrymccabe/ |
| Mary Noel Pepys |
194647 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/aboutus/advisoryboard/marynoelpepys/ |
| George T. Plumb |
194636 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/aboutus/advisoryboard/georgetplumb/ |
| Joseph A. Power, Jr. |
194639 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/aboutus/advisoryboard/josephapowerjr/ |
| Elizabeth Powers |
194641 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/aboutus/advisoryboard/elizabethpowers/ |
| Rumu Sarkar |
194643 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/aboutus/advisoryboard/rumusarkar/ |
| Renata Tardioli |
194644 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/aboutus/advisoryboard/renatatardioli/ |
| Justice Mary Jane Theis |
194645 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/aboutus/advisoryboard/justicemaryjanetheis/ |
| Edward Wanandi |
194650 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/aboutus/advisoryboard/edwardwanandi/ |
| Charles Benjamin |
206609 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/aboutus/advisoryboard/charlesbenjamin/ |
| Faculty |
207221 |
https://www.luc.edu/law/faculty/directory/?filter=lawProlaw |
| Rule of Law Institute |
207220 |
https://www.luc.edu/law/academics/centersinstitutesandprograms/ruleoflawinstitute/ |
| Benefactors and Strategic Partnerships |
194631 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/aboutus/benefactorsandstrategicpartnerships/ |
| Admission |
207348 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/admission/ |
| Application Process |
200420 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/admission/applicationprocess/ |
| Financial Support |
194683 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/financialsupport/ |
| Academics |
194654 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/academics/ |
| LLM in Rule of Law for Development (PROLAW) |
207222 |
https://www.luc.edu/law/academics/degreeprograms/llmdegrees/llminruleoflawfordevelopmentprolaw/ |
| MJ in Rule of Law for Development (PROLAW) |
207223 |
https://www.luc.edu/law/academics/degreeprograms/mjdegrees/mjinruleoflawfordevelopmentprolaw/ |
| Academic Calendar |
194671 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/academics/academiccalendar/ |
| Journal on Rule of Law |
194661 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/academics/journalonruleoflaw/ |
| Volume 1 |
194662 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/academics/journalonruleoflaw/volume1/ |
| Alexandre Cordahi |
194663 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/academics/journalonruleoflaw/volume1/alexandrecordahi/ |
| Eleonora Corsini |
194664 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/academics/journalonruleoflaw/volume1/eleonoracorsini/ |
| Melizsa Mugyenyi |
194665 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/academics/journalonruleoflaw/volume1/melizsamugyenyi/ |
| Volume 2 |
194666 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/academics/journalonruleoflaw/volume2/ |
| Volume 3 |
194667 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/academics/journalonruleoflaw/volume3/ |
| Volume 4 |
194668 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/academics/journalonruleoflaw/volume4/ |
| Volume 5 |
194669 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/academics/journalonruleoflaw/volume5/ |
| Volume 6 |
194670 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/academics/journalonruleoflaw/volume6/ |
| Volume 7 |
203960 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/academics/journalonruleoflaw/volume7/ |
| Akbar Khan |
194655 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/academics/akbarkhan/ |
| Rob Oliver |
194656 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/academics/roboliver/ |
| Developing and Managing an International Career |
194657 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/academics/developingandmanaginganinternationalcareer/ |
| Michelle Oliel |
194658 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/academics/michelleoliel/ |
| Nicole Rangel |
194659 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/academics/nicolerangel/ |
| Naresh Singh, Ph.D. |
194660 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/academics/nareshsinghphd/ |
| Orphanages, trafficking and the rule of law |
194672 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/academics/orphanagestraffickingandtheruleoflaw/ |
| Keith Moore |
194674 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/academics/keithmoore/ |
| Thibault Muzergues |
194675 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/academics/thibaultmuzergues/ |
| Legal Rights of the Poor: Making the Law Work for Everyone |
194676 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/academics/legalrightsofthepoormakingthelawworkforeveryone/ |
| Constitution Making in the 21st Century |
194677 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/academics/constitutionmakinginthe21stcentury/ |
| Ms. Geralyn Busnardo |
194678 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/academics/msgeralynbusnardo/ |
| Chontit Chuenurah |
194680 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/academics/chontitchuenurah/ |
| Olivia Rope |
194681 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/academics/oliviarope/ |
| Alessandra Mistura |
194682 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/academics/alessandramistura/ |
| PROLAW in Rome |
194688 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/prolaw-in-rome/ |
| Online and in campus |
200419 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/onlineandincampus/ |
| materials |
194687 |
/law/academics/centersinstitutesandprograms/ruleoflawfordevelopmentprogram/materials/ |
| Frequently Asked Questions |
205443 |
/law/sandbox/frequentlyaskedquestions/ |
| LAW - Rule of Law Institute |
194736 |
/law/academics/centersinstitutesandprograms/ruleoflawinstitute/ |
| site_logo |
194761 |
/law/academics/centersinstitutesandprograms/ruleoflawinstitute/sitelogo/ |
| Footer |
194763 |
/law/academics/centersinstitutesandprograms/ruleoflawinstitute/footer/ |
| I Links |
194764 |
/law/academics/centersinstitutesandprograms/ruleoflawinstitute/ilinks/ |
| right_column |
195130 |
/law/academics/centersinstitutesandprograms/ruleoflawinstitute/rightcolumn/ |
| About us |
194738 |
/law/academics/centersinstitutesandprograms/ruleoflawinstitute/aboutus/ |
| Research and Scholarship |
194740 |
/law/academics/centersinstitutesandprograms/ruleoflawinstitute/researchandscholarship/ |
| Publications |
194748 |
/law/academics/centersinstitutesandprograms/ruleoflawinstitute/publications/ |
| Newsletter archive |
205568 |
/law/academics/centersinstitutesandprograms/ruleoflawinstitute/newsletterarchive/ |
| International Diplomacy in Turbulent Times |
201405 |
/law/academics/centersinstitutesandprograms/ruleoflawinstitute/europes-waiting-room-2025 |
| The Rule of Law and the American Experiment |
204474 |
/law/academics/centersinstitutesandprograms/ruleoflawinstitute/theruleoflawandtheamericanexperiment/ |
| LAW - Tax and Estate Planning Program |
194487 |
/law/academics/centersinstitutesandprograms/taxandestateplanningprogram/ |
| site_logo |
194494 |
/law/academics/centersinstitutesandprograms/taxandestateplanningprogram/sitelogo/ |
| Footer |
194499 |
/law/academics/centersinstitutesandprograms/taxandestateplanningprogram/footer/ |
| I Links |
194501 |
/law/academics/centersinstitutesandprograms/taxandestateplanningprogram/ilinks/ |
| right_column |
195140 |
/law/academics/centersinstitutesandprograms/taxandestateplanningprogram/rightcolumn/ |
| Faculty |
194488 |
/law/academics/centersinstitutesandprograms/taxandestateplanningprogram/faculty/ |
| Gaining Practical Experience |
194489 |
/law/academics/centersinstitutesandprograms/taxandestateplanningprogram/gainingpracticalexperience/ |
| FAQ |
194490 |
/law/academics/centersinstitutesandprograms/taxandestateplanningprogram/faq/ |
| Loyola Advisory - DEV |
184891 |
/loyola-advisory-dev/ |
| site_logo |
184892 |
/loyola-advisory-dev/sitelogo/ |
| Quinlan Business Leadership Hub |
184186 |
/leadershiphub/ |
| site_logo |
184187 |
/leadershiphub/sitelogo/ |
| About the Hub |
184193 |
/leadershiphub/aboutthehub/ |
| Centers |
184194 |
/leadershiphub/centers/ |
| Baumhart Center |
184199 |
/baumhartcenter/ |
| Executive and Professional Education Center |
184200 |
/executiveeducation/ |
| Family Business Center |
184201 |
/familybusiness/ |
| Supply Chain and Sustainability Center |
184202 |
/supplychaincenter/ |
| Risk Management and Insurance Center |
184204 |
/leadershiphub/centers/riskmanagementandinsurancecenter/ |
| About |
184206 |
/leadershiphub/centers/riskmanagementandinsurancecenter/about/ |
| Advisory Board |
184207 |
/leadershiphub/centers/riskmanagementandinsurancecenter/about/advisoryboard/ |
| Profiles |
185535 |
/leadershiphub/centers/riskmanagementandinsurancecenter/about/advisoryboard/profiles/ |
| Events |
184218 |
/leadershiphub/centers/riskmanagementandinsurancecenter/events/ |
| Past Events |
184219 |
/leadershiphub/centers/riskmanagementandinsurancecenter/events/pastevents/ |
| archive |
184333 |
/leadershiphub/centers/riskmanagementandinsurancecenter/events/pastevents/archive/ |
| Financial Literacy Day |
198245 |
/leadershiphub/centers/riskmanagementandinsurancecenter/events/pastevents/financialliteracyday/ |
| Geopolitical and Economic Uncertainty |
206519 |
/leadershiphub/centers/riskmanagementandinsurancecenter/events/geopoliticalandeconomicuncertainty/ |
| Home Page |
187754 |
/leadershiphub/centers/riskmanagementandinsurancecenter/ |
| Speaker Series |
187728 |
/leadershiphub/centers/riskmanagementandinsurancecenter/speakerseries/ |
| Home Page |
205342 |
/leadershiphub/centers/riskmanagementandinsurancecenter/ |
| Past Speaker Series Presentations |
189995 |
/leadershiphub/centers/riskmanagementandinsurancecenter/speakerseries/pastspeakerseriespresentations/ |
| Fall 2025 |
200990 |
/leadershiphub/centers/riskmanagementandinsurancecenter/speakerseries/fall2025/ |
| Commanding the Chaos: A Playbook for High-Stakes Decision-Making |
204198 |
/leadershiphub/centers/riskmanagementandinsurancecenter/speakerseries/fall2025/commandingthechaosaplaybookforhigh-stakesdecision-making/ |
| Managing Enterprise Risk and ESG Investment |
204199 |
/leadershiphub/centers/riskmanagementandinsurancecenter/speakerseries/fall2025/managingenterpriseriskandesginvestment/ |
| Embedding AI in Risk Management in Financial Services |
204200 |
/leadershiphub/centers/riskmanagementandinsurancecenter/speakerseries/fall2025/embeddingaiinriskmanagementinfinancialservices/ |
| AI-Driven Risk Management in Banking and FinTech |
204201 |
/leadershiphub/centers/riskmanagementandinsurancecenter/speakerseries/fall2025/ai-drivenriskmanagementinbankingandfintech/ |
| Fall 2023 |
190014 |
/leadershiphub/centers/riskmanagementandinsurancecenter/speakerseries/pastspeakerseriespresentations/fall2023/ |
| Launching a Bank |
190001 |
/leadershiphub/centers/riskmanagementandinsurancecenter/speakerseries/pastspeakerseriespresentations/fall2023/launchingabank/ |
| Spring 2024 |
190015 |
/leadershiphub/centers/riskmanagementandinsurancecenter/speakerseries/pastspeakerseriespresentations/spring2024/ |
| Sanctions Matter |
190018 |
/leadershiphub/centers/riskmanagementandinsurancecenter/speakerseries/pastspeakerseriespresentations/spring2024/sanctionsmatter/ |
| Finding your Footing in Property Insurance Marketplace |
190019 |
/leadershiphub/centers/riskmanagementandinsurancecenter/speakerseries/pastspeakerseriespresentations/spring2024/findingyourfootinginpropertyinsurancemarketplace/ |
| Reconfiguring the Risk Management Frontier |
190020 |
/leadershiphub/centers/riskmanagementandinsurancecenter/speakerseries/pastspeakerseriespresentations/spring2024/reconfiguringtheriskmanagementfrontier/ |
| Managing the Enterprise Risk in Institutional Investment Portfolios |
190021 |
/leadershiphub/centers/riskmanagementandinsurancecenter/speakerseries/pastspeakerseriespresentations/spring2024/managingtheenterpriseriskininstitutionalinvestmentportfolios/ |
| ERM Development |
190022 |
/leadershiphub/centers/riskmanagementandinsurancecenter/speakerseries/pastspeakerseriespresentations/spring2024/ermdevelopment/ |
| Fall 2024 |
199781 |
/leadershiphub/centers/riskmanagementandinsurancecenter/speakerseries/pastspeakerseriespresentations/fall2024/ |
| Fintech |
187731 |
/leadershiphub/centers/riskmanagementandinsurancecenter/speakerseries/pastspeakerseriespresentations/fall2024/fintech/ |
| Evolution of the Private Equity Market |
187732 |
/leadershiphub/centers/riskmanagementandinsurancecenter/speakerseries/pastspeakerseriespresentations/fall2024/evolutionoftheprivateequitymarket/ |
| Commercial Real Estate |
187733 |
/leadershiphub/centers/riskmanagementandinsurancecenter/speakerseries/pastspeakerseriespresentations/fall2024/commercialrealestate/ |
| Machine Learning in Consumer Underwriting |
187735 |
/leadershiphub/centers/riskmanagementandinsurancecenter/speakerseries/pastspeakerseriespresentations/fall2024/machinelearninginconsumerunderwriting/ |
| Spring 2025 |
201760 |
/leadershiphub/centers/riskmanagementandinsurancecenter/speakerseries/pastspeakerseriespresentations/spring2025/ |
| Geopolitical Risk and Your Supply Chain Vendor Ecosystem |
200992 |
/leadershiphub/centers/riskmanagementandinsurancecenter/speakerseries/pastspeakerseriespresentations/spring2025/geopoliticalriskandyoursupplychainvendorecosystem/ |
| Money Laundering and Regulatory Risk Management |
200991 |
/leadershiphub/centers/riskmanagementandinsurancecenter/speakerseries/pastspeakerseriespresentations/spring2025/moneylaunderingandregulatoryriskmanagement/ |
| Right-Brained Risk |
187730 |
/leadershiphub/centers/riskmanagementandinsurancecenter/speakerseries/pastspeakerseriespresentations/spring2025/right-brainedrisk/ |
| Intro to Risk and Compliance Careers in Trading |
200994 |
/leadershiphub/centers/riskmanagementandinsurancecenter/speakerseries/pastspeakerseriespresentations/spring2025/introtoriskandcompliancecareersintrading/ |
| Issue Management |
200995 |
/leadershiphub/centers/riskmanagementandinsurancecenter/speakerseries/pastspeakerseriespresentations/spring2025/issuemanagement/ |
| A Risk Mindset for Not-for-Profit Firms |
201961 |
/leadershiphub/centers/riskmanagementandinsurancecenter/speakerseries/pastspeakerseriespresentations/spring2025/ariskmindsetfornot-for-profitfirms/ |
| Spring 2026 |
205932 |
/leadershiphub/centers/riskmanagementandinsurancecenter/speakerseries/spring2026/ |
| Modern Risk Management for High-Net-Worth Individuals and Family Businesses |
205933 |
/leadershiphub/centers/riskmanagementandinsurancecenter/speakerseries/spring2026/modernriskmanagementforhigh-net-worthindividualsandfamilybusinesses/ |
| Making Hard Decisions: A Practical Risk Analysis Framework |
206077 |
/leadershiphub/centers/riskmanagementandinsurancecenter/speakerseries/spring2026/makingharddecisionsapracticalriskanalysisframework/ |
| Seminar Series |
194784 |
/leadershiphub/centers/riskmanagementandinsurancecenter/seminarseries/ |
| Services |
184220 |
/leadershiphub/centers/riskmanagementandinsurancecenter/services/ |
| Sponsorship |
194571 |
/leadershiphub/centers/riskmanagementandinsurancecenter/sponsorship/ |
| site_logo |
187742 |
/leadershiphub/centers/riskmanagementandinsurancecenter/sitelogo/ |
| AI Business Consortium |
184205 |
/leadershiphub/centers/aibusinessconsortium/ |
| About |
184222 |
/leadershiphub/centers/aibusinessconsortium/about/ |
| Education |
185684 |
/leadershiphub/centers/aibusinessconsortium/education/ |
| Upcoming Events |
185687 |
/leadershiphub/centers/aibusinessconsortium/upcomingevents/ |
| Steering Committee |
185683 |
/leadershiphub/centers/aibusinessconsortium/steeringcommittee/ |
| Past Events |
187214 |
/leadershiphub/centers/aibusinessconsortium/pastevents/ |
| Sponsorship |
185685 |
/leadershiphub/centers/aibusinessconsortium/sponsorship/ |
| Research |
185686 |
/leadershiphub/centers/aibusinessconsortium/research/ |
| Contact Us |
187215 |
/leadershiphub/centers/aibusinessconsortium/contactus/ |
| Advisory Council |
184223 |
/leadershiphub/centers/aibusinessconsortium/about/advisorycouncil/ |
| Profiles |
185556 |
/leadershiphub/centers/aibusinessconsortium/about/advisorycouncil/profiles/ |
| Faculty |
184224 |
/leadershiphub/centers/aibusinessconsortium/about/faculty/ |
| Profiles |
185557 |
/leadershiphub/centers/aibusinessconsortium/about/faculty/profiles/ |
| Steering Committee |
184225 |
/leadershiphub/centers/aibusinessconsortium/steeringcommittee/ |
| Profiles |
185562 |
/leadershiphub/centers/aibusinessconsortium/steeringcommittee/profiles/ |
| Upcoming Events |
200814 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/upcomingevents/ |
| Education |
184226 |
/leadershiphub/centers/aibusinessconsortium/education/ |
| Past Events |
200938 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/pastevents/ |
| Sponsorship |
184229 |
/leadershiphub/centers/aibusinessconsortium/sponsorship/ |
| Research |
200819 |
/leadershiphub/centers/aibusinessconsortium/research/ |
| Research Services |
184230 |
/leadershiphub/centers/aibusinessconsortium/researchservices/ |
| Contact Us |
186748 |
/leadershiphub/centers/aibusinessconsortium/contactus/ |
| site_logo |
187162 |
/leadershiphub/centers/aibusinessconsortium/sitelogo/ |
| Kaufman Center for Financial Policy Studies |
197047 |
/kaufmancenter/ |
| Ignite Lab |
196157 |
/leadershiphub/centers/ignitelab/ |
| Services |
196164 |
/leadershiphub/centers/ignitelab/services/ |
| Marketing Consultation |
196166 |
/leadershiphub/centers/ignitelab/services/marketingconsultation/ |
| People and partners |
196160 |
/leadershiphub/centers/ignitelab/peopleandpartners/ |
| Spark Podcast |
196173 |
/leadershiphub/centers/ignitelab/sparkpodcast/ |
| Upcoming Events |
196165 |
/leadershiphub/centers/ignitelab/upcomingevents/ |
| Side Hustle Showcase 2026 |
206199 |
/leadershiphub/centers/ignitelab/upcomingevents/sidehustleshowcase2026/ |
| Past events |
200955 |
/leadershiphub/centers/ignitelab/pastevents/ |
| Side Hustle Showcase 2025 |
200954 |
/leadershiphub/centers/ignitelab/pastevents/sidehustleshowcase2025/ |
| AI and Entrepreneurship: A Presentation with Justin Daab |
202062 |
/leadershiphub/centers/ignitelab/pastevents/aiandentrepreneurshipapresentationwithjustindaab/ |
| Membership |
196181 |
/leadershiphub/centers/ignitelab/membership/ |
| Contact us |
196179 |
/leadershiphub/centers/ignitelab/contactus/ |
| social media |
196158 |
/leadershiphub/centers/ignitelab/socialmedia/ |
| site_logo |
196159 |
/leadershiphub/centers/ignitelab/sitelogo/ |
| Services |
184195 |
/leadershiphub/services/ |
| Recruitment |
184271 |
/leadershiphub/services/recruitment/ |
| Upcoming Events |
184196 |
/leadershiphub/upcomingevents/ |
| archive |
189070 |
/leadershiphub/upcomingevents/archive/ |
| Sponsorship |
184198 |
/leadershiphub/sponsorship/ |
| Videos |
184297 |
/leadershiphub/videos/ |
| Chicago Advocate Legal |
184298 |
/leadershiphub/videos/chicagoadvocatelegal/ |
| Syrian Community Network |
184299 |
/leadershiphub/videos/syriancommunitynetwork/ |
| The Value of the Loyola Business Leadership Hub |
184300 |
/leadershiphub/videos/thevalueoftheloyolabusinessleadershiphub/ |
| Quinlan School of Business |
202640 |
/leadershiphub/quinlanschoolofbusiness/ |
| Center for Cybersecurity |
178960 |
/ccpc/ |
| site_logo |
195825 |
/ccpc/sitelogo/ |
| Footer |
195826 |
/ccpc/footer/ |
| cta |
195827 |
/ccpc/cta/ |
| I Links |
195828 |
/ccpc/ilinks/ |
| News |
192454 |
/ccpc/news/ |
| 2025 |
200736 |
/ccpc/news/2025/ |
| archive |
206266 |
/ccpc/news/2024/archive/ |
| archive |
200737 |
/ccpc/news/archive/ |
| 2024 |
200738 |
/ccpc/news/2024/ |
| archive |
206263 |
/ccpc/news/2025/archive/ |
| 2023 |
206267 |
/ccpc/news/2023/ |
| 2022 |
206561 |
/ccpc/news/2022/ |
| 2021 |
207402 |
/ccpc/news/2021/ |
| 2020 |
207405 |
/ccpc/news/2020/ |
| 2019 |
207408 |
/ccpc/news/2019/ |
| 2018 |
207410 |
/ccpc/news/2018/ |
| right_column |
207438 |
/ccpc/news/rightcolumn/ |
| People |
178985 |
/ccpc/people/ |
| Contact |
178986 |
/ccpc/contact/ |
| Research and Activities |
178980 |
/ccpc/researchandactivities/ |
| Resources |
178984 |
/ccpc/resources/ |
| Loyola Chicago Retiree Association (LUCRA) |
69724 |
/loyolaretireeassociation/ |
| About Us |
71191 |
/loyolaretireeassociation/aboutus/ |
| Loyola Chicago Retiree Association (LUCRA) |
71192 |
/loyolaretireeassociation/aboutus/loyolachicagoretireeassociationlucra/ |
| Mission, Values, and Goals |
71193 |
/loyolaretireeassociation/aboutus/missionvaluesandgoals/ |
| Executive Committee |
71196 |
/loyolaretireeassociation/aboutus/executivecommittee/ |
| A Brief History |
185455 |
/loyolaretireeassociation/aboutus/abriefhistory/ |
| Recent Updates and News |
82354 |
/loyolaretireeassociation/recentupdatesandnews/ |
| Members' Notable Activities |
184274 |
/loyolaretireeassociation/recentupdatesandnews/membersnotableactivities/ |
| archive |
200650 |
/loyolaretireeassociation/recentupdatesandnews/membersnotableactivities/archive/ |
| Sharing Our Expertise |
184276 |
/loyolaretireeassociation/recentupdatesandnews/sharingourexpertise/ |
| In Memoriam |
185459 |
/loyolaretireeassociation/recentupdatesandnews/inmemoriam/ |
| Social Activities |
188535 |
/loyolaretireeassociation/recentupdatesandnews/socialactivities/ |
| Thomas H. Tobin, S.J. |
154305 |
/loyolaretireeassociation/recentupdatesandnews/thomashtobinsj/ |
| Raymond C. Baumhart, S.J. |
126289 |
/loyolaretireeassociation/recentupdatesandnews/raymondcbaumhartsj/ |
| Robert Bireley, S.J. |
126217 |
/loyolaretireeassociation/recentupdatesandnews/robertbireleysj/ |
| Wendy Cotter |
126219 |
/loyolaretireeassociation/recentupdatesandnews/wendycotter/ |
| Frank Fennell |
126221 |
/loyolaretireeassociation/recentupdatesandnews/frankfennell/ |
| Peter Gilmour |
126222 |
/loyolaretireeassociation/recentupdatesandnews/petergilmour/ |
| Anne Jalowiec |
126223 |
/loyolaretireeassociation/recentupdatesandnews/annejalowiec/ |
| Jeffry Mallow |
126224 |
/loyolaretireeassociation/recentupdatesandnews/jeffrymallow/ |
| Mary Ann McDermott |
126225 |
/loyolaretireeassociation/recentupdatesandnews/maryannmcdermott/ |
| Susan Mezey |
126226 |
/loyolaretireeassociation/recentupdatesandnews/susanmezey/ |
| Nick Patricca |
126229 |
/loyolaretireeassociation/recentupdatesandnews/nickpatricca/ |
| Barbara H. Rosenwein: |
126231 |
/loyolaretireeassociation/recentupdatesandnews/barbarahrosenwein/ |
| Linda K. Stroh |
126232 |
/loyolaretireeassociation/recentupdatesandnews/lindakstroh/ |
| Peter Maxwell |
126233 |
/loyolaretireeassociation/recentupdatesandnews/petermaxwell/ |
| Marilyn Susman |
126234 |
/loyolaretireeassociation/recentupdatesandnews/marilynsusman/ |
| Jean Morman Unsworth |
126235 |
/loyolaretireeassociation/recentupdatesandnews/jeanmormanunsworth/ |
| William Yotis |
126236 |
/loyolaretireeassociation/recentupdatesandnews/williamyotis/ |
| John Shea |
126238 |
/loyolaretireeassociation/recentupdatesandnews/johnshea/ |
| Nick Patricca: FIRST CALLED: ANDREW OF CAPERNAUM |
127286 |
/loyolaretireeassociation/recentupdatesandnews/nickpatriccafirstcalledandrewofcapernaum/ |
| Mary McDermott Hektoen Nurses and Humanities Program |
127523 |
/loyolaretireeassociation/recentupdatesandnews/marymcdermotthektoennursesandhumanitiesprogram/ |
| Mary McDermott: FREDA KAHLO SUMMER ART TOUR & PROGRAM |
127524 |
/loyolaretireeassociation/recentupdatesandnews/marymcdermottfredakahlosummerarttourprogram/ |
| Verna Foster |
178083 |
/loyolaretireeassociation/recentupdatesandnews/vernafoster/ |
| Ronald Thomas Lonsdale (January 23, 2019) |
178084 |
/loyolaretireeassociation/recentupdatesandnews/ronaldthomaslonsdalejanuary232019/ |
| Terry Williams |
178085 |
/loyolaretireeassociation/recentupdatesandnews/terrywilliams/ |
| Judith “Judy” Ginsberg Wittner |
178086 |
/loyolaretireeassociation/recentupdatesandnews/judithjudyginsbergwittner/ |
| Resources |
71197 |
/loyolaretireeassociation/resources/ |
| Dignity in Retirement |
72562 |
/loyolaretireeassociation/resources/dignityinretirement/ |
| Emeriti Privileges |
72560 |
/loyolaretireeassociation/resources/emeritiprivileges/ |
| AROHE (Association of Retiree Organization in Higher Education) |
184281 |
/loyolaretireeassociation/resources/aroheassociationofretireeorganizationinhighereducation/ |
| Consortium of Jesuit Retiree Associations in Higher Education |
185460 |
/loyolaretireeassociation/resources/consortiumofjesuitretireeassociationsinhighereducation/ |
| Archive |
185463 |
/loyolaretireeassociation/resources/archive/ |
| Annual Reports |
185461 |
/loyolaretireeassociation/resources/archive/annualreports/ |
| History of LUCRA |
185464 |
/loyolaretireeassociation/resources/archive/historyoflucra/ |
| Contact Us |
185791 |
/loyolaretireeassociation/contactus/ |
| site_logo |
200643 |
/loyolaretireeassociation/sitelogo/ |
| Footer |
69732 |
/loyolaretireeassociation/footer/ |
| Loyola Community and Family Services |
90701 |
/lcfs/ |
| site_logo |
90702 |
/lcfs/site_logo/ |
| Footer |
90704 |
/lcfs/footer/ |
| About Us |
92595 |
/lcfs/aboutus/ |
| STAFF |
99295 |
/lcfs/aboutus/staff/ |
| Profiles |
203474 |
/lcfs/aboutus/staff/profiles/ |
| TRAINEES |
99297 |
/lcfs/aboutus/trainees/ |
| Profiles |
203473 |
/lcfs/aboutus/trainees/profiles/ |
| Mission |
99315 |
/lcfs/mission/ |
| Services |
99316 |
/lcfs/services/ |
| Psychological Assessments (Testing) - Suspended as of Sept 2022 |
106980 |
/lcfs/psychologicalassessmentstesting-suspendedasofsept2022/ |
| Who We Serve |
100089 |
/lcfs/whoweserve/ |
| How To Get Started |
99317 |
/lcfs/howtogetstarted/ |
| Community Resources |
99314 |
/lcfs/communityresources/ |
| Graduate & Undergraduate Training |
101366 |
/lcfs/graduateundergraduatetraining/ |
| Contact Us |
90709 |
/lcfs/contactus/ |
| Loyola For You |
180937 |
/loyolaforyou/ |
| site_logo |
180980 |
/loyolaforyou/sitelogo/ |
| Living Up to Our Commitment |
180994 |
/loyolaforyou/livinguptoourcommitment/ |
| Our Position |
181152 |
/loyolaforyou/ourposition/ |
| Our Philosophy |
181351 |
/loyolaforyou/ourphilosophy/ |
| FAQ |
181389 |
/loyolaforyou/faq/ |
| Ask a Question |
181391 |
/loyolaforyou/askaquestion/ |
| Thank You |
181681 |
/loyolaforyou/askaquestion/thankyou/ |
| Loyola Gives |
166130 |
/loyolagives/ |
| site_logo |
166131 |
/loyolagives/sitelogo/ |
| social media |
166132 |
/loyolagives/socialmedia/ |
| Footer |
166133 |
/loyolagives/footer/ |
| I Links |
166134 |
/loyolagives/ilinks/ |
| Loyola Led Enterprises |
184203 |
/loyolaledenterprises/ |
| site_logo |
196094 |
/loyolaledenterprises/sitelogo/ |
| footer |
196095 |
/loyolaledenterprises/footer/ |
| Loyola Magazine |
91100 |
/loyolamagazine/ |
| About |
93384 |
/loyolamagazine/about/ |
| Contact Us |
93385 |
/loyolamagazine/about/contactus/ |
| How to receive Loyola magazine |
93417 |
/loyolamagazine/about/howtoreceiveloyolamagazine/ |
| Missed an issue? |
93418 |
/loyolamagazine/about/missedanissue/ |
| Submit a Class Note |
93419 |
/loyolamagazine/about/submitaclassnote/ |
| Past issues |
93386 |
/loyolamagazine/pastissues/ |
| Winter 2019 |
96319 |
https://www.qgdigitalpublishing.com/publication/?i=565223#{%22issue_id%22:565223,%22page%22:0} |
| Fall 2018 |
121616 |
https://www.qgdigitalpublishing.com/publication/?i=501589#{%22issue_id%22:%22530555%22,%22page%22:0} |
| Summer 2018 |
117167 |
https://www.qgdigitalpublishing.com/publication/?i=501589#{%22issue_id%22:501589,%22page%22:0} |
| Fall 2017 |
110480 |
http://content.digitalpub.blue-soho.com/web/y5b2/0A1tazz/Fall2017/html/index.html |
| Spring 2017 |
104672 |
http://content.digitalpub.blue-soho.com/web/y5b2/0A1tazz/LoyolaMagSpring2017/html/index.html |
| Winter 2017 |
100706 |
http://content.yudu.com/web/y5b2/0A1tazz/Winter2017/flash/resources/index.htm |
| Summer 2016 |
99834 |
http://content.yudu.com/web/y5b2/0A1tazz/Summer2016/flash/resources/index.htm |
| site_logo |
91103 |
/loyolamagazine/sitelogo/ |
| Loyola Mobile |
32884 |
/mobileapp/index.shtml |
| site_logo |
32890 |
/mobileapp/site_logo/ |
| Footer |
32891 |
/mobileapp/footer/ |
| Licensed Application End User License Agreement |
68727 |
/mobileapp/eula/ |
| Loyola Orientation 2024 |
195726 |
/loyolaorientation2024/ |
| Connecting to wifi |
195730 |
/loyolaorientation2024/connectingtowifi/ |
| Wolf Group |
195743 |
/loyolaorientation2024/wolfgroup/ |
| Kettle Group |
195769 |
/loyolaorientation2024/kettlegroup/ |
| Maroon Group |
195770 |
/loyolaorientation2024/maroongroup/ |
| Gold Group |
195771 |
/loyolaorientation2024/goldgroup/ |
| Families Schedule |
195774 |
/loyolaorientation2024/familiesschedule/ |
| Session Summaries |
195775 |
/loyolaorientation2024/sessionsummaries/ |
| site_logo |
195744 |
/loyolaorientation2024/sitelogo/ |
| footer |
195745 |
/loyolaorientation2024/footer/ |
| Loyola Orientation 2024 - One Day |
195978 |
/loyolaorientation2024-oneday/ |
| Wolf Group |
195979 |
/loyolaorientation2024-oneday/wolfgroup/ |
| Kettle Group |
195987 |
/loyolaorientation2024-oneday/kettlegroup/ |
| Maroon Group |
195988 |
/loyolaorientation2024-oneday/maroongroup/ |
| Gold Group |
195989 |
/loyolaorientation2024-oneday/goldgroup/ |
| Family and Guest Schedule |
195983 |
/loyolaorientation2024-oneday/familyandguestschedule/ |
| site_logo |
195981 |
/loyolaorientation2024-oneday/sitelogo/ |
| Loyola Orientation 2024 - Transfer Students |
195840 |
/loyolaorientation2024-transferstudents/ |
| Transfer Student Schedule |
195835 |
/loyolaorientation2024-transferstudents/transferstudentschedule/ |
| Family and Guest Schedule |
195845 |
/loyolaorientation2024-transferstudents/familyandguestschedule/ |
| Session Summaries |
195846 |
/loyolaorientation2024-transferstudents/sessionsummaries/ |
| Connecting to wifi |
195836 |
/loyolaorientation2024-transferstudents/connectingtowifi/ |
| site_logo |
195837 |
/loyolaorientation2024-transferstudents/sitelogo/ |
| footer |
195838 |
/loyolaorientation2024-transferstudents/footer/ |
| Loyola Orientation 2025 |
202277 |
/orientation2025-dev/ |
| First Year Commuter Schedule |
202288 |
/orientation2025-dev/firstyearcommuterschedule/ |
| 2-Day Schedule |
202289 |
/orientation2025-dev/2-dayschedule/ |
| Transfer Schedule |
202816 |
/orientation2025-dev/transferschedule/ |
| Resources |
202799 |
/orientation2025-dev/resources/ |
| Loyola Orientation 2026 |
207186 |
/loyolaorientation2026/ |
| First Year Schedules |
207216 |
/loyolaorientation2026-dev/firstyearschedules/ |
| First Year Schedule: Students |
207188 |
/loyolaorientation2026-dev/firstyearschedules/firstyearschedulestudents/ |
| First Year Schedule: Guests |
207189 |
/loyolaorientation2026-dev/firstyearschedules/firstyearscheduleguests/ |
| Commuter Schedules |
207217 |
/loyolaorientation2026-dev/commuterschedules/ |
| Schedule: Commuter Students |
207187 |
/loyolaorientation2026-dev/commuterschedules/schedulecommuterstudents/ |
| Schedule: Commuter Guests |
207214 |
/loyolaorientation2026-dev/commuterschedules/schedulecommuterguests/ |
| Transfer Schedules |
207218 |
/loyolaorientation2026-dev/transferschedules/ |
| Schedule: Transfer Students |
207194 |
/loyolaorientation2026-dev/transferschedules/scheduletransferstudents/ |
| Schedule: Transfer Guests |
207215 |
/loyolaorientation2026-dev/transferschedules/scheduletransferguests/ |
| site_logo |
207383 |
/loyolaorientation2026/sitelogo/ |
| right_column |
207468 |
/loyolaorientation2026/rightcolumn/ |
| Loyola Program Incubator |
200554 |
/incubator/ |
| site_logo |
200555 |
/incubator/sitelogo/ |
| Footer |
200556 |
/incubator/footer/ |
| cta |
200557 |
/incubator/cta/ |
| social media |
200559 |
/incubator/socialmedia/ |
| Apply |
200564 |
/incubator/apply/ |
| Proposal Development |
200565 |
/incubator/proposaldevelopment/ |
| Start-up Funds |
200566 |
/incubator/start-upfunds/ |
| Revenue Sharing |
200567 |
/incubator/revenuesharing/ |
| Oversight |
200568 |
/incubator/oversight/ |
| Loyola University School Partners |
109076 |
/schoolpartners/ |
| About |
109077 |
/schoolpartners/about/ |
| History |
126059 |
/schoolpartners/about/history/ |
| The Community Schools Model |
126060 |
/schoolpartners/about/thecommunityschoolsmodel/ |
| right_column |
109132 |
/schoolpartners/about/rightcolumn/ |
| Commitment to Social Justice |
161096 |
/schoolpartners/about/commitmenttosocialjustice/ |
| About Us |
161097 |
/schoolpartners/about/aboutus/ |
| Stories |
198633 |
/schoolpartners/about/stories/ |
| archive |
198634 |
/schoolpartners/about/stories/archive/ |
| Teacher and Student Reunion |
198637 |
/schoolpartners/about/stories/teacherandstudentreunion/ |
| Gale Entrepreneurship Summer Program |
198638 |
/schoolpartners/about/stories/galeentrepreneurshipsummerprogram/ |
| Eugene Field and New Field Future Possibilities Day |
198639 |
/schoolpartners/about/stories/eugenefieldandnewfieldfuturepossibilitiesday/ |
| Partner Schools |
125790 |
/schoolpartners/partnerschools/ |
| Joyce Kilmer Elementary School |
125789 |
/schoolpartners/partnerschools/joycekilmerelementaryschool/ |
| Eugene Field Elementary School |
125791 |
/schoolpartners/partnerschools/eugenefieldelementaryschool/ |
| New Field Primary School |
125792 |
/schoolpartners/partnerschools/newfieldprimaryschool/ |
| Nicholas Senn High School |
125794 |
/schoolpartners/partnerschools/nicholassennhighschool/ |
| DeWitt Clinton Elementary School |
125862 |
/schoolpartners/partnerschools/dewittclintonelementaryschool/ |
| Gale Community Academy |
125863 |
/schoolpartners/partnerschools/galecommunityacademy/ |
| McCutcheon Elementary School |
125866 |
/schoolpartners/partnerschools/mccutcheonelementaryschool/ |
| Roger C. Sullivan High School |
125867 |
/schoolpartners/partnerschools/rogercsullivanhighschool/ |
| right_column |
126038 |
/schoolpartners/partnerschools/rightcolumn/ |
| George W. Tilton Elementary School |
184747 |
/schoolpartners/partnerschools/georgewtiltonelementaryschool/ |
| Research |
126210 |
/schoolpartners/research/ |
| right_column |
160351 |
/schoolpartners/research/rightcolumn/ |
| Volunteer |
109078 |
/schoolpartners/volunteer/ |
| right_column |
109133 |
/schoolpartners/volunteer/rightcolumn/ |
| Program Highlights |
109080 |
/schoolpartners/programhighlights/ |
| John Slania |
109288 |
/schoolpartners/programhighlights/johnslania/ |
| right_column |
109135 |
/schoolpartners/programhighlights/rightcolumn/ |
| Donate |
109081 |
/schoolpartners/donate/ |
| right_column |
109136 |
/schoolpartners/donate/rightcolumn/ |
| Contact Us |
109082 |
/schoolpartners/contactus/ |
| right_column |
109137 |
/schoolpartners/contactus/rightcolumn/ |
| home_top |
109088 |
/schoolpartners/hometop/ |
| home_content |
109091 |
/schoolpartners/homecontent/ |
| home_left |
109090 |
/schoolpartners/homeleft/ |
| home_right |
160145 |
/schoolpartners/homeright/ |
| home_news |
160243 |
/schoolpartners/homenews/ |
| documents |
109156 |
/schoolpartners/documents/ |
| site_background |
109094 |
/schoolpartners/sitebackground/ |
| site_logo |
109092 |
/schoolpartners/sitelogo/ |
| LUC in DC |
205669 |
/dc/ |
| Discover the Program |
205670 |
/dc-dev/discovertheprogram/ |
| Curriculum & Fees |
205675 |
/dc-dev/discovertheprogram/curriculumfees/ |
| FAQs |
205685 |
/dc-dev/discovertheprogram/faqs/ |
| Your Internship Experience |
205686 |
/dc-dev/yourinternshipexperience/ |
| Faculty & Staff |
205691 |
/dc-dev/facultystaff/ |
| profiles |
205706 |
/dc-dev/facultystaff/profiles/ |
| right_column |
205707 |
/dc-dev/facultystaff/profiles/rightcolumn/ |
| Apply |
205690 |
/dc-dev/apply/ |
| Thank You |
205736 |
/dc-dev/apply/thankyou/ |
| site_logo |
205683 |
/dc-dev/sitelogo/ |
| social media |
205681 |
/dc-dev/socialmedia/ |
| modules-programming |
205694 |
/dc-dev/modules-programming/ |
| LUMA |
35740 |
/luma/ |
| site_logo |
36073 |
/luma/site_logo/ |
| social media |
199722 |
/luma/socialmedia/ |
| About LUMA |
35762 |
/luma/about/index.shtml |
| Museum Hours |
204193 |
/luma/about/museumhours/ |
| Directions & Parking |
204194 |
/luma/about/directionsparking/ |
| Mission |
36097 |
/luma/about/mission/ |
| Contact Us |
36093 |
/luma/about/contactus/ |
| Facility Rentals |
36095 |
/luma/about/facilityrentals/ |
| Current Exhibitions |
203698 |
/luma/currentexhibitions/ |
| Sr. Jean Dolores Schmidt, BVM Gallery |
203668 |
/luma/exhibitions/currentexhibitions/srjeandoloresschmidtbvmgallery/ |
| The Martin D’Arcy Gallery |
203892 |
/luma/collections/martindarcysjcollection/ |
| Tours & Programming |
204187 |
/luma/toursprogramming/ |
| The Lumanary |
206655 |
/luma/thelumanary/ |
| Past Exhibitions |
203794 |
/luma/pastexhibitions/ |
| Freedom in Form: Richard Hunt |
157319 |
/luma/exhibitions/currentexhibitions/freedominformrichardhunt/ |
| Results May Vary Student Showcase |
206654 |
/luma/pastexhibitions/resultsmayvarystudentshowcase/ |
| The Many Faces of South Shore Fine Arts Academy |
203800 |
/luma/pastexhibitions/themanyfacesofsouthshorefineartsacademy/ |
| Art & Faith of the Crèche: 20th Anniversary Celebration |
204931 |
/luma/currentexhibitions/artfaithofthecreche20thanniversarycelebration/ |
| Morton School of Excellence |
203801 |
/luma/pastexhibitions/mortonschoolofexcellence/ |
| Saint Angela School |
203802 |
/luma/pastexhibitions/saintangelaschool/ |
| Chicago International Charter School—Avalon Park Campus |
203803 |
/luma/pastexhibitions/chicagointernationalcharterschoolavalonparkcampus/ |
| The Art of Collage |
203804 |
/luma/pastexhibitions/theartofcollage/ |
| Artistic Vision/Artistic Expression |
203805 |
/luma/pastexhibitions/artisticvisionartisticexpression/ |
| The Artistic Faces of Dewey |
203806 |
/luma/pastexhibitions/theartisticfacesofdewey/ |
| Chicago Stories from the Students of the Chicago Dance Medium |
203807 |
/luma/pastexhibitions/chicagostoriesfromthestudentsofthechicagodancemedium/ |
| What Child Is This: Chicago Children and the Crèche |
203808 |
/luma/pastexhibitions/whatchildisthischicagochildrenandthecreche/ |
| Make No Little Plans: The Big Shoulders Fund Schools Plan Their Future Chicago |
203809 |
/luma/pastexhibitions/makenolittleplansthebigshouldersfundschoolsplantheirfuturechicago/ |
| Jazz Collages |
203810 |
/luma/pastexhibitions/jazzcollages/ |
| Character is Power |
203811 |
/luma/pastexhibitions/characterispower/ |
| Be a Witness |
203812 |
/luma/pastexhibitions/beawitness/ |
| disCovered |
203813 |
/luma/pastexhibitions/discovered/ |
| A Very Old Man with Enormous Wings |
203814 |
/luma/pastexhibitions/averyoldmanwithenormouswings/ |
| Spring Has Sprung |
203815 |
/luma/pastexhibitions/springhassprung/ |
| HEAVEN and HELL |
203816 |
/luma/pastexhibitions/heavenandhell/ |
| This is Home: Youth Document Life in a Nairobi Slum |
203817 |
/luma/pastexhibitions/thisishomeyouthdocumentlifeinanairobislum/ |
| The Grand Spectacle: Collages by Doug Stapleton |
203818 |
/luma/pastexhibitions/thegrandspectaclecollagesbydougstapleton/ |
| Pathways to Stable Housing |
203820 |
/luma/pastexhibitions/pathwaystostablehousing/ |
| The Hanukkah Lamp: Modernist Style and the Jewish Experience |
203821 |
/luma/pastexhibitions/thehanukkahlampmoderniststyleandthejewishexperience/ |
| Art and Faith of the Crèche: The Collection of James and Emilia Govan |
203822 |
/luma/pastexhibitions/artandfaithofthecrechethecollectionofjamesandemiliagovan/ |
| Inscribing the Divine: The Saint John's Bible |
203823 |
/luma/pastexhibitions/inscribingthedivinethesaintjohnsbible/ |
| Holiness and the Feminine Spirit: The Art of Janet McKenzie |
203824 |
/luma/pastexhibitions/holinessandthefemininespirittheartofjanetmckenzie/ |
| After the Flood: Eklavya Prasad's Photographs of Life in North Bihar, India |
203825 |
/luma/pastexhibitions/afterthefloodeklavyaprasadsphotographsoflifeinnorthbiharindia/ |
| Stories in Cloth: The Threads of Daily Life |
203826 |
/luma/pastexhibitions/storiesincloththethreadsofdailylife/ |
| Underground Chinese Catholic Community: Photographs by Lu Nan |
203827 |
/luma/pastexhibitions/undergroundchinesecatholiccommunityphotographsbylunan/ |
| De Humanum: The Collages of Balint Zsako |
203828 |
/luma/pastexhibitions/dehumanumthecollagesofbalintzsako/ |
| Eric Gill: Iconographer |
203829 |
/luma/pastexhibitions/ericgilliconographer/ |
| Benjamin Bergery: Epiphanies |
203830 |
/luma/pastexhibitions/benjaminbergeryepiphanies/ |
| Art and Faith of the Crèche: The Collection of James and Emilia Govan |
203831 |
/luma/pastexhibitions/artandfaithofthecrechethecollectionofjamesandemiliagovan/ |
| Contemporary Arabic Calligraphy by Nihad Dukhan |
203832 |
/luma/pastexhibitions/contemporaryarabiccalligraphybynihaddukhan/ |
| Pilgrimage and Faith Buddhism Christianity and Islam |
203833 |
/luma/pastexhibitions/pilgrimageandfaithbuddhismchristianityandislam/ |
| Jessica Gondek: A Decade in Print |
203834 |
/luma/pastexhibitions/jessicagondekadecadeinprint/ |
| New Icon |
203835 |
/luma/pastexhibitions/newicon/ |
| The Papercut Haggadah by Archie Granot |
203836 |
/luma/pastexhibitions/thepapercuthaggadahbyarchiegranot/ |
| Moholy: An Education of the Senses |
203837 |
/luma/pastexhibitions/moholyaneducationofthesenses/ |
| Pilgrimage and Faith: Buddhism, Christianity, and Islam |
203838 |
/luma/pastexhibitions/pilgrimageandfaithbuddhismchristianityandislam/ |
| Lost in Venice: Photographs by Sarah Hadley |
203839 |
/luma/pastexhibitions/lostinvenicephotographsbysarahhadley/ |
| Art and Faith of the Crèche: The Collection of James and Emilia Govan |
203840 |
/luma/pastexhibitions/artandfaithofthecrechethecollectionofjamesandemiliagovan/ |
| Masterpiece under the Microscope |
203841 |
/luma/pastexhibitions/masterpieceunderthemicroscope/ |
| mcmahon: vatican&chicago |
203843 |
/luma/pastexhibitions/mcmahonvaticanchicago/ |
| Paris-Chicago: The Photography of Jean-Christophe Ballot |
203844 |
/luma/pastexhibitions/paris-chicagothephotographyofjean-christopheballot/ |
| Rodin: In His Own Words Selections from the Iris and B. Gerald Cantor Foundation |
203845 |
/luma/pastexhibitions/rodininhisownwordsselectionsfromtheirisandbgeraldcantorfoundation/ |
| Ecology.Design.Synergy |
203846 |
/luma/pastexhibitions/ecologydesignsynergy/ |
| The Eternal Light of Egypt: The Photography of Sarite Sanders |
203847 |
/luma/pastexhibitions/theeternallightofegyptthephotographyofsaritesanders/ |
| Just Like Being There: A Collection of Stereo Photography |
203848 |
/luma/pastexhibitions/justlikebeingthereacollectionofstereophotography/ |
| Locking It Away: The Signs, Symbols and Secrets of Keys |
203849 |
/luma/pastexhibitions/lockingitawaythesignssymbolsandsecretsofkeys/ |
| Western Neolithic Idols: Symbols of Fertility and Life |
203850 |
/luma/pastexhibitions/westernneolithicidolssymbolsoffertilityandlife/ |
| Dreamscaping: The Therapeutic Photomontages of Nancy Gershman |
203851 |
/luma/pastexhibitions/dreamscapingthetherapeuticphotomontagesofnancygershman/ |
| Suitcase Paintings |
203853 |
/luma/pastexhibitions/suitcasepaintings/ |
| The Art of Democracy |
203854 |
/luma/pastexhibitions/theartofdemocracy/ |
| Landscapes by Photographer Gary Kolb |
203855 |
/luma/pastexhibitions/landscapesbyphotographergarykolb/ |
| …point…to line…to plane: Labanotation and Antony Tudor’s The Leaves are Fading |
203857 |
/luma/pastexhibitions/pointtolinetoplanelabanotationandantonytudorstheleavesarefading/ |
| Merce Cunningham’s RainForest |
203858 |
/luma/pastexhibitions/mercecunninghamsrainforest/ |
| Andy Warhol Print Portfolios 1971-1980 from the Bank of America Collection |
203859 |
/luma/pastexhibitions/andywarholprintportfolios1971-1980fromthebankofamericacollection/ |
| Warhol and Silver Clouds at the Factory: Nat Finkelstein’s Photography |
203860 |
/luma/pastexhibitions/warholandsilvercloudsatthefactorynatfinkelsteinsphotography/ |
| Andy Warhol's Silver Clouds |
203861 |
/luma/pastexhibitions/andywarholssilverclouds/ |
| Art and Faith of the Creche: The Collection of James and Emilia Govan |
203862 |
/luma/pastexhibitions/artandfaithofthecrechethecollectionofjamesandemiliagovan/ |
| Painting Ethiopia: The Life and Work of Qes Adamu Tesfaw |
203863 |
/luma/pastexhibitions/paintingethiopiathelifeandworkofqesadamutesfaw/ |
| On the Block: A Chicago Homage to Romare Bearden |
203864 |
/luma/pastexhibitions/ontheblockachicagohomagetoromarebearden/ |
| David Lee Csicsko: Sacred Visions in Art and Design |
203865 |
/luma/pastexhibitions/davidleecsicskosacredvisionsinartanddesign/ |
| I Remember Purim: Molly J. Schiff |
203866 |
/luma/pastexhibitions/irememberpurimmollyjschiff/ |
| A Blessing to One Another: Pope John Paul II and The Jewish People |
203867 |
/luma/pastexhibitions/ablessingtooneanotherpopejohnpauliiandthejewishpeople/ |
| Arts Botanica |
203868 |
/luma/pastexhibitions/artsbotanica/ |
| Thomas Merton |
203870 |
/luma/pastexhibitions/thomasmerton/ |
| The Missing Peace: Artists Consider the Dalai Lama |
203871 |
/luma/pastexhibitions/themissingpeaceartistsconsiderthedalailama/ |
| Loyola University Chicago Studio Art Faculty Biennial |
203872 |
/luma/pastexhibitions/loyolauniversitychicagostudioartfacultybiennial/ |
| Gods as We Shape Them |
203873 |
/luma/pastexhibitions/godsasweshapethem/ |
| Dodo Jin Ming: Land and Sea |
203874 |
/luma/pastexhibitions/dodojinminglandandsea/ |
| Living Drawings: Recent Works by Hunter O’Reilly |
203875 |
/luma/pastexhibitions/livingdrawingsrecentworksbyhunteroreilly/ |
| Arts Botanica |
203876 |
/luma/pastexhibitions/artsbotanica/ |
| Carlos Saura: Flamenco |
203877 |
/luma/pastexhibitions/carlossauraflamenco/ |
| Caravaggio Una Mostra Impossibile |
203879 |
/luma/pastexhibitions/caravaggiounamostraimpossibile/ |
| Sacred Geometry and Secular Science |
203795 |
/luma/sacred_geometry_2012.html |
| Madonna and Child with Cherubs |
203796 |
/luma/madonnaandchildwithcherubs/ |
| David & Hi-Jin Hodge: Who's Counting and Temporal State of Being |
203797 |
/luma/pastexhibitions/davidhi-jinhodgewhoscountingandtemporalstateofbeing/ |
| Santitos |
203883 |
/luma/pastexhibitions/santitos/ |
| Christmas Greetings: The Graphic Design of Melville P. Steinfels and Margaret Hollahan Steinfels |
203882 |
/luma/pastexhibitions/christmasgreetingsthegraphicdesignofmelvillepsteinfelsandmargarethollahansteinfels/ |
| Mirroring the Saints: The Jesuit Wierix Collection from De Krijtberg in Amsterdam |
203881 |
/luma/pastexhibitions/mirroringthesaintsthejesuitwierixcollectionfromdekrijtberginamsterdam/ |
| Art and Faith of the Crèche: The Collection of James and Emilia Govan |
203880 |
/luma/pastexhibitions/artandfaithofthecrechethecollectionofjamesandemiliagovan/ |
| Dewey Elementary Academy of Fine Arts |
203799 |
/luma/pastexhibitions/deweyelementaryacademyoffinearts/ |
| Graven Images: Marc Chagall's Bible Illustrations |
203885 |
/luma/pastexhibitions/gravenimagesmarcchagallsbibleillustrations/ |
| The Truth is in the Telling: Tradition and Innovation in Passover Haggadot from the Stephen P. Durchslag Collection |
203886 |
/luma/pastexhibitions/thetruthisinthetellingtraditionandinnovationinpassoverhaggadotfromthestephenpdurchslagcollection/ |
| Lewis Kostiner: Choosing Fatherhood—A Photographic Journey |
203887 |
/luma/pastexhibitions/lewiskostinerchoosingfatherhoodaphotographicjourney/ |
| Preserving the Saints |
203798 |
/luma/pastexhibitions/preservingthesaints/ |
| Saint Joseph School |
203884 |
/luma/pastexhibitions/saintjosephschool/ |
| Online Exhibitions |
203888 |
/luma/pastexhibitions/onlineexhibitions/ |
| Preserving the Saints |
203889 |
/luma/pastexhibitions/onlineexhibitions/preservingthesaints/ |
| A Portrait in Search of an Identity |
203891 |
/luma/pastexhibitions/onlineexhibitions/aportraitinsearchofanidentity/ |
| Masterpiece under the Microscope |
203890 |
/luma/pastexhibitions/onlineexhibitions/masterpieceunderthemicroscope/ |
| Collections |
35943 |
/luma/collections/index.shtml |
| LUMA Collection |
36116 |
/luma/collections/lumacollection/ |
| Andar Com Fe |
36821 |
/luma/collections/lumacollection/andarcomfe/ |
| Neolithic Idols |
36869 |
/luma/collections/lumacollection/neolithicidols/ |
| Drawings for the Bible—Job in Despair |
36870 |
/luma/collections/lumacollection/drawingsforthebiblejobindespair/ |
| Retablo |
36871 |
/luma/collections/lumacollection/retablo/ |
| Dharmakaya |
70803 |
/luma/collections/lumacollection/dharmakaya/ |
| Untitled |
70804 |
/luma/collections/lumacollection/untitled/ |
| Martin D'Arcy, S.J. Collection |
36117 |
/luma/collections/martindarcysjcollection/ |
| Collector’s Chest |
36198 |
/luma/collections/martindarcysjcollection/collectorschest/ |
| A Jesuit Saint: San Francisco de Borja |
36199 |
/luma/collections/martindarcysjcollection/ajesuitsaintsanfranciscodeborja/ |
| Madonna and Child with Cherubs |
36201 |
/luma/collections/martindarcysjcollection/madonnaandchildwithcherubs/ |
| Scenes from the Legend of David and Goliath |
36202 |
/luma/collections/martindarcysjcollection/scenesfromthelegendofdavidandgoliath/ |
| The Assurance to Joseph |
36207 |
/luma/collections/martindarcysjcollection/theassurancetojoseph/ |
| The Annunciation |
36208 |
/luma/collections/martindarcysjcollection/theannunciation/ |
| St. Jerome |
36209 |
/luma/collections/martindarcysjcollection/stjerome/ |
| The Flagellation of Christ |
36210 |
/luma/collections/martindarcysjcollection/theflagellationofchrist/ |
| Christ Among the Doctors |
36211 |
/luma/collections/martindarcysjcollection/christamongthedoctors/ |
| The Adoration of the Magi |
36212 |
/luma/collections/martindarcysjcollection/theadorationofthemagi/ |
| Madonna and Child with Saint John the Baptist |
36213 |
/luma/collections/martindarcysjcollection/madonnaandchildwithsaintjohnthebaptist/ |
| The Rest on the Flight into Egypt |
36214 |
/luma/collections/martindarcysjcollection/therestontheflightintoegypt/ |
| Reliquary Châsse |
36215 |
/luma/collections/martindarcysjcollection/reliquarychasse/ |
| Elephant Automaton Clock |
36216 |
/luma/collections/martindarcysjcollection/elephantautomatonclock/ |
| The Way to Calvary |
36217 |
/luma/collections/martindarcysjcollection/thewaytocalvary/ |
| Ecce Homo |
36219 |
/luma/collections/martindarcysjcollection/eccehomo/ |
| Double-bit Key |
36220 |
/luma/collections/martindarcysjcollection/double-bitkey/ |
| Lioness Key |
36221 |
/luma/collections/martindarcysjcollection/lionesskey/ |
| Windows of Faith |
66763 |
/luma/collections/windowsoffaith/ |
| The James and Emilia Govan Crèche Collection |
72707 |
/luma/collections/thejamesandemiliagovancrechecollection/ |
| Advent Calendar: Day 1 |
72708 |
/luma/collections/thejamesandemiliagovancrechecollection/adventcalendarday1/ |
| Drawings for the Bible—Job in Despair |
72710 |
/luma/collections/thejamesandemiliagovancrechecollection/drawingsforthebiblejobindespair/ |
| Retablo |
72709 |
/luma/collections/thejamesandemiliagovancrechecollection/retablo/ |
| Dharmakaya |
72713 |
/luma/collections/thejamesandemiliagovancrechecollection/dharmakaya/ |
| Untitled |
72712 |
/luma/collections/thejamesandemiliagovancrechecollection/untitled/ |
| New Acquisitions |
93821 |
/luma/collections/collections_acquisition.html |
| A Present for LUMA |
88544 |
/luma/collections/newacquisitions/apresentforluma/ |
| DSD Areas |
186657 |
/luma/dsdareas/ |
| Campus Recreation |
186658 |
/campusrec/ |
| Campus Reservations |
186659 |
/campus_reservations/ |
| Community Coalition on Gender-Based Violence |
186663 |
/coalition/ |
| Conference Services |
186664 |
/conference/index.shtml |
| CTA U-Pass |
186665 |
/upass/ |
| Damen Student Center |
186667 |
/damenstudentcenter/index.shtml |
| Family Weekend |
186669 |
/familyweekend/ |
| Graduate, Professional, and Adult Student Life |
186670 |
/gpasl/ |
| Loyola University Museum of Art |
186671 |
/luma/ |
| Office of Student Conduct and Conflict Resolution |
186672 |
/osccr/ |
| Student Government |
186674 |
/sglc/ |
| Terry Student Center |
186675 |
/tsc/ |
| Wellness Center |
186677 |
/wellness/ |
| footer |
59187 |
/luma/footer/ |
| modules-programming |
205340 |
/luma/modules-programming/ |
| Madonna della Strada Weddings |
14652 |
/mdsweddings/ |
| site_logo |
14736 |
/mdsweddings/sitelogo/ |
| Footer |
14739 |
/mdsweddings/footer/ |
| modules-programming |
200866 |
/mdsweddings/modules-programming/ |
| Contact Us |
14654 |
/mdsweddings/contact_us.shtml |
| right_column |
58845 |
/mdsweddings/contactus/rightcolumn/ |
| Marriage Prep |
14716 |
/mdsweddings/marriage_prep/marriage_prep.shtml |
| right_column |
58844 |
/mdsweddings/marriage_prep/rightcolumn/ |
| Music and Liturgy Planner |
14721 |
/mdsweddings/music-liturgy/ |
| Music |
14657 |
/mdsweddings/music-liturgy/music/ |
| Psalm 128 |
14686 |
/mdsweddings/music/psalm128chepponis.html |
| World Marriage Day |
185602 |
/mdsweddings/worldmarriageday/ |
| Thank You |
14719 |
/mdsweddings/thankyou.shtml |
| Documents |
71470 |
/mdsweddings/documents/ |
| Maroon & Gold Standards of Excellence |
24040 |
/standards/index.shtml |
| Benefits |
24041 |
/standards/benefits.shtml |
| Feedback Form |
24042 |
/standards/feedback_form.shtml |
| Thank You |
89795 |
/standards/feedbackform/thankyou/ |
| Five Standards |
24043 |
/standards/standards.shtml |
| How to Enroll |
51840 |
/standards/howtoenroll/ |
| Footer |
24211 |
/standards/footer/ |
| site_logo |
24210 |
/standards/site_logo/ |
| cta |
201915 |
/standards/cta/ |
| social media |
201916 |
/standards/socialmedia/ |
| Mathematics and Statistics |
17821 |
/math/ |
| site_logo |
198867 |
/math/sitelogo/ |
| cta |
198871 |
/math/cta/ |
| social media |
198870 |
/math/socialmedia/ |
| modules-programming |
198872 |
/math/modules-programming/ |
| About Us |
17822 |
/math/about.shtml |
| Contact Us |
17823 |
/math/contactus.shtml |
| Faculty Research |
198875 |
/math/facultyresearch/ |
| Faculty & Staff |
17825 |
/math/facstaff.shtml |
| Profiles |
198876 |
/math/profiles/ |
| right_column |
198877 |
/math/profiles/rightcolumn/ |
| Women in Math & Stat |
61922 |
/math/women-math-stat/ |
| LUC Math & Stats Club |
17828 |
/math/mathclub.shtml |
| LUC AWM Student Chapter |
184854 |
/math/lucawmstudentchapter/ |
| LUC SIAM Student Chapter |
197603 |
/math/lucsiamstudentchapter/ |
| Loyola Data Science Club |
198248 |
/math/loyoladatascienceclub/ |
| Math and Stats Student Spotlight |
202089 |
/math/mathandstatsstudentspotlight/ |
| Open Positions |
56753 |
/math/facultyjobs.shtml |
| Alumni Newsletters |
187141 |
/math/alumninewsletters/ |
| Location |
17827 |
/math/location.shtml |
| Academics |
17834 |
/math/academics.shtml |
| Courses |
17845 |
/math/courses.shtml |
| Course Grid |
37811 |
/math/course-grid.shtml |
| Course Catalog |
198899 |
https://catalog.luc.edu/undergraduate/arts-sciences/mathematics-statistics/ |
| Undergraduate Programs |
204158 |
https://catalog.luc.edu/undergraduate/arts-sciences/mathematics-statistics/#academicstext |
| Graduate Programs |
17846 |
/math/gradprogs.shtml |
| MS in Data Science |
185722 |
https://gpem.luc.edu/portal/program?name=datasciencems |
| MS in Mathematics |
185723 |
https://gpem.luc.edu/portal/program?name=mathematicsms |
| MS in Applied Statistics |
185724 |
https://gpem.luc.edu/portal/program?name=appliedstatisticsms |
| Applied Statistics Admission FAQs |
123337 |
/math/appliedstatisticsadmissionfaqs/ |
| Applied Statistics Curriculum FAQs |
123341 |
/math/appliedstatisticscurriculumfaqs/ |
| Outcomes | Jobs with Statistics Degree from Loyola |
123342 |
/math/outcomesjobswithstatisticsdegreefromloyola/ |
| Job Placement |
123343 |
/math/outcomesjobswithstatisticsdegreefromloyola/jobplacement/ |
| Graduate Research |
123344 |
/math/outcomesjobswithstatisticsdegreefromloyola/graduateresearch/ |
| Alumni Profiles |
68958 |
/math/outcomesjobswithstatisticsdegreefromloyola/alumniprofiles/ |
| What Does an Applied Degree Mean in the Job Market? |
68960 |
/math/outcomesjobswithstatisticsdegreefromloyola/alumniprofiles/whatdoesanapplieddegreemeaninthejobmarket/ |
| Real Outcomes |
68963 |
/math/outcomesjobswithstatisticsdegreefromloyola/alumniprofiles/realoutcomes/ |
| right_column |
123345 |
/math/outcomesjobswithstatisticsdegreefromloyola/rightcolumn/ |
| Combined BS/MS Programs |
17844 |
/math/bsmsprogs.shtml |
| BS/MS Program in Mathematics |
17842 |
/math/bsmsmath/ |
| Overview |
69547 |
/math/bsmsmath/ |
| overview2022 |
181970 |
/math/bsmsmath/overview2022/ |
| BS/MS Program in Applied Statistics |
17843 |
/math/bsmsstats/ |
| Overview |
69552 |
/math/bsmsstats/ |
| Department Policies |
17892 |
/math/dept-policies.shtml |
| Honors and Awards |
192462 |
/math/honorsandawards/ |
| Past Award Winners |
207178 |
/math/pastawardwinners/ |
| Admission |
17859 |
/math/admission.shtml |
| Financial Aid |
37623 |
http://www.luc.edu/finaid/ |
| Graduate |
37624 |
/math/gradprogs.shtml |
| Undergraduate |
37625 |
http://www.luc.edu/undergrad/ |
| Resources |
17884 |
/math/resources.shtml |
| Statistics Resources |
17855 |
/math/stats-resources.shtml |
| Coordinated Course Resources |
199367 |
/math/coordinatedcourseresources/ |
| MATH 100: Intermediate Algebra |
199870 |
/math/academics/courses/math100/ |
| MATH 110: Business Precalculus |
200996 |
/math/coordinatedcourseresources/math110businessprecalculus/ |
| MATH 117: Precalculus I |
199193 |
/math/academics/courses/math117/ |
| MATH 117 Past final exams |
206893 |
/math/academics/courses/math117/math117pastfinalexams/ |
| MATH 118: Precalculus II |
199194 |
/math/academics/courses/math118/ |
| MATH 118 Past final exams |
206894 |
/math/academics/courses/math118/math118pastfinalexams/ |
| MATH 130: Business Calculus |
200998 |
/math/coordinatedcourseresources/math130businesscalculus/ |
| MATH 131: Applied Calculus I |
199195 |
/math/academics/courses/math131/ |
| MATH 131 Past final exams |
205426 |
/math/academics/courses/math131/math131pastfinalexams/ |
| MATH 132: Applied Calculus II |
199871 |
/math/academics/courses/math132/ |
| MATH 161: Calculus I |
199197 |
/math/academics/courses/math161/ |
| MATH 162: Calculus II |
199872 |
/math/academics/courses/math162/ |
| STAT 103: Fundamentals of Statistics |
199873 |
/math/academics/courses/stat103/ |
| Tutoring |
38194 |
/math/tutoring.shtml |
| Colloquia, Lectures & Seminars |
17880 |
/math/Colloquium.shtml |
| Math/Stat Colloquium |
42489 |
/math/ucms/ |
| Teaching Seminar |
54341 |
/math/teach/ |
| AMS Fall Central Section Meeting |
75923 |
/math/amsfallmeeting/ |
| Erdős Memorial Lecture |
87253 |
/math/amsfallmeeting/erdoslecture/ |
| Problem of the Month |
180221 |
/math/problemofthemonth/ |
| 2024-2025 PROBLEM OF THE MONTH WINNERS |
204637 |
/math/problemofthemonth/2024-2025problemofthemonthwinners/ |
| 2023-2024 PROBLEM OF THE MONTH WINNERS |
198212 |
/math/problemofthemonth/2023-2024problemofthemonthwinners/ |
| 2022-2023 PROBLEM OF THE MONTH WINNERS |
188900 |
/math/problemofthemonth/2022-2023problemofthemonthwinners/ |
| Placement |
74184 |
/math/placement/ |
| Majors Requiring Math |
76067 |
/math/placement/majorsrequiringmath/ |
| Majors Requiring Math_old |
74509 |
/math/placement/majorsrequiringmathold/ |
| MPA Password and Instructions |
206590 |
/math/placement/mpapasswordandinstructions/ |
| Careers & Internships |
42979 |
/math/careers.shtml |
| Overview |
79711 |
/math/careers.shtml |
| Career Profiles |
78417 |
/math/careersinternships/careerprofiles/ |
| Paul Bell |
80036 |
/math/careersinternships/careerprofiles/paulbell/ |
| Sara Ring |
80037 |
/math/careersinternships/careerprofiles/sararing/ |
| Matthew Willms |
80038 |
/math/careersinternships/careerprofiles/matthewwillms/ |
| Anne McCauley |
88034 |
/math/careersinternships/careerprofiles/annemccauley/ |
| Kay Wakeman |
89998 |
/math/careersinternships/careerprofiles/kaywakeman/ |
| Vincent Visuth |
106054 |
/math/careersinternships/careerprofiles/vincentvisuth/ |
| Summer Opportunities |
78419 |
/math/careersinternships/summeropportunities/ |
| Career Resources |
78420 |
/math/careersinternships/careerresources/ |
| Scholarships & Opportunities |
106533 |
/math/scholarshipsopportunities/ |
| Calculus Information |
30785 |
/math/calculusinformation/ |
| Sample math placement questions |
17894 |
/math/mathplacement-sample.shtml |
| Student Organizations |
17898 |
/math/studactiv.shtml |
| WebWork |
17902 |
/math/webwork.shtml |
| Academic Grievances |
17885 |
/math/grievance.shtml |
| DataFest |
123351 |
https://www.luc.edu/datascience/events/datafest/ |
| Outreach |
75367 |
/math/outreach/ |
| Math Teacher's Circle |
75695 |
/math/outreach/ |
| Research |
17831 |
/math/research.shtml |
| Faculty Research |
123628 |
/math/facultyresearch/ |
| Colloquia, Lectures & Seminars |
180663 |
https://www.luc.edu/math/Colloquium.shtml |
| LUROP Portal |
123629 |
/celts/programs/undergraduateresearch/ |
| REU Portal |
166521 |
https://www.nsf.gov/crssprgm/reu/list_result.jsp?unitid=5044 |
| News |
29905 |
/math/news/ |
| Stories |
84996 |
/math/stories/ |
| archive |
84997 |
/math/stories/archive/ |
| AY 25-26 |
204229 |
/math/stories/ay25-26/ |
| archive |
204230 |
/math/stories/ay25-26/archive/ |
| Congratulations to our 2026 Graduates |
207174 |
/math/stories/ay25-26/congratulationstoour2026graduates/ |
| Mathematics and Statistics Colloquium (Apr 16) |
206779 |
/math/stories/ay25-26/mathematicsandstatisticscolloquiumapr16/ |
| Symme-Tri-Dye |
206716 |
/math/stories/ay25-26/symme-tri-dye/ |
| Mathematics and Statistics Colloquium (Mar 26) |
206591 |
/math/stories/ay25-26/mathematicsandstatisticscolloquiummar26/ |
| Pi-e Day Celebration (Mar 13) |
206536 |
/math/stories/ay25-26/pi-edaycelebrationmar13/ |
| Mathematics and Statistics Colloquium (Feb 26) |
206146 |
/math/stories/ay25-26/mathematicsandstatisticscolloquiumfeb26/ |
| Math In Industry (Jan 22) |
205916 |
/math/stories/ay25-26/mathinindustryjan22/ |
| Mathematics and Statistics Colloquium (Nov 6) |
204726 |
/math/stories/ay25-26/mathematicsandstatisticscolloquiumnov6/ |
| Mathematics and Statistics Colloquium (Oct 30) |
204363 |
/math/stories/ay25-26/mathematicsandstatisticscolloquiumoct30/ |
| Students Present at Great Lakes SIAM Conference |
204490 |
/math/stories/ay25-26/studentspresentatgreatlakessiamconference/ |
| Math and Stats Student Colloquium (Oct 2) |
204451 |
/math/stories/ay25-26/mathandstatsstudentcolloquiumoct2/ |
| Mathematics and Statistics Colloquium (Sep 25) |
204332 |
/math/stories/ay25-26/mathematicsandstatisticscolloquiumsep25/ |
| Math and Stats Student Colloquium (Sep 11) |
204237 |
/math/stories/ay25-26/mathandstatsstudentcolloquiumsep11/ |
| AY 24-25 |
198190 |
/math/stories/ay24-25/ |
| archive |
198191 |
/math/stories/ay24-25/archive/ |
| Five Math and Stats Professors Receive Awards |
203189 |
/math/stories/ay24-25/fivemathandstatsprofessorsreceiveawards/ |
| Congratulations to our graduates! |
202906 |
/math/stories/ay24-25/congratulationstoourgraduates/ |
| Department of Mathematics and Statistics Colloquium (Apr 10) |
202296 |
/math/stories/ay24-25/departmentofmathematicsandstatisticscolloquiumapr10/ |
| Department of Mathematics and Statistics Colloquium (Apr 3) |
202238 |
/math/stories/ay24-25/departmentofmathematicsandstatisticscolloquiumapr3/ |
| Seminar with Dr. Zeyu Zhou |
202196 |
/math/stories/ay24-25/seminarwithdrzeyuzhou/ |
| Pi Day Celebration |
201927 |
/math/stories/ay24-25/pidaycelebration/ |
| Department of Mathematics and Statistics Colloquium (Mar 20) |
201910 |
/math/stories/ay24-25/departmentofmathematicsandstatisticscolloquiummar20/ |
| Department of Mathematics and Statistics Colloquium (Nov 21) |
199865 |
/math/stories/ay24-25/departmentofmathematicsandstatisticscolloquiumnov21/ |
| Mathematics and Statistics Colloquium (Oct 17) |
198757 |
/math/stories/ay24-25/mathematicsandstatisticscolloquiumoct17/ |
| SIAM Informational Meeting |
198914 |
/math/stories/ay24-25/siaminformationalmeeting/ |
| Undergraduate Research Colloquium (Sep 26) |
198719 |
/math/stories/ay24-25/undergraduateresearchcolloquiumsep26/ |
| Undergrad Summer Research Workshop |
198563 |
/math/stories/ay24-25/undergradsummerresearchworkshop/ |
| Math and Magic |
198519 |
/math/stories/ay24-25/mathandmagic/ |
| Special Seminar (Sep 17) |
198499 |
/math/stories/ay24-25/specialseminarsep17/ |
| Undergraduate Research Colloquium (Sep 12) |
198450 |
/math/stories/ay24-25/undergraduateresearchcolloquiumsep12/ |
| Xiang Wan Awarded NSF LEAPS Grant |
198211 |
/math/stories/ay24-25/xiangwanawardednsfleapsgrant/ |
| Two Math Professors Awarded AMS-Simons Travel Grants |
198193 |
/math/stories/ay24-25/twomathprofessorsawardedams-simonstravelgrants/ |
| AY 23-24 |
191456 |
/math/stories/ay23-24/ |
| archive |
191457 |
/math/stories/ay23-24/archive/ |
| RPSAA 2024 |
196098 |
/math/stories/ay23-24/rpsaa2024/ |
| Mathematics and Statistics Student Awards and Honors |
194769 |
/math/stories/ay23-24/mathematicsandstatisticsstudentawardsandhonors/ |
| Mathematics and Statistics Colloquium (April 18) |
193794 |
/math/stories/ay23-24/mathematicsandstatisticscolloquiumapril18/ |
| Chicago Symposium Series, Excellence in Teaching Mathematics and Science |
192451 |
/math/stories/ay23-24/chicagosymposiumseriesexcellenceinteachingmathematicsandscience/ |
| Mathematics and Statistics Colloquium (April 11) |
192450 |
/math/stories/ay23-24/mathematicsandstatisticscolloquiumapril11/ |
| DEI Movie and Discussion |
192162 |
/math/stories/ay23-24/deimovieanddiscussion/ |
| Tim O'Brien Awarded Honorary Degree in Thailand |
191662 |
/math/stories/ay23-24/timobrienawardedhonorarydegreeinthailand/ |
| Joint Data Science and Math & Stat Colloquium |
191590 |
/math/stories/ay23-24/jointdatascienceandmathstatcolloquium/ |
| AY 23-24 PC |
188261 |
/math/stories/ay23-24pc/ |
| archive |
188262 |
/math/stories/ay23-24pc/archive/ |
| Association of Women in Mathematics Colloquium (Jan 29) |
191261 |
/math/stories/ay23-24pc/associationofwomeninmathematicscolloquiumjan29/ |
| Mathematics and Statisitcs Colloquium (Dec 7) |
190202 |
/math/stories/ay23-24pc/mathematicsandstatisitcscolloquiumdec7/ |
| Mathematics and Statisitcs Colloquium (Nov 16) |
189804 |
/math/stories/ay23-24pc/mathematicsandstatisitcscolloquiumnov16/ |
| Mathematics and Statistics Colloquium (Nov 7) |
189695 |
/math/stories/ay23-24pc/mathematicsandstatisticscolloquiumnov7/ |
| Mathematics and Statistics Colloquium (Oct 12) |
181051 |
/math/stories/ay23-24pc/mathematicsandstatisticscolloquiumoct12/ |
| AY 22-23 |
177852 |
/math/stories/ay22-23/ |
| archive |
177853 |
/math/stories/ay22-23/archive/ |
| Mathematics and Statistics Club (2022-2023): Year in Review |
185648 |
/math/stories/ay22-23/mathematicsandstatisticsclub2022-2023yearinreview/ |
| Congratulations to our 2023 Graduates! |
185591 |
/math/stories/ay22-23/congratulationstoour2023graduates/ |
| Alec Krueger Named a Sujack Master Teacher |
185507 |
/math/stories/ay22-23/aleckruegernamedasujackmasterteacher/ |
| Mathematics and Statistics Colloquium (April 20) |
185363 |
/math/stories/ay22-23/mathematicsandstatisticscolloquiumapril20/ |
| Kate Bove Wins Undergraduate Leadership Award |
184758 |
/math/stories/ay22-23/katebovewinsundergraduateleadershipaward/ |
| Pi Day 2023 |
184734 |
/math/stories/ay22-23/piday2023/ |
| Love is in the Square |
183695 |
/math/stories/ay22-23/loveisinthesquare/ |
| Mathematics and Statistics Colloquium (Dec 1) |
182021 |
/math/stories/ay22-23/mathematicsandstatisticscolloquiumdec1/ |
| Kiet Anh Nguyen Wins President's Medallion |
181768 |
/math/stories/ay22-23/kietanhnguyenwinspresidentsmedallion/ |
| Mathematics and Statistics Colloquium (Nov 17) |
181788 |
/math/stories/ay22-23/mathematicsandstatisticscolloquiumnov17/ |
| Applied Statistics Career Night |
181690 |
/math/stories/ay22-23/appliedstatisticscareernight/ |
| Connecting Women in STEM |
181377 |
/math/stories/ay22-23/connectingwomeninstem/ |
| Symme-Tri-Dye Event |
180581 |
/math/stories/ay22-23/symme-tri-dyeevent/ |
| AY 21-22 |
177850 |
/math/stories/ay21-22/ |
| archive |
177851 |
/math/stories/ay21-22/archive/ |
| AY 20-21 |
177289 |
/math/stories/ay20-21/ |
| archive |
177290 |
/math/stories/ay20-21/archive/ |
| AY 19-20 |
124534 |
/math/stories/ay19-20/ |
| archive |
124535 |
/math/stories/ay19-20/archive/ |
| AY 18-19 |
121142 |
/math/stories/ay18-19/ |
| archive |
121143 |
/math/stories/ay18-19/archive/ |
| AY 17-18 |
109100 |
/math/stories/ay17-18/ |
| archive |
109101 |
/math/stories/ay17-18/archive/ |
| AY 16-17 |
106089 |
/math/stories/ay16-17/ |
| archive |
106090 |
/math/stories/ay16-17/archive/ |
| 2012 and Previous |
88975 |
/math/stories/2012andprevious/ |
| Introduction to WebWork for Students |
17873 |
/math/webworkinfo.shtml |
| Registering Your Course on Webwork |
17882 |
/math/webworkregistration.shtml |
| WebWork Demo |
17905 |
/math/webworkdemo.shtml |
| Webwork Documentation for Instructors |
17906 |
/math/webworkInstructor.shtml |
| WebWork: Entering Answers |
17907 |
/math/webworkanswers.shtml |
| WebWork Frequently Asked Questions |
17908 |
/math/webworkfaq.shtml |
| Guidelines for Using ASCIIto Write Mathematics |
17912 |
/math/webworkwrite.shtml |
| Rataj Lecture: Kenneth Ribet |
101601 |
/math/ratajlecturekennethribet/ |
| amsmeeting |
86823 |
/math/amsmeeting/ |
| wireless_access |
198902 |
https://www.luc.edu/media/lucedu/math/docs/Bradford%20Wireless%20Access.pdf |
| McNamara Center |
26344 |
/mcnamaracenter/index.shtml |
| The Center |
26289 |
/mcnamaracenter/about.shtml |
| About Us |
26290 |
/mcnamaracenter/about.shtml |
| Contact Us |
26291 |
/mcnamaracenter/about_contactus.shtml |
| Director's Welcome |
26292 |
/mcnamaracenter/about_welcomemsg.shtml |
| McNamara Lectures |
26293 |
/mcnamaracenter/about_lectures.shtml |
| Ross P. Scherer Memorial Library |
26294 |
/mcnamaracenter/about_library.shtml |
| CAGSRC |
26270 |
/mcnamaracenter/cagsrc.shtml |
| 2013-2014 Academic Year Calendar |
37020 |
/mcnamaracenter/2013-2014academicyearcalendar/ |
| CAGSRC Working Papers |
26272 |
/mcnamaracenter/cagsrc_workingpapers.shtml |
| Prior CAGSRC Presentations |
26273 |
/mcnamaracenter/cagsrc_priorpresentations.shtml |
| 2010-2011 Academic Year Calendar |
26271 |
/mcnamaracenter/cagsrc_calendar.shtml |
| McNamara Research |
26274 |
/mcnamaracenter/mcnamara_research.shtml |
| Sociology of Religion Working Group |
26275 |
/mcnamaracenter/research_workinggrp.shtml |
| Working Group Semester Schedule |
26276 |
/mcnamaracenter/research_semschedule.shtml |
| Working Papers |
26277 |
/mcnamaracenter/research_workingpapers.shtml |
| Department News & Events |
62076 |
/mcnamaracenter/departmentnewsevents/ |
| Robert McNamara Award |
99322 |
/mcnamaracenter/robertmcnamaraaward/ |
| Relevant Outside Sources |
26285 |
/mcnamaracenter/relevantcenters_data.html |
| Associations for the Social Study of Religions |
26286 |
/mcnamaracenter/relevantsources_assoc.html |
| Centers for the Social Study of Religion |
26287 |
/mcnamaracenter/relevantsources_centers.html |
| Data Sources |
26288 |
/mcnamaracenter/relevantcenters_data.html |
| Footer |
26355 |
/mcnamaracenter/footer/ |
| site_logo |
26356 |
/mcnamaracenter/sitelogo/ |
| social media |
204458 |
/mcnamaracenter/socialmedia/ |
| cta |
204459 |
/mcnamaracenter/cta/ |
| Medieval Studies |
13010 |
/medieval/index.shtml |
| The Minor |
13045 |
/medieval/theminor/ |
| History of Medieval Studies at Loyola |
91071 |
/medieval/theminor/historyofmedievalstudiesatloyola/ |
| Faculty |
13047 |
/medieval/facultystaff.shtml |
| Lecture series |
13048 |
/medieval/lecture_series.shtml |
| Resources |
13050 |
/medieval/resources.shtml |
| News |
94453 |
/medieval/stories/ |
| archive |
94454 |
/medieval/stories/archive/ |
| Internship |
91072 |
/medieval/internship/ |
| Contact Us |
13046 |
/medieval/contact.shtml |
| Footer |
13464 |
/medieval/footer/ |
| site_logo |
13465 |
/medieval/sitelogo/ |
| What's New in Medieval Studies? |
188026 |
/medieval/whatsnewinmedievalstudies/ |
| cta |
200612 |
/medieval/cta/ |
| social media |
200614 |
/medieval/socialmedia/ |
| modules-programming |
200615 |
/medieval/modules-programming/ |
| Mentor a CS/IT Student |
124782 |
/cspacmentoringprogram/ |
| Home |
124833 |
/cspacmentoringprogram/home/ |
| CS/IT Student Home |
124839 |
/cspacmentoringprogram/ |
| About the Program |
124816 |
/cspacmentoringprogram/abouttheprogram/ |
| Program Overview |
124812 |
/cspacmentoringprogram/abouttheprogram/programoverview/ |
| Program FAQs |
124818 |
/cspacmentoringprogram/programfaqs/ |
| Frequently Asked Questions |
124810 |
/cspacmentoringprogram/programfaqs/frequentlyaskedquestions/ |
| Become a Mentee |
124829 |
/cspacmentoringprogram/becomeamentee/ |
| Mentee Application |
124830 |
/cspacmentoringprogram/becomeamentee/menteeapplication/ |
| Become a Mentor |
124831 |
/cspacmentoringprogram/becomeamentor/ |
| Mentor Application |
124832 |
/cspacmentoringprogram/becomeamentor/mentorapplication/ |
| hero |
124784 |
/cspacmentoringprogram/hero/ |
| custom_css |
124787 |
/cspacmentoringprogram/customcss/ |
| custom_js |
124788 |
/cspacmentoringprogram/customjs/ |
| footer |
124793 |
/cspacmentoringprogram/footer/ |
| site_logo |
124794 |
/cspacmentoringprogram/sitelogo/ |
| Middle East and Islamic World Studies Minor |
17178 |
/middleeaststudies/ |
| About |
200580 |
/middleeaststudies/about/ |
| Contact Us |
17174 |
/middleeaststudies/about/contactus/ |
| Faculty |
17177 |
/middleeaststudies/about/faculty/ |
| Academics |
200581 |
/middleeaststudies/academics/ |
| Course Offerings |
17175 |
/middleeaststudies/academics/courseofferings/ |
| Requirements |
17179 |
/middleeaststudies/academics/requirements/ |
| Outcomes |
108914 |
/middleeaststudies/outcomes/ |
| Events |
17176 |
/middleeaststudies/events/ |
| site_logo |
17181 |
/middleeaststudies/site_logo/ |
| Footer |
17184 |
/middleeaststudies/footer/ |
| Midwest Modern Language Association |
73321 |
/mmla/ |
| custom_css |
73356 |
/mmla/customcss/ |
| site_logo |
73357 |
/mmla/sitelogo/ |
| site_background |
73352 |
/mmla/sitebackground/ |
| home_center |
73332 |
/mmla/homecenter/ |
| home_content |
73334 |
/mmla/homecontent/ |
| home_left |
73333 |
/mmla/homeleft/ |
| home_right |
73335 |
/mmla/homeright/ |
| About Us |
73344 |
/mmla/aboutus/ |
| Leadership |
73345 |
/mmla/aboutus/leadership/ |
| MLA and Regional Affiliates |
73348 |
/mmla/aboutus/mlaandregionalaffiliates/ |
| Contact Us |
73351 |
/mmla/aboutus/contactus/ |
| Equity and Inclusion |
191600 |
/mmla/aboutus/equityandinclusion/ |
| Convention |
73353 |
/mmla/convention/ |
| Past Conventions |
73366 |
/mmla/convention/pastconventions/ |
| Future Convention Plans |
73367 |
/mmla/convention/futureconventionplans/ |
| Journal |
73368 |
/mmla/journal/ |
| Submission Guidelines |
73370 |
/mmla/journal/submissionguidelines/ |
| Subscriptions & Advertisements |
73377 |
/mmla/journal/subscriptionsadvertisements/ |
| Published Issues |
73375 |
/mmla/journal/publishedissues/ |
| JMMLA Editorial Board |
191601 |
/mmla/journal/jmmlaeditorialboard/ |
| right_column |
160444 |
/mmla/journal/rightcolumn/ |
| Membership |
73379 |
/mmla/membership/ |
| MMLA Short-Term Fellowship at the Newberry Library |
73384 |
/mmla/mmlashort-termfellowshipatthenewberrylibrary/ |
| 2014 Fellowship Recipient |
73385 |
/mmla/mmlashort-termfellowshipatthenewberrylibrary/2014fellowshiprecipient/ |
| 2015 Fellowship Recipient |
90764 |
/mmla/mmlashort-termfellowshipatthenewberrylibrary/2015fellowshiprecipient/ |
| 2016 Fellowship Recipient |
93353 |
/mmla/mmlashort-termfellowshipatthenewberrylibrary/2016fellowshiprecipient/ |
| 2017 Fellowship Recipient |
103076 |
/mmla/mmlashort-termfellowshipatthenewberrylibrary/2017fellowshiprecipient/ |
| 2018 Fellowship Recipient |
126946 |
/mmla/mmlashort-termfellowshipatthenewberrylibrary/2018fellowshiprecipient/ |
| 2019 Fellowship Recipient |
126945 |
/mmla/mmlashort-termfellowshipatthenewberrylibrary/2019fellowshiprecipient/ |
| 2020 Fellowship Recipient |
157605 |
/mmla/mmlashort-termfellowshipatthenewberrylibrary/2020fellowshiprecipient/ |
| 2021 Fellowship Recipient |
187303 |
/mmla/mmlashort-termfellowshipatthenewberrylibrary/2021fellowshiprecipient/ |
| 2022 Fellowship Recipient |
187304 |
/mmla/mmlashort-termfellowshipatthenewberrylibrary/2022fellowshiprecipient/ |
| 2023 Fellowship Recipient |
187305 |
/mmla/mmlashort-termfellowshipatthenewberrylibrary/2023fellowshiprecipient/ |
| Member Portal |
187404 |
https://www.midwest-mla.org |
| Military |
188982 |
/military/ |
| site_logo |
188984 |
/military/sitelogo/ |
| Military Veteran Student Services |
69825 |
/veterans/ |
| About MVSS |
70532 |
/veterans/aboutmvss/ |
| Mission and Goals |
70554 |
/veterans/aboutmvss/missionandgoals/ |
| Meet the MVSS Staff |
70555 |
/veterans/aboutmvss/meetthemvssstaff/ |
| Location and Office Hours |
70556 |
/veterans/aboutmvss/locationandofficehours/ |
| Contact Us |
70557 |
/veterans/aboutmvss/contactus/ |
| Veterans Advisory Council (VAC) |
201357 |
/veterans/aboutmvss/veteransadvisorycouncilvac/ |
| Prospective Students |
70534 |
/veterans/prospectivestudents/ |
| Why Study at Loyola |
70559 |
/veterans/prospectivestudents/whystudyatloyola/ |
| Applying to Traditional Undergraduate Programs |
70560 |
/veterans/prospectivestudents/applyingtotraditionalundergraduateprograms/ |
| Applying to Graduate and Professional Programs |
70561 |
/veterans/prospectivestudents/applyingtograduateandprofessionalprograms/ |
| Transition Checklist |
70562 |
/veterans/prospectivestudents/transitionchecklist/ |
| Current Students |
70535 |
/veterans/currentstudents/ |
| Campus Ministry |
70661 |
/veterans/currentstudents/campusministry/ |
| Career Development Center |
70662 |
/veterans/currentstudents/careerdevelopmentcenter/ |
| Events |
202546 |
/veterans/currentstudents/events/ |
| LoyolaLinked |
203083 |
/veterans/currentstudents/loyolalinked/ |
| Reservists/Guardsmen |
201327 |
/veterans/currentstudents/reservistsguardsmen/ |
| Student Accessibility Center |
70663 |
/veterans/currentstudents/studentaccessibilitycenter/ |
| Student Veterans Association |
70660 |
/veterans/currentstudents/studentveteransassociation/ |
| Study Abroad |
204103 |
/veterans/currentstudents/studyabroad/ |
| VIP (Veteran Integration Program) |
204104 |
/veterans/currentstudents/vipveteranintegrationprogram/ |
| Wellness Center |
70664 |
/veterans/currentstudents/wellnesscenter/ |
| VA Educational Benefits |
70536 |
/veterans/vaeducationalbenefits/ |
| How to Use VA Benefits |
194233 |
/veterans/vaeducationalbenefits/howtousevabenefits/ |
| Ch 33: Post 9/11 GI Bill® |
70785 |
/veterans/vaeducationalbenefits/ch33post911gibill/ |
| Ch 31: Veteran Readiness & Employment |
70784 |
/veterans/vaeducationalbenefits/ch31veteranreadinessemployment/ |
| Ch 35: Dependents' Educational Assistance |
70790 |
/veterans/vaeducationalbenefits/ch35dependentseducationalassistance/ |
| Ch 30: Montgomery GI Bill® |
70783 |
/veterans/vaeducationalbenefits/ch30montgomerygibill/ |
| Ch 1606: Montgomery GI Bill® - Selected Reserve |
70786 |
/veterans/vaeducationalbenefits/ch1606montgomerygibill-selectedreserve/ |
| TA: Tuition Assistance |
70788 |
/veterans/vaeducationalbenefits/tatuitionassistance/ |
| Fry Scholarship |
207067 |
/veterans/vaeducationalbenefits/fryscholarship/ |
| Edith Nourse Rogers STEM Scholarship |
207068 |
/veterans/vaeducationalbenefits/edithnourserogersstemscholarship/ |
| REAP: Reserve Education Assistance Program |
70787 |
/veterans/vaeducationalbenefits/reapreserveeducationassistanceprogram/ |
| Tutorial Assistance |
71879 |
/veterans/vaeducationalbenefits/tutorialassistance/ |
| Resources |
70537 |
/veterans/resources/ |
| Department of Veterans Affairs |
70828 |
/veterans/resources/departmentofveteransaffairs/ |
| Discounts |
70832 |
/veterans/resources/discounts/ |
| Educational and Career Resources |
70829 |
/veterans/resources/educationalandcareerresources/ |
| Legal Assistance |
70830 |
/veterans/resources/legalassistance/ |
| Scholarships |
195781 |
/veterans/resources/scholarships/ |
| Veteran Service Organization |
70831 |
/veterans/resources/veteranserviceorganization/ |
| Faculty & Staff Resources |
76866 |
/veterans/resources/facultystaffresources/ |
| Student Referral Form |
81627 |
/veterans/resources/facultystaffresources/studentreferralform.shtml |
| Thank You |
81629 |
/veterans/resources/facultystaffresources/studentreferralform-ty.shtml |
| FAQ |
70833 |
/veterans/faq/ |
| site_logo |
69828 |
/veterans/sitelogo/ |
| Footer |
69830 |
/veterans/footer/ |
| Documents |
71816 |
/veterans/documents/ |
| Stories |
88984 |
/veterans/stories/ |
| archive |
88985 |
/veterans/stories/archive/ |
| Request Information |
125367 |
/veterans/requestinformation/ |
| modules-programming |
197980 |
/veterans/modules-programming/ |
| I Links |
197981 |
/veterans/ilinks/ |
| cta |
197982 |
/veterans/cta/ |
| social media |
197983 |
/veterans/socialmedia/ |
| Mission Integration |
126355 |
/mission/ |
| site_logo |
126358 |
/mission/sitelogo/ |
| Footer |
184992 |
/mission/footer/ |
| social media |
184993 |
/mission/socialmedia/ |
| modules-programming |
199868 |
/mission/modules-programming/ |
| About |
126360 |
/mission/about/ |
| Meet The Team |
126363 |
/mission/about/meettheteam/ |
| Profiles |
184994 |
/mission/about/meettheteam/profiles/ |
| right_column |
203109 |
/mission/about/meettheteam/profiles/rightcolumn/ |
| St. Ignatius History |
126392 |
/mission/about/stignatiushistory/ |
| Jesuit Community |
126393 |
/mission/about/jesuitcommunity/ |
| News and Events |
126394 |
/mission/about/newsandevents/ |
| Contact |
126378 |
/mission/about/contact/ |
| Faculty and Staff Formation |
126366 |
/mission/facultyandstaffformation/ |
| Mission Orientation |
126367 |
/mission/facultyandstaffformation/missionorientation/ |
| Retreats |
126368 |
/mission/facultyandstaffformation/retreats/ |
| Faculty Writing Retreat |
126374 |
/mission/facultyandstaffformation/retreats/facultywritingretreat/ |
| Ignatian Contemplation Retreat |
184897 |
/mission/facultyandstaffformation/retreats/ignatiancontemplationretreat/ |
| Spiritual Exercises in Everyday Life (SEEL or the 19th Annotation) |
184898 |
/mission/facultyandstaffformation/retreats/spiritualexercisesineverydaylifeseelorthe19thannotation/ |
| Busy Person Retreat |
184899 |
/mission/facultyandstaffformation/retreats/busypersonretreat/ |
| May Retreat |
185145 |
/mission/facultyandstaffformation/retreats/mayretreat/ |
| Milestone Retreat: A Day Away |
204270 |
/mission/facultyandstaffformation/retreats/milestoneretreatadayaway/ |
| Cura Personalis Staff Retreat |
206645 |
/mission/facultyandstaffformation/retreats/curapersonalisstaffretreat/ |
| All Things Ignatian Staff Seminar |
184900 |
/mission/facultyandstaffformation/allthingsignatianstaffseminar/ |
| Book Clubs |
184901 |
/mission/facultyandstaffformation/bookclubs/ |
| Spiritual Direction |
184902 |
/mission/facultyandstaffformation/spiritualdirection/ |
| Damen Legacy Fellowship |
198550 |
/mission/facultyandstaffformation/damenlegacyfellowship/ |
| Mission Integration Faculty Seminar |
198946 |
/mission/facultyandstaffformation/missionintegrationfacultyseminar/ |
| Reigniting the Mission Conference |
204269 |
/mission/facultyandstaffformation/reignitingthemissionconference/ |
| Ignatian Heritage |
126382 |
/mission/ignatianheritage/ |
| Transformative Education |
126373 |
/mission/ignatianheritage/transformativeeducation/ |
| Mission Priority Examen |
126370 |
/mission/ignatianheritage/missionpriorityexamen/ |
| Ignatian Heritage Month |
126371 |
/mission/ignatianheritage/ignatianheritagemonth/ |
| Examens and Podcasts |
198743 |
/mission/ignatianheritage/ignatianheritagemonth/examensandpodcasts/ |
| Daily Examens |
199183 |
/mission/ignatianheritage/ignatianheritagemonth/examensandpodcasts/dailyexamens/ |
| Examen - 01 |
199379 |
/mission/ignatianheritage/ignatianheritagemonth/examensandpodcasts/examen-01/ |
| Examen - 02 |
199375 |
/mission/ignatianheritage/ignatianheritagemonth/examensandpodcasts/examen-02/ |
| Examen - 03 |
199366 |
/mission/ignatianheritage/ignatianheritagemonth/examensandpodcasts/examen-03/ |
| Examen - 04 |
199413 |
/mission/ignatianheritage/ignatianheritagemonth/examensandpodcasts/examen-04/ |
| Examen - 05 |
199377 |
/mission/ignatianheritage/ignatianheritagemonth/examensandpodcasts/examen-05/ |
| Examen - 06 |
199507 |
/mission/ignatianheritage/ignatianheritagemonth/examensandpodcasts/examen-06/ |
| Examen - 07 |
199400 |
/mission/ignatianheritage/ignatianheritagemonth/examensandpodcasts/examen-07/ |
| Examen - 08 |
199381 |
/mission/ignatianheritage/ignatianheritagemonth/examensandpodcasts/examen-08/ |
| Examen - 09 |
198748 |
/mission/ignatianheritage/ignatianheritagemonth/examensandpodcasts/examen-09/ |
| Examen - 10 |
199405 |
/mission/ignatianheritage/ignatianheritagemonth/examensandpodcasts/examen-10/ |
| Examen - 11 |
199565 |
/mission/ignatianheritage/ignatianheritagemonth/examensandpodcasts/examen-11/ |
| Examen - 12 |
199406 |
/mission/ignatianheritage/ignatianheritagemonth/examensandpodcasts/examen-12/ |
| Examen - 13 |
199506 |
/mission/ignatianheritage/ignatianheritagemonth/examensandpodcasts/examen-13/ |
| Examen - 14 |
199410 |
/mission/ignatianheritage/ignatianheritagemonth/examensandpodcasts/examen-14/ |
| Examen - 15 |
199411 |
/mission/ignatianheritage/ignatianheritagemonth/examensandpodcasts/examen-15/ |
| Examen - 16 |
199412 |
/mission/ignatianheritage/ignatianheritagemonth/examensandpodcasts/examen-16/ |
| Examen - 17 |
199415 |
/mission/ignatianheritage/ignatianheritagemonth/examensandpodcasts/examen-17/ |
| Examen - 18 |
199478 |
/mission/ignatianheritage/ignatianheritagemonth/examensandpodcasts/examen-18/ |
| Examen - 19 |
199479 |
/mission/ignatianheritage/ignatianheritagemonth/examensandpodcasts/examen-19/ |
| Podcast - 01 |
199570 |
/mission/ignatianheritage/ignatianheritagemonth/examensandpodcasts/podcast-01/ |
| Podcast - 02 |
199763 |
/mission/ignatianheritage/ignatianheritagemonth/examensandpodcasts/podcast-02/ |
| Podcast - 03 |
199990 |
/mission/ignatianheritage/ignatianheritagemonth/examensandpodcasts/podcast-03/ |
| Podcast - 04 |
200418 |
/mission/ignatianheritage/ignatianheritagemonth/examensandpodcasts/podcast-04/ |
| Podcast - 05 |
200523 |
/mission/ignatianheritage/ignatianheritagemonth/examensandpodcasts/podcast-05/ |
| Examens |
200957 |
/mission/ignatianheritage/examens/ |
| Podcast |
200958 |
/mission/ignatianheritage/podcast/ |
| Podcast - 06 |
204920 |
/mission/ignatianheritage/podcast/podcast-06/ |
| Examen - 05 2025 |
204765 |
/mission/ignatianheritage/podcast/examen-052025/ |
| Examen - 01 |
200964 |
/mission/ignatianheritage/podcast/examen-01/ |
| Examen - 02 |
200962 |
/mission/ignatianheritage/podcast/examen-02/ |
| Examen - 03 |
200961 |
/mission/ignatianheritage/podcast/examen-03/ |
| Examen - 04 |
200972 |
/mission/ignatianheritage/podcast/examen-04/ |
| Examen - 05 |
200963 |
/mission/ignatianheritage/podcast/examen-05/ |
| Examen - 06 |
200977 |
/mission/ignatianheritage/podcast/examen-06/ |
| Examen - 07 |
200966 |
/mission/ignatianheritage/podcast/examen-07/ |
| Examen - 08 |
200965 |
/mission/ignatianheritage/podcast/examen-08/ |
| Examen - 09 |
200959 |
/mission/ignatianheritage/podcast/examen-09/ |
| Examen - 10 |
200967 |
/mission/ignatianheritage/podcast/examen-10/ |
| Examen - 11 |
200978 |
/mission/ignatianheritage/podcast/examen-11/ |
| Examen - 12 |
200968 |
/mission/ignatianheritage/podcast/examen-12/ |
| Examen - 13 |
200976 |
/mission/ignatianheritage/podcast/examen-13/ |
| Examen - 14 |
200969 |
/mission/ignatianheritage/podcast/examen-14/ |
| Examen - 15 |
200970 |
/mission/ignatianheritage/podcast/examen-15/ |
| Examen - 16 |
200971 |
/mission/ignatianheritage/podcast/examen-16/ |
| Examen - 17 |
200973 |
/mission/ignatianheritage/podcast/examen-17/ |
| Examen - 18 |
200974 |
/mission/ignatianheritage/podcast/examen-18/ |
| Examen - 19 |
200975 |
/mission/ignatianheritage/podcast/examen-19/ |
| Podcast - 01 |
200979 |
/mission/ignatianheritage/podcast/podcast-01/ |
| Podcast - 02 |
200980 |
/mission/ignatianheritage/podcast/podcast-02/ |
| Podcast - 03 |
200981 |
/mission/ignatianheritage/podcast/podcast-03/ |
| Podcast - 04 |
200982 |
/mission/ignatianheritage/podcast/podcast-04/ |
| Podcast - 05 |
200983 |
/mission/ignatianheritage/podcast/podcast-05/ |
| Examen - 01 2025 |
204757 |
/mission/ignatianheritage/podcast/examen-012025/ |
| Examen - 02 2025 |
204758 |
/mission/ignatianheritage/podcast/examen-022025/ |
| Examen - 03 2025 |
204763 |
/mission/ignatianheritage/podcast/examen-032025/ |
| Examen - 04 2025 |
204764 |
/mission/ignatianheritage/podcast/examen-042025/ |
| Examen - 06 2025 |
204766 |
/mission/ignatianheritage/podcast/examen-062025/ |
| Examen - 07 2025 |
204960 |
/mission/ignatianheritage/podcast/examen-072025/ |
| Examen - 08 2025 |
204961 |
/mission/ignatianheritage/podcast/examen-082025/ |
| Examen - 09 2025 |
204962 |
/mission/ignatianheritage/podcast/examen-092025/ |
| Examen - 10 2025 |
204964 |
/mission/ignatianheritage/podcast/examen-102025/ |
| Examen - 11 2025 |
204965 |
/mission/ignatianheritage/podcast/examen-112025/ |
| Examen - 12 2025 |
204966 |
/mission/ignatianheritage/podcast/examen-122025/ |
| Podcast - 07 |
204972 |
/mission/ignatianheritage/podcast/podcast-07/ |
| Examen - 13 2025 |
205077 |
/mission/ignatianheritage/podcast/examen-132025/ |
| Examen - 14 2025 |
205078 |
/mission/ignatianheritage/podcast/examen-142025/ |
| Examen - 15 2025 |
205079 |
/mission/ignatianheritage/podcast/examen-152025/ |
| Examen - 16 2025 |
205080 |
/mission/ignatianheritage/podcast/examen-162025/ |
| Examen - 17 2025 |
205084 |
/mission/ignatianheritage/podcast/examen-172025/ |
| Examen - 18 2025 |
205085 |
/mission/ignatianheritage/podcast/examen-182025/ |
| Podcast - 08 |
205202 |
/mission/ignatianheritage/podcast/podcast-08/ |
| Examen - 19 2025 |
205313 |
/mission/ignatianheritage/podcast/examen-192025/ |
| Examen - 20 2025 |
205314 |
/mission/ignatianheritage/podcast/examen-202025/ |
| Examen - 21 2025 |
205315 |
/mission/ignatianheritage/podcast/examen-212025/ |
| Examen - 22 2025 |
205326 |
/mission/ignatianheritage/podcast/examen-222025/ |
| Examen - 23 2025 |
205329 |
/mission/ignatianheritage/podcast/examen-232025/ |
| Examen - 24 2025 |
205330 |
/mission/ignatianheritage/podcast/examen-242025/ |
| Podcast - 09 |
205334 |
/mission/ignatianheritage/podcast/podcast-09/ |
| Jesuit Heritage Signage |
204220 |
/jesuitheritage/ |
| Resources |
126390 |
/mission/resources/ |
| University Partners |
126391 |
/mission/universitypartners/ |
| sandbox-sberlin |
204434 |
/mission/sandbox-sberlin/ |
| Modern Languages and Literatures |
14422 |
/modernlang/index.shtml |
| site_logo |
14490 |
/modernlang/sitelogo/ |
| Footer |
14489 |
/modernlang/footer/ |
| I Links |
200865 |
/modernlang/ilinks/ |
| modules-programming |
199835 |
/modernlang/modules-programming/ |
| About Us |
14423 |
/modernlang/about.shtml |
| Mission Statement |
62678 |
/modernlang/missionstatement/ |
| Faculty & Staff Directory |
14426 |
/modernlang/faculty_directory.shtml |
| profiles |
199836 |
/modernlang/profiles/ |
| right_column |
204278 |
/modernlang/profiles/rightcolumn/ |
| Faculty Activities & Publications |
14425 |
/modernlang/faculty_activities_publications.shtml |
| Faculty & Staff Positions |
71702 |
/modernlang/facultystaffpositions/ |
| Academics |
14429 |
/modernlang/academics.shtml |
| BA Programs |
84910 |
/modernlang/baprograms/ |
| French |
14432 |
/modernlang/baprograms/french/ |
| Degree Requirements |
98758 |
/modernlang/baprograms/french/degreerequirements/ |
| Declaring a Major |
98759 |
/modernlang/baprograms/french/declaringamajor/ |
| Faculty |
98760 |
http://www.luc.edu/modernlang/faculty.shtml#French |
| Study Abroad |
98762 |
https://abroad.luc.edu/ |
| Italian |
14434 |
/modernlang/baprograms/italian/ |
| Degree Requirements |
98763 |
/modernlang/baprograms/italian/degreerequirements/ |
| Faculty |
98764 |
http://www.luc.edu/modernlang/faculty.shtml#Italian |
| Declaring a Major |
98765 |
/modernlang/baprograms/italian/declaringamajor/ |
| BA Italian Studies |
166522 |
/modernlang/baprograms/italian/baitalianstudies/ |
| Spanish |
14438 |
/modernlang/baprograms/spanish/ |
| Degree Requirements |
98767 |
/modernlang/baprograms/spanish/degreerequirements/ |
| Declaring a Major |
98768 |
/modernlang/baprograms/spanish/declaringamajor/ |
| Pre-2016 Requirements |
98770 |
/modernlang/baprograms/spanish/pre-2016requirements/ |
| Study Abroad |
98771 |
/modernlang/baprograms/spanish/studyabroad/ |
| Internship |
108055 |
/modernlang/baprograms/spanish/internship/ |
| Capstone E-Portfolio on TaskStream for French, Italian, and Spanish BA |
105181 |
/modernlang/baprograms/capstonee-portfolioontaskstreamforfrenchitalianandspanishba/ |
| BA/MA in Hispanic Studies |
96047 |
/modernlang/ba-ma-spanish/ |
| Overview |
99181 |
/modernlang/ba-ma-spanish/overview/ |
| Program Outcomes |
96048 |
/modernlang/ba-ma-spanish/programoutcomes/ |
| Degree Progress |
96049 |
/modernlang/ba-ma-spanish/degreeprogress/ |
| Degree Requirements |
96050 |
/modernlang/ba-ma-spanish/degreerequirements/ |
| Application Requirements |
96051 |
/modernlang/ba-ma-spanish/applicationrequirements/ |
| Contact Us |
99183 |
/modernlang/ba-ma-spanish/contactus/ |
| MA in Hispanic Studies |
96444 |
/modernlang/ma-spanish/ |
| Minors |
84911 |
/modernlang/minors/ |
| Arabic Language and Culture Minor |
18854 |
/modernlang/arabicminor/index.shtml |
| Mission |
15138 |
/modernlang/arabicminor/mission/ |
| Students’ Blogs: Why Arabic at Loyola? |
16572 |
/modernlang/arabicminor/studentsblogswhyarabicatloyola/ |
| An Eye on the Arab World |
49256 |
http://blogs.luc.edu/eyeonthearabworld/ |
| My Arabic: Connecting words to the World |
49257 |
http://blogs.luc.edu/myarabic/ |
| right_column |
62440 |
/modernlang/arabicminor/rightcolumn/ |
| Arabic Learning Resources |
23424 |
/modernlang/arabicminor/arabiclearningresources/ |
| Arabic Language Tutors |
19171 |
/modernlang/arabicminor/arabiclanguagetutors/ |
| Arabic Language Coach |
127458 |
/modernlang/arabicminor/arabiclanguagecoach/ |
| Asian Languages and Literatures Minor |
107908 |
/modernlang/minors/asianlanguagesandliteraturesminor/ |
| Chinese Language and Culture Minor |
92687 |
/modernlang/minors/chineselanguageandcultureminor/ |
| French Minors |
98757 |
/modernlang/minors/frenchminors/ |
| French Language Minor |
114303 |
/modernlang/minors/frenchminors/frenchlanguageminor/ |
| French Language & Literature Minor |
114305 |
/modernlang/minors/frenchminors/frenchlanguageliteratureminor/ |
| German Studies Minor |
14433 |
/modernlang/germanstudiesminor/ |
| Italian Minors |
98766 |
/modernlang/minors/italianminors/ |
| Italian Language Minor |
114306 |
/modernlang/minors/italianminors/italianlanguageminor/ |
| Italian Language & Literature Minor |
114307 |
/modernlang/minors/italianminors/italianlanguageliteratureminor/ |
| Italian American Studies |
116231 |
/modernlang/minors/italianamericanstudies/ |
| Japanese Language and Culture Minor |
180573 |
/modernlang/minors/japaneselanguageandcultureminor/ |
| Latin American & Latinx Studies |
114364 |
/modernlang/minors/latinamericanlatinxstudies/ |
| Polish Studies |
114365 |
/modernlang/minors/polishstudies/ |
| Spanish Minors |
114304 |
/modernlang/minors/spanishminors/ |
| Spanish Language Minor |
98769 |
/modernlang/minors/spanishminors/spanishlanguageminor/ |
| Spanish Language & Literature Minor |
114299 |
/modernlang/minors/spanishminors/spanishlanguageliteratureminor/ |
| Study Abroad |
14439 |
/modernlang/study_abroad.shtml |
| Financial Aid |
14443 |
/modernlang/finaid.html |
| Placement & Competency |
116583 |
/modernlang/placementcompetency/ |
| Foreign Language Competency Exam |
158990 |
/modernlang/placementcompetency/foreignlanguagecompetencyexam/ |
| Foreign Language Placement Exam |
14480 |
/modernlang/exam.shtml |
| Foreign Language Placement Coordinators |
63457 |
/modernlang/placementcompetency/foreignlanguageplacementcoordinators/ |
| News and Events |
79693 |
/modernlang/stories/ |
| archive |
79694 |
/modernlang/stories/archive/ |
| Stories from 2018 |
206943 |
/modernlang/stories/archive/storiesfrom2018/ |
| archive |
206944 |
/modernlang/stories/storiesfrom2018/archive/ |
| Stories from 2017 |
206941 |
/modernlang/stories/storiesfrom2017/ |
| archive |
206942 |
/modernlang/stories/storiesfrom2017/archive/ |
| Stories from 2016 |
206934 |
/modernlang/stories/storiesfrom2016/ |
| archive |
206935 |
/modernlang/stories/storiesfrom2016/archive/ |
| Stories before 2015 |
206932 |
/modernlang/stories/storiesbefore2015/ |
| archive |
206933 |
/modernlang/stories/storiesbefore2015/archive/ |
| Clubs, Activities, & Resources |
14481 |
/modernlang/resources.shtml |
| Career Opportunities |
14477 |
/modernlang/career.shtml |
| Clubs & Activities |
116582 |
/modernlang/clubsactivities/ |
| Chinese |
116680 |
/modernlang/clubsactivities/chinese/ |
| Chinese Student Association |
116793 |
/modernlang/clubsactivities/chinese/chinesestudentassociation/ |
| Chinese Students & Scholars Association |
116794 |
/modernlang/clubsactivities/chinese/chinesestudentsscholarsassociation/ |
| German |
116681 |
/modernlang/clubsactivities/german/ |
| German Club / Deutsch Klub |
116792 |
/modernlang/clubsactivities/german/germanclubdeutschklub/ |
| French |
116592 |
/modernlang/clubsactivities/french/ |
| French Club / Club Français |
116664 |
/modernlang/clubsactivities/french/frenchclubclubfranais/ |
| Italian |
116593 |
/modernlang/clubsactivities/italian/ |
| Italian Club / Italiola |
116679 |
/modernlang/clubsactivities/italian/italianclubitaliola/ |
| Japanese |
116594 |
/modernlang/clubsactivities/japanese/ |
| Japanese Lunch |
116795 |
/modernlang/clubsactivities/japanese/japaneselunch/ |
| Japanese Table |
116796 |
/modernlang/clubsactivities/japanese/japanesetable/ |
| Japanese Movie Nights |
116797 |
/modernlang/clubsactivities/japanese/japanesemovienights/ |
| Japanese Student Organization |
116798 |
/modernlang/clubsactivities/japanese/japanesestudentorganization/ |
| Anime Club |
116799 |
/modernlang/clubsactivities/japanese/animeclub/ |
| JET Program |
117146 |
/modernlang/clubsactivities/japanese/jetprogram/ |
| Honor Societies |
116596 |
/modernlang/honorsocieties/ |
| Spanish / Sigma Delta Pi |
117457 |
/modernlang/honorsocieties/spanishsigmadeltapi/ |
| Resources |
116590 |
/modernlang/resources/ |
| Language Learning Resource Center |
103454 |
/modernlang/languagelearningresourcecenter/ |
| Features |
96455 |
/modernlang/features/ |
| Neighborhood Initiatives |
110925 |
/neighborhood/ |
| site_logo |
110929 |
/neighborhood/sitelogo/ |
| Footer |
110928 |
/neighborhood/footer/ |
| social media |
201975 |
/neighborhood/socialmedia/ |
| News |
201875 |
/neighborhood/news/ |
| About |
110934 |
/neighborhood/about/ |
| Our Mission |
110935 |
/neighborhood/about/ourmission/ |
| Our Team |
110950 |
/neighborhood/about/ourteam/ |
| Jennifer Clark |
29725 |
/neighborhood/about/ourteam/jenniferclark/ |
| Summur Lawson |
29726 |
/neighborhood/about/ourteam/summurlawson/ |
| Cecilia Rodriguez |
199765 |
/neighborhood/about/ourteam/ceciliarodriguez/ |
| Diversity, Equity, and Inclusion |
181063 |
/neighborhood/about/diversityequityandinclusion/ |
| Office of Institutional Diversity, Equity, and Inclusion |
181064 |
https://www.luc.edu/diversityandinclusion/ |
| Land Acknowledgment Statement |
181065 |
https://www.luc.edu/celts/about/landacknowledgmentstatement/ |
| Work at Loyola |
181066 |
https://www.luc.edu/hr/careers/employment/ |
| Sustainability at Loyola |
181082 |
https://www.luc.edu/sustainabilitycommittee/sustainabilityatloyola/ |
| Association of Jesuit Colleges and Universities |
181239 |
https://www.ajcunet.edu/ |
| News and Events |
201971 |
/neighborhood/about/newsandevents/ |
| archive |
201972 |
/neighborhood/about/newsandevents/archive/ |
| Addressing Community Safety |
201977 |
/neighborhood/about/newsandevents/addressingcommunitysafety/ |
| Migratory Birds in Campus Planning |
202751 |
/neighborhood/about/newsandevents/migratorybirdsincampusplanning/ |
| Investing in Our Local Schools |
203242 |
/neighborhood/about/newsandevents/investinginourlocalschools/ |
| Economic Growth |
110936 |
/neighborhood/economicgrowth/ |
| Ramblin Around |
110939 |
/neighborhood/economicgrowth/ramblinaround/ |
| Ramblin’ Around Dinner Crawl |
127507 |
/neighborhood/economicgrowth/ramblinaround/ramblinarounddinnercrawl/ |
| Ramblin Around Business Showcase |
127508 |
/neighborhood/economicgrowth/ramblinaround/ramblinaroundbusinessshowcase/ |
| Let's Get Ready to Ramble Student Discounts |
156887 |
/neighborhood/economicgrowth/ramblinaround/letsgetreadytoramblestudentdiscounts/ |
| Lakeshore Campus |
181225 |
/neighborhood/economicgrowth/ramblinaround/lakeshorecampus/ |
| Water Tower Campus |
181226 |
/neighborhood/economicgrowth/ramblinaround/watertowercampus/ |
| Health Science Campus |
181227 |
/neighborhood/economicgrowth/ramblinaround/healthsciencecampus/ |
| Community Planning and Development |
181068 |
/neighborhood/economicgrowth/communityplanninganddevelopment/ |
| Elevate Devon |
181069 |
https://elevatedevon.org/ |
| Campus Plan |
181070 |
https://www.luc.edu/campusplan/ |
| Kenmore Vacation |
181071 |
https://www.luc.edu/communityrelations/currentprojects/kenmorevacation/ |
| Des Plaines Trail Improvements |
181072 |
https://fpdcc.com/about/plans-projects/des-plaines-trail-improvements/ |
| North DuSable Lake Shore Drive |
181251 |
https://northdusablelakeshoredrive.org/ |
| Community Board Memberships |
181073 |
/neighborhood/economicgrowth/communityboardmemberships/ |
| Rogers Park Business Alliance |
181074 |
https://rpba.org/ |
| Edgewater Chamber of Commerce |
181075 |
https://www.edgewater.org/ |
| Maywood Chamber of Commerce |
181076 |
https://maywood-il-mcc.com/ |
| Magnificent Mile Association |
181077 |
https://www.themagnificentmileassociation.com/about-us/leadership/ |
| University Assisted Housing |
181078 |
https://www.luc.edu/hr/uahprogram/ |
| Supporting Small Businesses |
181080 |
/neighborhood/economicgrowth/supportingsmallbusinesses/ |
| Small Business Utilization |
181079 |
https://www.luc.edu/purchasing/purch_policy.shtml#utilization |
| 2024 Civic Impact Report |
181081 |
https://7ba2077e.flowpaper.com/CRO2501AnchorReport/ |
| Dine Local Initiative |
181240 |
https://www.luc.edu/celts/resources/anchormission/dinelocal/ |
| Educational Access |
110945 |
/neighborhood/educationalaccess/ |
| Loyola University School Partners |
181094 |
https://www.luc.edu/schoolpartners/ |
| Senn High School Partnership |
181097 |
https://www.luc.edu/schoolpartners/partnerschools/nicholassennhighschool/ |
| Center for Science and Math Education |
181098 |
https://www.luc.edu/csme/ |
| Center for Catholic Education |
181099 |
https://www.luc.edu/gcce/index.shtml |
| Proviso Partners for Health |
181100 |
https://www.provisopartners.com/about-us.html |
| Arrupe College: Two-Year Degree |
181101 |
https://www.luc.edu/arrupe/ |
| Loyola Pre-School |
181230 |
https://www.luc.edu/preschool/missionstatement/ |
| Resources for Neighbors |
127069 |
/neighborhood/resourcesforneighbors/ |
| Halas Recreation Center |
181241 |
https://www.luc.edu/studentcomplex/halasreccenter/rentalinformation/ |
| Public Library Access |
181242 |
https://libraries.luc.edu/access |
| Contact Campus Safety |
181243 |
https://www.luc.edu/safety/contacting_help.html |
| File A Complaint |
181244 |
https://secure.ethicspoint.com/domain/media/en/gui/34712/index.html |
| Student Move-In / Move-Out |
181245 |
https://www.luc.edu/reslife/currentresidents/moveout/ |
| Mass at Madonna della Strada |
181246 |
https://www.luc.edu/campusministry/sacramental_life/eucharist/ |
| Tickets for Loyola Athletics |
181247 |
https://ramblertickets.com/online/default.asp |
| Fine and Performing Arts |
181248 |
https://luc.universitytickets.com/ |
| Loyola Votes |
181249 |
https://www.luc.edu/vote/ |
| LUPE Task Force |
181250 |
https://www.luc.edu/vote/about/thelupetaskforce/ |
| Anchor Mission Initiative |
198825 |
https://www.luc.edu/celts/resources/anchormission/#d.en.585487 |
| Neighborhood Partner Support |
206674 |
/neighborhood/resourcesforneighbors/neighborhoodpartnersupport/ |
| Health Equity |
181095 |
/neighborhood/healthequity/ |
| Health Sciences Campus |
181232 |
https://www.luc.edu/undergrad/about/ourcampuses/healthsciencescampus/ |
| Loyola Community and Family Services |
181233 |
https://www.luc.edu/lcfs/ |
| Maywood Medical-Legal Partnership |
181234 |
https://www.luc.edu/law/stories/our-stories/loyola-maywood-legal-partnership/ |
| Proviso Partners for Health |
181235 |
https://www.provisopartners.com/ |
| Loyola Community Nursing Center |
181236 |
https://www.luc.edu/nursing/innovation/practice/loyolacommunitynursingcenter/ |
| Loyola Street Medicine |
181237 |
https://hsd.luc.edu/global_health/programs/loyolastreetmedicine/ |
| Stand Against Gun Violence |
181238 |
https://standagainstgunviolence.org/about-us/ |
| Neuroscience |
17195 |
/neuroscience/ |
| site_logo |
200402 |
/neuroscience/sitelogo/ |
| Footer |
17203 |
/neuroscience/footer/ |
| social media |
200405 |
/neuroscience/socialmedia/ |
| cta |
200403 |
/neuroscience/cta/ |
| I Links |
200404 |
/neuroscience/ilinks/ |
| modules-programming |
200401 |
/neuroscience/modules-programming/ |
| About Us |
95432 |
/neuroscience/aboutus/ |
| Contact Us |
95436 |
/neuroscience/aboutus/contactus/ |
| Faculty Directory and Research |
95438 |
/neuroscience/aboutus/facultydirectoryandresearch/ |
| Academics |
17194 |
/neuroscience/courses.shtml |
| BS in Neuroscience |
95434 |
/neuroscience/bsinneuroscience/ |
| Minor in Neuroscience |
95435 |
/neuroscience/minorinneuroscience/ |
| Academic Calendars |
95439 |
http://luc.edu/academics/schedules/index.shtml |
| Undergraduate Research |
95441 |
/neuroscience/undergraduateresearch/ |
| New Faculty Member |
163081 |
/neuroscience/undergraduateresearch/newfacultymember/ |
| Events |
180943 |
/neuroscience/events/ |
| Chicago Brain Bee |
180944 |
/neuroscience/events/chicagobrainbee/ |
| Documents |
97416 |
/neuroscience/documents/ |
| New Student Programs |
17548 |
/nsp/index.shtml |
| About Us |
17549 |
/nsp/aboutus/ |
| Staff |
17555 |
/nsp/aboutus/staff/ |
| Contact Us |
17550 |
/nsp/aboutus/contactus/ |
| Teach UNIV 101/201 |
126691 |
/nsp/aboutus/teachuniv101201/ |
| Meet Our Staff |
198911 |
/nsp/aboutus/meetourstaff/ |
| Profiles |
199589 |
/nsp/aboutus/meetourstaff/profiles/ |
| right_column |
203110 |
/nsp/aboutus/meetourstaff/profiles/rightcolumn/ |
| First-Year Experience |
17579 |
/nsp/first-yearexperience/ |
| Orientation |
125864 |
https://www.luc.edu/orientation/ |
| Welcome Week |
125776 |
https://www.luc.edu/welcomeweek/ |
| Living Learning Communities |
127460 |
https://www.luc.edu/learningcommunity/ |
| New Student Convocation |
17566 |
/nsp/first-yearexperience/newstudentconvocation/ |
| Information for Faculty and Staff |
125778 |
/nsp/first-yearexperience/newstudentconvocation/informationforfacultyandstaff/ |
| UNIV 101: First-Year Seminar |
119745 |
/nsp/first-yearexperience/univ101first-yearseminar/ |
| First and Second Year Advising |
125878 |
https://www.luc.edu/fsya/index.shtml |
| Loyola 360 Retreat |
56874 |
http://www.luc.edu/campusministry/retreats/retreatofferings/ |
| UNIV 102: Loyola Seminar |
19834 |
/nsp/first-yearexperience/univ102loyolaseminar/ |
| First-Year Packs |
156398 |
/nsp/first-yearexperience/first-yearpacks/ |
| Become a NSP Student Leader |
37673 |
/nsp/first-yearexperience/becomeanspstudentleader/ |
| Orientation Leaders |
200397 |
/nsp/first-yearexperience/becomeanspstudentleader/orientationleaders/ |
| Peer Navigators |
201056 |
/nsp/first-yearexperience/becomeanspstudentleader/peernavigators/ |
| FYE Events |
17562 |
/nsp/fyeevents/ |
| No ImPact Bike Trip |
17563 |
/nsp/noimpactbiketrip/ |
| November events in the office of first year experience |
17564 |
/nsp/novembereventsintheofficeoffirstyearexperience/ |
| Thank you |
17590 |
/nsp/thankyou/ |
| FYE Program Summer |
17593 |
/nsp/fyeprogramsummer/ |
| Successful Student Profile #1 |
17594 |
/nsp/successfulstudentprofile1/ |
| Successful Student Profile #2 |
17595 |
/nsp/successfulstudentprofile2/ |
| Successful Student Profile #3 |
17596 |
/nsp/successfulstudentprofile3/ |
| Successful Student Profile #4 |
17597 |
/nsp/successfulstudentprofile4/ |
| First-Year Essay Contest |
31967 |
/nsp/first-yearessaycontest/ |
| Thank You!!! |
31968 |
/nsp/first-yearessaycontest/thankyou/ |
| home_news |
56252 |
/nsp/homenews/ |
| Documents |
82896 |
/nsp/documents/ |
| Parents and Guests |
117852 |
/nsp/parentsandguests/ |
| Orientation |
125875 |
/orientation/ |
| Newsletter |
125859 |
/nsp/parentsandfamilies/newsletter/ |
| Helpful Links |
125860 |
/nsp/parentsandfamilies/helpfullinks/ |
| Family Weekend |
125858 |
https://www.luc.edu/familyweekend/ |
| Report a Student Concern |
125874 |
https://www.luc.edu/cura/ |
| modules-programming |
198520 |
/nsp/modules-programming/ |
| cta |
198521 |
/nsp/cta/ |
| social media |
198522 |
/nsp/socialmedia/ |
| Footer |
17607 |
/nsp/footer/ |
| site_logo |
17608 |
/nsp/sitelogo/ |
| Student Academic Services |
202500 |
/nsp/studentacademicservices/ |
| Scholars Programs |
202504 |
https://www.luc.edu/scholarsprograms/ |
| Notice of Non-Discrimination Policy |
62226 |
/nondiscrimination.shtml |
| Office for Equity and Compliance |
123875 |
/equity/ |
| site_logo |
123891 |
/equity/sitelogo/ |
| Footer |
123892 |
/equity/footer/ |
| cta |
198885 |
/equity/cta/ |
| modules-programming |
198188 |
/equity/modules-programming/ |
| About |
123877 |
/equity/about/ |
| Mission and Scope |
123878 |
/equity/about/missionandscope/ |
| Meet the Team |
201780 |
/equity/about/meettheteam/ |
| Profiles |
201888 |
/equity/about/meettheteam/profiles/ |
| Records Requests |
180748 |
/equity/about/recordsrequests/ |
| Press/Media Inquiries |
123883 |
/equity/about/pressmediainquiries/ |
| Get Help |
123884 |
/equity/gethelp/ |
| Supportive Measures |
163625 |
/equity/gethelp/supportivemeasures/ |
| Reporting & Complaint Options |
151985 |
/equity/gethelp/reportingcomplaintoptions/ |
| I Experienced Discrimination or Sexual Misconduct |
123885 |
/equity/gethelp/iexperienceddiscriminationorsexualmisconduct/ |
| Supportive Measures |
151998 |
/equity/gethelp/iexperienceddiscriminationorsexualmisconduct/supportivemeasures/ |
| Confidential Resources |
154304 |
/equity/gethelp/iexperienceddiscriminationorsexualmisconduct/confidentialresources/ |
| A Report or Complaint Has Been Filed Against Me |
124619 |
/equity/gethelp/areportorcomplainthasbeenfiledagainstme/ |
| Supportive Measures |
151999 |
/equity/gethelp/areportorcomplainthasbeenfiledagainstme/supportivemeasures/ |
| I Need Help for Someone Else |
123899 |
/equity/gethelp/ineedhelpforsomeoneelse/ |
| Accommodations for Individuals with Disabilities |
124618 |
/equity/gethelp/accommodationsforindividualswithdisabilities/ |
| Pregnant & Parenting Resources |
168102 |
/equity/gethelp/pregnantparentingresources/ |
| Policy & Procedure |
123886 |
/equity/policyprocedure/ |
| Comprehensive Policy |
124168 |
/equity/policyprocedure/comprehensivepolicy/ |
| Discrimination Policy |
152290 |
/equity/policyprocedure/comprehensivepolicy/discriminationpolicy/ |
| Sexual Misconduct Policy |
152291 |
/equity/policyprocedure/comprehensivepolicy/sexualmisconductpolicy/ |
| Retaliation Policy |
152295 |
/equity/policyprocedure/comprehensivepolicy/retaliationpolicy/ |
| Other Related Offenses Policy |
197133 |
/equity/policyprocedure/comprehensivepolicy/otherrelatedoffensespolicy/ |
| University Nondiscrimination Policy |
125663 |
/equity/policyprocedure/universitynondiscriminationpolicy/ |
| Responsible Campus Partner Obligations |
125660 |
/equity/policyprocedure/responsiblecampuspartnerobligations/ |
| Preliminary Review of Reports |
124169 |
/equity/policyprocedure/preliminaryreviewofreports/ |
| Resolution Processes |
152004 |
/equity/policyprocedure/resolutionprocesses/ |
| Equitable Resolution Process |
152001 |
/equity/policyprocedure/resolutionprocesses/equitableresolutionprocess/ |
| ERP Investigation |
152005 |
/equity/policyprocedure/resolutionprocedures/equitableresolutionprocedures/erpinvestigation/ |
| Administrative Resolution |
152006 |
/equity/policyprocedure/resolutionprocedures/equitableresolutionprocedures/administrativeresolution/ |
| Resolution Format for Student Respondents |
124877 |
/equity/policyprocedure/resolutionprocedures/equitableresolutionprocedures/administrativeresolution/resolutionformatforstudentrespondents/ |
| Resolution Format for Faculty Respondents |
124883 |
/equity/policyprocedure/resolutionprocedures/equitableresolutionprocedures/administrativeresolution/resolutionformatforfacultyrespondents/ |
| Resolution Format for Staff Respondents |
124882 |
/equity/policyprocedure/resolutionprocedures/equitableresolutionprocedures/administrativeresolution/resolutionformatforstaffrespondents/ |
| Appeals |
154678 |
/equity/policyprocedure/resolutionprocedures/equitableresolutionprocedures/appeals/ |
| Grievance Process |
152002 |
/equity/policyprocedure/resolutionprocedures/grievanceprocess/ |
| What is Title IX Sexual Harassment? |
152124 |
/equity/policyprocedure/resolutionprocedures/grievanceprocess/whatistitleixsexualharassment/ |
| Investigation of a Grievance Process Complaint |
152120 |
/equity/policyprocedure/resolutionprocedures/grievanceprocess/investigationofagrievanceprocesscomplaint/ |
| Grievance Process Hearings |
152121 |
/equity/policyprocedure/resolutionprocedures/grievanceprocess/grievanceprocesshearings/ |
| Grievance Process Sanctioning & Remedies |
152122 |
/equity/policyprocedure/resolutionprocedures/grievanceprocess/grievanceprocesssanctioningremedies/ |
| Grievance Process Appeals |
152123 |
/equity/policyprocedure/resolutionprocedures/grievanceprocess/grievanceprocessappeals/ |
| Alternative Resolution Options |
152003 |
/equity/policyprocedure/resolutionprocedures/alternativeresolutionoptions/ |
| Advisors |
124508 |
/equity/policyprocedure/advisors/ |
| Equity Laws |
153977 |
/equity/policyprocedure/equitylaws/ |
| Other Resources |
124579 |
/equity/otherresources/ |
| News & Announcements |
154196 |
/equity/otherresources/newsannouncements/ |
| Zoom Bomb Prevention |
154222 |
/equity/otherresources/newsannouncements/zoombombprevention/ |
| OEC Support for Racial Justice |
147348 |
/equity/otherresources/newsannouncements/oecsupportforracialjustice/ |
| Virtual Office Hours |
154446 |
/equity/otherresources/newsannouncements/virtualofficehours/ |
| Student Disability Accommodations |
168076 |
/equity/otherresources/newsannouncements/studentdisabilityaccommodations/ |
| Training & Development |
124586 |
/equity/otherresources/trainingdevelopment/ |
| Resources for Faculty & Staff |
124636 |
/equity/otherresources/resourcesforfacultystaff/ |
| Responding to Student Disclosures |
124668 |
/equity/otherresources/resourcesforfacultystaff/respondingtostudentdisclosures/ |
| Syllabus Language |
124675 |
/equity/otherresources/resourcesforfacultystaff/syllabuslanguage/ |
| Inclusive Practices |
128171 |
/equity/otherresources/resourcesforfacultystaff/inclusivepractices/ |
| GBV Terminology |
187878 |
/equity/otherresources/gbvterminology/ |
| Safe Haven Events |
178062 |
/equity/otherresources/safehavenevents/ |
| CPA Training |
152073 |
/equity/otherresources/cpatraining/ |
| Posted Training Materials |
152077 |
/equity/otherresources/cpatraining/postedtrainingmaterials/ |
| Visual Aids |
154326 |
/equity/otherresources/visualaids/ |
| Library |
154341 |
/equity/otherresources/library/ |
| Topics of Special Interest |
126971 |
/equity/otherresources/topicsofspecialinterest/ |
| Resources for Staff |
124637 |
/equity/otherresources/resourcesforstaff/ |
| Responding to Student Disclosures |
124692 |
/equity/otherresources/resourcesforstaff/respondingtostudentdisclosures/ |
| Resources for Students |
124635 |
/equity/otherresources/resourcesforstudents/ |
| Community Standards |
124684 |
https://luc.edu/communitystandards |
| Make a Report to OEC |
124687 |
https://cm.maxient.com/reportingform.php?LoyolaUnivChicago&layout_id=9 |
| SAAM |
168901 |
/equity/otherresources/saam/ |
| Title IX Final Rule Update |
194239 |
/equity/otherresources/titleixfinalruleupdate/ |
| Title IX & Equity Laws |
123881 |
/equity/titleixequitylaws/ |
| Title IX |
124617 |
/equity/titleixequitylaws/titleix/ |
| Age Discrimination |
124653 |
/equity/titleixequitylaws/agediscrimination/ |
| Title VI |
124640 |
/equity/titleixequitylaws/titlevi/ |
| Title VII |
154195 |
/equity/titleixequitylaws/titlevii/ |
| Illinois Preventing Sexual Violence in Higher Education Act |
124857 |
/equity/titleixequitylaws/illinoispreventingsexualviolenceinhighereducationact/ |
| ADA/504 |
154225 |
/equity/titleixequitylaws/ada504/ |
| Pregnancy and Parenting |
124587 |
/equity/titleixequitylaws/pregnancyandparenting/ |
| Other Related Laws |
124621 |
/equity/titleixequitylaws/otherrelatedlaws/ |
| Feedback Form |
199576 |
/equity/feedbackform/ |
| Thank you! |
199578 |
/equity/feedbackform/thankyou/ |
| Office of Global and Community Engagement |
158839 |
/ogce/ |
| About OGCE |
160005 |
/ogce/aboutogce/ |
| Global Engagement |
199560 |
/ogce/globalengagement/ |
| English Language Learning Program (ELLP) |
160442 |
https://www.luc.edu/esl |
| International Student and Scholar Services (ISSS) |
160443 |
https://www.luc.edu/isss |
| Office of Global Initiatives |
199829 |
/globalengagement/officesandprograms/globalinitiatives/ |
| Ricci Scholars Program |
199561 |
https://www.luc.edu/ricci/index.shtml |
| Rome Center |
166362 |
https://www.luc.edu/rome |
| Study Abroad Office |
160441 |
https://www.luc.edu/studyabroad/ |
| Community Engagement |
199563 |
/ogce/communityengagement/ |
| Center for Engaged Learning, Teaching, and Scholarship (CELTS) |
166366 |
https://www.luc.edu/celts |
| Center for Science and Math Education (CSME) |
185352 |
https://www.luc.edu/csme/ |
| Center for Urban Research and Learning (CURL) |
166369 |
https://www.luc.edu/curl |
| Gannon Center for Women and Leadership |
166367 |
https://www.luc.edu/gannon |
| Ricci Scholars |
199732 |
https://www.luc.edu/ricci/index.shtml |
| Resources |
203583 |
/ogce/resources/ |
| Travel Resources |
198879 |
/ogce/travelresources/ |
| Assets |
198900 |
/ogce/travelresources/assets/ |
| International Travel and Safety Policy |
200572 |
https://www.luc.edu/media/lucedu/ogce/University%20International%20Travel%20Safety%20Policy.pdf |
| International Travel Registration |
206946 |
/ogce/resources/travelresources/internationaltravelregistration/ |
| right_column |
207155 |
/ogce/resources/travelresources/internationaltravelregistration/rightcolumn/ |
| Related Policies |
198903 |
/ogce/travelresources/relatedpolicies/ |
| International Education Week |
189652 |
/ogce/IEW |
| social media |
159033 |
/ogce/socialmedia/ |
| site_logo |
158842 |
/ogce/sitelogo/ |
| Footer |
158843 |
/ogce/footer/ |
| I Links |
159032 |
/ogce/ilinks/ |
| cta |
207114 |
/ogce/cta/ |
| Office of Institutional Research and Analysis (OIRA) |
191940 |
/oira/ |
| site_logo |
191941 |
/oira/sitelogo/ |
| Footer |
191942 |
/oira/footer/ |
| social media |
191945 |
/oira/socialmedia/ |
| modules-programming |
191946 |
/oira/modules-programming/ |
| About OIRA |
191440 |
/oira/aboutoira/ |
| Living Our Mission |
192363 |
/oira/aboutoira/livingourmission/ |
| Contact Us |
202188 |
/oira/aboutoira/contactus/ |
| Directory |
207334 |
/oira/aboutoira/contactus/directory/ |
| profiles |
190916 |
/oira/aboutoira/contactus/profiles/ |
| Submit Request |
192001 |
/oira/aboutoira/submitrequest/ |
| right_column |
192310 |
/oira/aboutoira/submitrequest/rightcolumn/ |
| Dashboards |
207182 |
/oira/dashboards/ |
| Dashboard Catalog |
207197 |
/oira/dashboards/dashboardcatalog/ |
| Dashboard Update Schedule |
206417 |
/oira/datagovernance/dashboardupdateschedule/ |
| Dashboard Workshop Schedule |
207195 |
/oira/dashboards/dashboardworkshopschedule/ |
| Institutional Data |
191417 |
/oira/institutionaldata/ |
| Student Enrollment |
198618 |
/oira/institutionaldata/studentenrollment/ |
| Faculty & Staff |
199908 |
/oira/institutionaldata/facultystaff/ |
| Student Achievement & Career Outcomes |
192021 |
/oira/institutionaldata/studentachievement/ |
| LUC Fact Book |
192017 |
/oira/institutionaldata/lucfactbook/ |
| Common Data Set |
191957 |
/oira/institutionaldata/commondataset/ |
| Ad Hoc Data Request |
192020 |
/oira/surveysandevaluation/adhocdatarequest/ |
| Economic Impact |
207110 |
/oira/institutionaldata/economicimpact/ |
| Attaining R1 classification |
207115 |
/eir-dev/attainingr1classification/ |
| Loyola and Arrupe: Increasing access |
207121 |
/eir-dev/loyolaandarrupeincreasingaccess/ |
| A vision for the future |
207122 |
/eir-dev/avisionforthefuture/ |
| Convener of conferences |
207123 |
/eir-dev/convenerofconferences/ |
| Degrees that boost income |
207124 |
/eir-dev/degreesthatboostincome/ |
| Surveys and Evaluation |
191427 |
/oira/surveysandevaluation/ |
| right_column |
207074 |
/oira/surveysandevaluation/rightcolumn/ |
| Academic Program Review |
191429 |
/oira/planningassessmentandevaluation/academicprogramreview/ |
| About APR at LUC |
196301 |
/clas/continuousimprovementatloyola/academicprogramreview/ |
| Scheduled APRs |
191968 |
/oira/planningassessmentandevaluation/academicprogramreviewevidence/scheduledaprs/ |
| Conducting APRs |
191969 |
/oira/planningassessmentandevaluation/academicprogramreviewevidence/conductingaprs/ |
| University Assessment & Planning Support |
191441 |
/oira/planningassessmentandevaluation/universityassessmentplanningsupport/ |
| Course Evals |
191970 |
/course-evaluations/ |
| Process |
192025 |
/oira/planningassessmentandevaluation/universityassessment/process/ |
| Academic Evaluations |
191436 |
/oira/planningassessmentandevaluation/universityassessment/academicevaluations/ |
| Faculty Activities System |
191972 |
/f180/ |
| Course Evaluations |
191971 |
/course-evaluations/ |
| Current Survey Reports |
207071 |
/oira/surveysandevaluation/currentsurveyreports/ |
| Archived Survey Report List |
207072 |
/oira/surveysandevaluation/archivedsurveyreportlist/ |
| Survey Policies |
207073 |
/oira/surveysandevaluation/surveypolicies/ |
| Campus Climate Survey |
207075 |
/oira/surveysandevaluation/climatesurvey/ |
| Data Governance |
191439 |
/oira/datagovernance/ |
| OIRA Reporting Policy |
192284 |
/oira/datagovernance/oirareportingpolicy/ |
| OIRA Approval Protocol |
192292 |
/oira/datagovernance/oiraapprovalprotocol/ |
| right_column |
192297 |
/oira/datagovernance/oiraapprovalprotocol/rightcolumn/ |
| Data Literacy |
192295 |
/oira/datagovernance/dataliteracy/ |
| Small Cell Suppression |
198821 |
/oira/datagovernance/smallcellsuppression/ |
| Data Quality & Integrity |
204435 |
/oira/datagovernance/dataqualityintegrity/ |
| 2022-2023 U.S. News & World Report |
191981 |
/oira/2022-2023usnewsworldreport/ |
| 2018-19 Diversity Report |
191982 |
/oira/2018-19diversityreport/ |
| Hidden Dashboards |
198715 |
/oira/hiddendashboards/ |
| Dashboard Catalog |
198366 |
/oira/dashboards/dashboardcatalog/ |
| Student Enrollment Dashboard |
198716 |
/oira/dashboards/studentenrollmentdashboard/ |
| Faculty Peer Comparison |
199705 |
/oira/dashboards/facultypeercomparison/ |
| Faculty Demographics |
199706 |
/oira/dashboards/facultydemographics/ |
| Majors and Graduate Programs |
199906 |
/oira/dashboards/majorsandgraduateprograms/ |
| Statistical Modeling and Analysis |
200539 |
/oira/statisticalmodelingandanalysis/ |
| Global Engagement |
183712 |
/globalengagement/ |
| About Global Engagement |
183713 |
/globalengagement/aboutoip/ |
| Global Engagement Overview |
204164 |
/globalengagement/aboutoip/globalengagementoverview/ |
| Meet Our Team |
199586 |
/globalengagement/aboutoip/meetourteam/ |
| Offices and Programs |
199825 |
/globalengagement/officesandprograms/ |
| Offices and Programs |
199825 |
/globalengagement/officesandprograms/ |
| Office of Global Initiatives |
159034 |
/globalengagement/officesandprograms/globalinitiatives/ |
| About Global Initiatives |
159119 |
/globalengagement/officesandprograms/globalinitiatives/aboutglobalinitiatives/ |
| International Partner Visits |
166324 |
/globalengagement/officesandprograms/globalinitiatives/internationalpartnervisits/ |
| International Partner Visit Form |
166412 |
/globalengagement/officesandprograms/globalinitiatives/internationalpartnervisits/form/ |
| Form Submission Confirmation |
166404 |
/globalengagement/officesandprograms/globalinitiatives/internationalpartnervisits/formconfirmationpage/ |
| Virtual Global Education |
159120 |
/globalengagement/officesandprograms/globalinitiatives/virtualglobaleducation/ |
| Global Migration Web Series |
159206 |
/globalengagement/officesandprograms/globalinitiatives/virtualglobaleducation/globalmigrationwebseries/ |
| Speaker Bios |
159209 |
/globalengagement/officesandprograms/globalinitiatives/virtualglobaleducation/globalmigrationwebseries/speakerbios/ |
| Rafael Moreno, SJ |
166379 |
/globalengagement/officesandprograms/globalinitiatives/virtualglobaleducation/globalmigrationwebseries/speakerbios/rafaelmorenosj/ |
| Caitlin Marie Ward |
166381 |
/globalengagement/officesandprograms/globalinitiatives/virtualglobaleducation/globalmigrationwebseries/speakerbios/caitlinmarieward/ |
| Bridget Wooding |
166449 |
/globalengagement/officesandprograms/globalinitiatives/virtualglobaleducation/globalmigrationwebseries/speakerbios/bridgetwooding/ |
| Alberto Baltazar |
166450 |
/globalengagement/officesandprograms/globalinitiatives/virtualglobaleducation/globalmigrationwebseries/speakerbios/albertobaltazar/ |
| Dr. Isabel Berganza Setién |
166455 |
/globalengagement/officesandprograms/globalinitiatives/virtualglobaleducation/globalmigrationwebseries/speakerbios/drisabelberganzasetien/ |
| Ligia Bolívar |
166457 |
/globalengagement/officesandprograms/globalinitiatives/virtualglobaleducation/globalmigrationwebseries/speakerbios/ligiabolivar/ |
| Dr. Duval Fernandes |
166487 |
/globalengagement/officesandprograms/globalinitiatives/virtualglobaleducation/globalmigrationwebseries/speakerbios/drduvalfernandes/ |
| Fr. Martin Puthussery, SJ |
166488 |
/globalengagement/officesandprograms/globalinitiatives/virtualglobaleducation/globalmigrationwebseries/speakerbios/frmartinputhusserysj/ |
| Rev. Dr. Louie Albert, SJ |
166547 |
/globalengagement/officesandprograms/globalinitiatives/virtualglobaleducation/globalmigrationwebseries/speakerbios/revdrlouiealbertsj/ |
| Dr. Bernard D'Sami |
166548 |
/globalengagement/officesandprograms/globalinitiatives/virtualglobaleducation/globalmigrationwebseries/speakerbios/drbernarddsami/ |
| Rev. Dr. Joseph Antony Jacob, SJ |
166575 |
/globalengagement/officesandprograms/globalinitiatives/virtualglobaleducation/globalmigrationwebseries/speakerbios/revdrjosephantonyjacobsj/ |
| Dr. Aimee Hilado |
166579 |
/globalengagement/officesandprograms/globalinitiatives/virtualglobaleducation/globalmigrationwebseries/speakerbios/draimeehilado/ |
| Fr. Martin Puthussery, SJ 2 |
166632 |
/globalengagement/officesandprograms/globalinitiatives/virtualglobaleducation/globalmigrationwebseries/speakerbios/frmartinputhusserysj2/ |
| Collaborative Online International Learning (COIL) |
159121 |
/globalengagement/officesandprograms/globalinitiatives/virtualglobaleducation/coil/ |
| Virtual Dual Immersion (VDI) |
159798 |
/globalengagement/officesandprograms/globalinitiatives/virtualglobaleducation/vdi/ |
| Forum on Global Affairs |
180396 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/ |
| What are we Learning from the War in Ukraine? |
180401 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/whatarewelearningfromthewarinukraine/ |
| How a Ukrainian University Responds to War Panelists |
180576 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/whatarewelearningfromthewarinukraine/howaukrainianuniversityrespondstowarpanelists/ |
| How a Ukrainian University Responds to War Panelists |
180577 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/whatarewelearningfromthewarinukraine/howaukrainianuniversityrespondstowarpanelists/howaukrainianuniversityrespondstowarpanelists/ |
| Dr. Dmytro Sherengovsky |
180588 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/whatarewelearningfromthewarinukraine/howaukrainianuniversityrespondstowarpanelists/howaukrainianuniversityrespondstowarpanelists/drdmytrosherengovsky/ |
| Mariya Tytarenko |
180589 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/whatarewelearningfromthewarinukraine/howaukrainianuniversityrespondstowarpanelists/howaukrainianuniversityrespondstowarpanelists/mariyatytarenko/ |
| Dr. Halyna Protsyk |
180590 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/whatarewelearningfromthewarinukraine/howaukrainianuniversityrespondstowarpanelists/howaukrainianuniversityrespondstowarpanelists/drhalynaprotsyk/ |
| Refugees: How Has the War in Ukraine Affected Western Policy? Panelists |
180689 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/whatarewelearningfromthewarinukraine/refugeeshowhasthewarinukraineaffectedwesternpolicypanelists/ |
| Refugees: How Has the War in Ukraine Affected Western Policy? Panelists |
180690 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/whatarewelearningfromthewarinukraine/refugeeshowhasthewarinukraineaffectedwesternpolicypanelists/refugeeshowhasthewarinukraineaffectedwesternpolicypanelists/ |
| Vladyslava Kachkovska, MD, PhD |
180691 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/whatarewelearningfromthewarinukraine/refugeeshowhasthewarinukraineaffectedwesternpolicypanelists/refugeeshowhasthewarinukraineaffectedwesternpolicypanelists/vladyslavakachkovskamdphd/ |
| Katherine Kaufka Walts, JD |
180692 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/whatarewelearningfromthewarinukraine/refugeeshowhasthewarinukraineaffectedwesternpolicypanelists/refugeeshowhasthewarinukraineaffectedwesternpolicypanelists/katherinekaufkawaltsjd/ |
| Ukraine, War, and Energy Panelists |
181965 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/whatarewelearningfromthewarinukraine/ukrainewarandenergypanelists/ |
| Ukraine, War, and Energy Panelists |
181966 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/whatarewelearningfromthewarinukraine/ukrainewarandenergypanelists/ukrainewarandenergypanelists/ |
| Griffin Thompson, PhD |
181967 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/whatarewelearningfromthewarinukraine/ukrainewarandenergypanelists/ukrainewarandenergypanelists/griffinthompsonphd/ |
| Joshua Volz |
181968 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/whatarewelearningfromthewarinukraine/ukrainewarandenergypanelists/ukrainewarandenergypanelists/joshuavolz/ |
| Welcome and Protect: JRS’s Response to the Ukraine Crisis Panelists |
183524 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/whatarewelearningfromthewarinukraine/welcomeandprotectjrssresponsetotheukrainecrisispanelists/ |
| Welcome and Protect: JRS’s Response to the Ukraine Crisis Panelists |
183525 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/whatarewelearningfromthewarinukraine/welcomeandprotectjrssresponsetotheukrainecrisispanelists/welcomeandprotectjrssresponsetotheukrainecrisispanelists/ |
| Diana Haidemak |
183526 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/whatarewelearningfromthewarinukraine/welcomeandprotectjrssresponsetotheukrainecrisispanelists/welcomeandprotectjrssresponsetotheukrainecrisispanelists/dianahaidemak/ |
| Olena Zinkevych |
183527 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/whatarewelearningfromthewarinukraine/welcomeandprotectjrssresponsetotheukrainecrisispanelists/welcomeandprotectjrssresponsetotheukrainecrisispanelists/olenazinkevych/ |
| The War in Ukraine and US Foreign Policy Panelists |
183539 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/whatarewelearningfromthewarinukraine/thewarinukraineandusforeignpolicypanelists/ |
| The War in Ukraine and US Foreign Policy Panelists |
183540 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/whatarewelearningfromthewarinukraine/thewarinukraineandusforeignpolicypanelists/thewarinukraineandusforeignpolicypanelists/ |
| Ryan Guirlinger |
183541 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/whatarewelearningfromthewarinukraine/thewarinukraineandusforeignpolicypanelists/thewarinukraineandusforeignpolicypanelists/ryanguirlinger/ |
| Poland and Ukraine's Historical Encounter with the Russian Empire |
184521 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/whatarewelearningfromthewarinukraine/polandandukraineshistoricalencounterwiththerussianempire/ |
| Poland and Ukraine's Historical Encounter with the Russian Empire |
184522 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/whatarewelearningfromthewarinukraine/polandandukraineshistoricalencounterwiththerussianempire/polandandukraineshistoricalencounterwiththerussianempire/ |
| Maciej Olchawa |
184523 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/whatarewelearningfromthewarinukraine/polandandukraineshistoricalencounterwiththerussianempire/polandandukraineshistoricalencounterwiththerussianempire/maciejolchawa/ |
| Michael Khodarkovsky, PhD |
184524 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/whatarewelearningfromthewarinukraine/polandandukraineshistoricalencounterwiththerussianempire/polandandukraineshistoricalencounterwiththerussianempire/michaelkhodarkovskyphd/ |
| Paweł Markiewicz, PhD |
184525 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/whatarewelearningfromthewarinukraine/polandandukraineshistoricalencounterwiththerussianempire/polandandukraineshistoricalencounterwiththerussianempire/pawemarkiewiczphd/ |
| The Year of War: The State of Russian Economy and Society |
185003 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/whatarewelearningfromthewarinukraine/theyearofwarthestateofrussianeconomyandsociety/ |
| The Year of War: The State of Russian Economy and Society Panelists |
185004 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/whatarewelearningfromthewarinukraine/theyearofwarthestateofrussianeconomyandsociety/theyearofwarthestateofrussianeconomyandsocietypanelists/ |
| Olga Avdeyeva |
185005 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/whatarewelearningfromthewarinukraine/theyearofwarthestateofrussianeconomyandsociety/theyearofwarthestateofrussianeconomyandsocietypanelists/olgaavdeyeva/ |
| Maria Snegovaya |
185006 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/whatarewelearningfromthewarinukraine/theyearofwarthestateofrussianeconomyandsociety/theyearofwarthestateofrussianeconomyandsocietypanelists/mariasnegovaya/ |
| Water Insecurity Across Borders |
188544 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/waterinsecurityacrossborders/ |
| Paula Skye Tallman, PhD |
188549 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/waterinsecurityacrossborders/waterinsecurityandgender-basedviolencealinkedpublichealththreatpanelistinformation/waterinsecurityandgender-basedviolencealinkedpublichealththreatpanelists/paulaskyetallmanphd/ |
| Shalean Collins |
188550 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/waterinsecurityacrossborders/waterinsecurityandgender-basedviolencealinkedpublichealththreatpanelistinformation/waterinsecurityandgender-basedviolencealinkedpublichealththreatpanelists/shaleancollins/ |
| Aman Kothadia |
188551 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/waterinsecurityacrossborders/waterinsecurityandgender-basedviolencealinkedpublichealththreatpanelistinformation/waterinsecurityandgender-basedviolencealinkedpublichealththreatpanelists/amankothadia/ |
| Lucía López |
188555 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/waterinsecurityacrossborders/waterinsecurityandgender-basedviolencealinkedpublichealththreatpanelistinformation/waterinsecurityandgender-basedviolencealinkedpublichealththreatpanelists/lucialopez/ |
| Lara Dugas, PhD, MPH, FTOS |
189591 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/waterinsecurityacrossborders/aheatingclimateextremewatereventsandhealthoutcomesamongvulnerablepopulationspanelistinformation/aheatingclimateextremewatereventsandhealthoutcomesamongvulnerablepopulationspanelists/laradugasphdmphftos/ |
| Amber Abrams |
189592 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/waterinsecurityacrossborders/aheatingclimateextremewatereventsandhealthoutcomesamongvulnerablepopulationspanelistinformation/aheatingclimateextremewatereventsandhealthoutcomesamongvulnerablepopulationspanelists/amberabrams/ |
| Alice Gwynne-Evans |
189593 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/waterinsecurityacrossborders/aheatingclimateextremewatereventsandhealthoutcomesamongvulnerablepopulationspanelistinformation/aheatingclimateextremewatereventsandhealthoutcomesamongvulnerablepopulationspanelists/alicegwynne-evans/ |
| Julienne Sánchez Pérez |
189594 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/waterinsecurityacrossborders/aheatingclimateextremewatereventsandhealthoutcomesamongvulnerablepopulationspanelistinformation/aheatingclimateextremewatereventsandhealthoutcomesamongvulnerablepopulationspanelists/juliennesanchezperez/ |
| Marlene Brito-Millán, PhD |
192210 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/waterinsecurityacrossborders/dialogueswithoutborderscommunitysciencesinthefaceofsocio-hydrologicalcrisespanelistinformation/dialogueswithoutborderscommunitysciencesinthefaceofsocio-hydrologicalcrisespanelists/marlenebrito-millanphd/ |
| Heladio Nava Xinol |
192211 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/waterinsecurityacrossborders/dialogueswithoutborderscommunitysciencesinthefaceofsocio-hydrologicalcrisespanelistinformation/dialogueswithoutborderscommunitysciencesinthefaceofsocio-hydrologicalcrisespanelists/heladionavaxinol/ |
| Larissa Catalán Sanchez |
192212 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/waterinsecurityacrossborders/dialogueswithoutborderscommunitysciencesinthefaceofsocio-hydrologicalcrisespanelistinformation/dialogueswithoutborderscommunitysciencesinthefaceofsocio-hydrologicalcrisespanelists/larissacatalansanchez/ |
| Arquímedes Bolito González |
192213 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/waterinsecurityacrossborders/dialogueswithoutborderscommunitysciencesinthefaceofsocio-hydrologicalcrisespanelistinformation/dialogueswithoutborderscommunitysciencesinthefaceofsocio-hydrologicalcrisespanelists/arquimedesbolitogonzalez/ |
| Following the Lithium Frontier: Water, Global Inequality, and Green Extractivism Panelist Information |
192217 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/waterinsecurityacrossborders/followingthelithiumfrontierwaterglobalinequalityandgreenextractivismpanelistinformation/ |
| Maria Akchurin, PhD |
192219 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/waterinsecurityacrossborders/followingthelithiumfrontierwaterglobalinequalityandgreenextractivismpanelistinformation/followingthelithiumfrontierwaterglobalinequalityandgreenextractivismpanelists/mariaakchurinphd/ |
| Thea Riofrancos, PhD |
192220 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/waterinsecurityacrossborders/followingthelithiumfrontierwaterglobalinequalityandgreenextractivismpanelistinformation/followingthelithiumfrontierwaterglobalinequalityandgreenextractivismpanelists/theariofrancosphd/ |
| Ramón Balcázar Morales |
192221 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/waterinsecurityacrossborders/followingthelithiumfrontierwaterglobalinequalityandgreenextractivismpanelistinformation/followingthelithiumfrontierwaterglobalinequalityandgreenextractivismpanelists/ramonbalcazarmorales/ |
| AI in a Globalized World |
202297 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/aiinaglobalizedworld/ |
| AI Foundations and Applications |
202298 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/aiinaglobalizedworld/aifoundationsandapplications/ |
| AI Foundations and Applications Panelists |
202299 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/aiinaglobalizedworld/aifoundationsandapplications/aifoundationsandapplicationspanelists/ |
| George K. Thiruvathukal |
202300 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/aiinaglobalizedworld/aifoundationsandapplications/aifoundationsandapplicationspanelists/georgekthiruvathukal/ |
| Michael Burns |
202301 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/aiinaglobalizedworld/aifoundationsandapplications/aifoundationsandapplicationspanelists/michaelburns/ |
| Dmitry Dligach |
202302 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/aiinaglobalizedworld/aifoundationsandapplications/aifoundationsandapplicationspanelists/dmitrydligach/ |
| Joe Vukov |
202303 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/aiinaglobalizedworld/aifoundationsandapplications/aifoundationsandapplicationspanelists/joevukov/ |
| Shilpika |
202327 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/aiinaglobalizedworld/aifoundationsandapplications/aifoundationsandapplicationspanelists/shilpika/ |
| Towards Responsible AI: Challenges and Strategies |
202304 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/aiinaglobalizedworld/towardsresponsibleaichallengesandstrategies/ |
| Towards Responsible AI: Challenges and Strategies Panelists |
202305 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/aiinaglobalizedworld/towardsresponsibleaichallengesandstrategies/towardsresponsibleaichallengesandstrategiespanelists/ |
| Joe Vukov |
202306 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/aiinaglobalizedworld/towardsresponsibleaichallengesandstrategies/towardsresponsibleaichallengesandstrategiespanelists/joevukov/ |
| Florence M. Chee |
202307 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/aiinaglobalizedworld/towardsresponsibleaichallengesandstrategies/towardsresponsibleaichallengesandstrategiespanelists/florencemchee/ |
| Brian Patrick Green |
202308 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/aiinaglobalizedworld/towardsresponsibleaichallengesandstrategies/towardsresponsibleaichallengesandstrategiespanelists/brianpatrickgreen/ |
| Daniel H. Moreira |
202309 |
/globalengagement/officesandprograms/globalinitiatives/forumonglobalaffairs/aiinaglobalizedworld/towardsresponsibleaichallengesandstrategies/towardsresponsibleaichallengesandstrategiespanelists/danielhmoreira/ |
| Study Abroad Office |
200579 |
https://www.luc.edu/studyabroad/ |
| International Student and Scholar Services (ISSS) |
199828 |
https://www.luc.edu/isss/ |
| Rome Center |
199830 |
https://www.luc.edu/rome/ |
| English Language Learning Program (ELLP) |
199826 |
https://www.luc.edu/esl |
| Ricci Scholars Program |
199827 |
https://www.luc.edu/ricci |
| Fellowship Office |
206474 |
/fellowshipoffice/index.shtml |
| Rome Center Enrollment Management |
199831 |
https://www.luc.edu/rome/admission/romecenteradmission/ |
| Rome Center |
204162 |
https://www.luc.edu/rome |
| Exchange Resource Center |
203584 |
/ogce/resources/exchangeresourcecenter/ |
| Explore Our Exchange |
203585 |
/ogce/resources/exchangeresourcecenter/exploreourexchange/ |
| Apply to Loyola |
203586 |
/ogce/resources/exchangeresourcecenter/applytoloyola/ |
| Complete Exchange Requirements |
203587 |
/ogce/resources/exchangeresourcecenter/completeexchangerequirements/ |
| Prepare for Loyola |
203588 |
/ogce/resources/exchangeresourcecenter/prepareforloyola/ |
| Discover Campus Resources |
203589 |
/ogce/resources/exchangeresourcecenter/discovercampusresources/ |
| Final Steps Before Departure |
203590 |
/ogce/resources/exchangeresourcecenter/finalstepsbeforedeparture/ |
| Learn More |
202152 |
/globalengagement/learnmore/ |
| Travel Resources |
200574 |
/globalengagement/learnmore/travelresources/ |
| Assets |
200575 |
/globalengagement/learnmore/travelresources/assets/ |
| International Travel and Safety Policy |
200578 |
https://www.luc.edu/media/lucedu/ogce/University%20International%20Travel%20Safety%20Policy.pdf |
| Related Policies |
200576 |
/globalengagement/learnmore/travelresources/relatedpolicies/ |
| International Travel Registration |
200589 |
/ogce/resources/travelresources/internationaltravelregistration/ |
| Exchange Resource Center |
204163 |
/globalengagement/learnmore/exchangeresourcecenter/ |
| Contact Us |
183714 |
/globalengagement/contactus/ |
| cta |
183787 |
/globalengagement/cta/ |
| site_logo |
183727 |
/globalengagement/sitelogo/ |
| Footer |
183726 |
/globalengagement/footer/ |
| social media |
183788 |
/globalengagement/socialmedia/ |
| I Links |
203695 |
/globalengagement/ilinks/ |
| Office of Online Learning |
182258 |
/ool/ |
| site_logo |
182260 |
/ool/sitelogo/ |
| Footer |
182261 |
/ool/footer/ |
| cta |
183458 |
/ool/cta/ |
| AudienceNav |
206550 |
/ool/audiencenav/ |
| About Us |
182375 |
/ool/aboutus/ |
| Our Team |
182379 |
/ool/aboutus/ourteam/ |
| Mission, Vision, and Goals |
182380 |
/ool/aboutus/missionvisionandgoals/ |
| Contact Us |
183460 |
/ool/aboutus/contactus/ |
| Services |
182376 |
/ool/services/ |
| Instructional Design |
182381 |
/ool/services/instructionaldesign/ |
| Instructional Design Projects |
195184 |
/ool/services/instructionaldesign/instructionaldesignprojects/ |
| Quality Assurance |
182382 |
/ool/services/qualityassurance/ |
| Professional Development |
182383 |
/ool/services/professionaldevelopment/ |
| Online Teaching Professional Learning Community |
182389 |
/ool/services/professionaldevelopment/onlineteachingprofessionallearningcommunity/ |
| Live Workshops & Webinars |
190323 |
/ool/services/professionaldevelopment/liveworkshopswebinars/ |
| Online Teaching Courses |
182384 |
/ool/services/onlineteachingcourses/ |
| Competency Equivalent Online Teaching Fundamentals |
188589 |
/ool/services/onlineteachingcourses/competencyequivalentonlineteachingfundamentals/ |
| Academic Integrity |
182385 |
/ool/services/academicintegrity/ |
| Academic Integrity Toolbox for Online Courses |
182390 |
/ool/services/academicintegrity/academicintegritytoolboxforonlinecourses/ |
| State and International Authorization |
182386 |
/ool/services/stateandinternationalauthorization/ |
| Online Teaching Guidelines |
182377 |
/ool/onlineteachingguidelines/ |
| Online Course Definitions |
182426 |
/ool/onlineteachingguidelines/onlinecoursedefinitions/ |
| Online Teaching Readiness Requirement |
195537 |
/ool/onlineteachingguidelines/onlineteachingreadinessrequirement/ |
| Accessibility Guidelines |
182427 |
/ool/onlineteachingguidelines/accessibilityguidelines/ |
| Panopto Accessibility |
182431 |
/ool/onlineteachingguidelines/accessibilityguidelines/panoptoaccessibility/ |
| PowerPoint Accessibility |
182432 |
/ool/onlineteachingguidelines/accessibilityguidelines/powerpointaccessibility/ |
| Sakai Accessibility |
182433 |
/ool/onlineteachingguidelines/accessibilityguidelines/sakaiaccessibility/ |
| VoiceThread Accessibility |
182434 |
/ool/onlineteachingguidelines/accessibilityguidelines/voicethreadaccessibility/ |
| Word Accessibility |
182435 |
/ool/onlineteachingguidelines/accessibilityguidelines/wordaccessibility/ |
| Glossary |
182436 |
/ool/onlineteachingguidelines/accessibilityguidelines/glossary/ |
| Contact Hours Guidelines |
182428 |
/ool/onlineteachingguidelines/contacthoursguidelines/ |
| Guidelines for Recording Students During Online Classes |
182429 |
/ool/onlineteachingguidelines/guidelinesforrecordingstudentsduringonlineclasses/ |
| Guidelines for Student Camera Usage |
182430 |
/ool/onlineteachingguidelines/guidelinesforstudentcamerausage/ |
| Regular and Substantive Interaction |
200728 |
/ool/onlineteachingguidelines/regularandsubstantiveinteraction/ |
| Student Services |
52247 |
/ool/studentservices/ |
| Student Complaint Procedure |
66739 |
/ool/studentservices/student-grievances/ |
| right_column |
66181 |
/ool/studentservices/rightcolumn/ |
| Online Student Orientation |
180053 |
/ool/studentservices/onlinestudentorientation/ |
| State Authorization |
66738 |
/ool/studentservices/state-authorization/ |
| Resources |
182378 |
/ool/resources/ |
| List of Resources |
195165 |
/ool/resources/listofresources/ |
| Faculty Resources |
183441 |
/ool/resources/facultyresources/ |
| Accessibility |
183443 |
/ool/resources/facultyresources/accessibility/ |
| Accessibility Training |
183451 |
/ool/resources/facultyresources/accessibility/accessibilitytraining/ |
| Academic Integrity |
183444 |
/ool/resources/facultyresources/academicintegrity/ |
| Contingency Planning |
183445 |
/ool/resources/facultyresources/contingencyplanning/ |
| Just In Time Online |
183452 |
/ool/resources/facultyresources/contingencyplanning/justintimeonline/ |
| Course Planning |
183446 |
/ool/resources/facultyresources/courseplanning/ |
| Getting Started with Online Teaching |
183453 |
/ool/resources/facultyresources/courseplanning/gettingstartedwithonlineteaching/ |
| Instructional Strategies |
183447 |
/ool/resources/facultyresources/instructionalstrategies/ |
| Blended Courses |
183454 |
/ool/resources/facultyresources/instructionalstrategies/blended/ |
| Classroom Disengagement: Strategies and Supports |
183455 |
/ool/resources/facultyresources/instructionalstrategies/peer-learning/ |
| Project & Problem-Based Learning |
183456 |
/ool/resources/facultyresources/instructionalstrategies/pbl/ |
| Gamification |
183457 |
/ool/resources/facultyresources/instructionalstrategies/gamification/ |
| Peer Learning |
185581 |
/ool/resources/facultyresources/instructionalstrategies/peerlearning/ |
| Online Course Assistants |
183448 |
/ool/resources/facultyresources/onlinecourseassistants/ |
| Syllabus Guidelines |
183449 |
/ool/resources/facultyresources/syllabusguidelines/ |
| Sakai Templates |
183450 |
/ool/resources/facultyresources/sakaitemplates/ |
| Office of Research Services |
14134 |
/ors/index.shtml |
| site_logo |
14292 |
/ors/sitelogo/ |
| footer |
14291 |
/ors/footer/ |
| modules-programming |
199483 |
/ors/modules-programming/ |
| News |
56610 |
/ors/news/ |
| News Archive |
56611 |
/ors/news/newsarchive/ |
| archive |
56612 |
/ors/news/newsarchive/archive/ |
| About Us |
14176 |
/ors/aboutus/ |
| Directory |
199502 |
/ors/aboutus/v3/ |
| Contact Us |
199503 |
/ors/aboutus/contactus/ |
| Proposals |
14213 |
/ors/proposals_ptap.shtml |
| Facilities and Administration / Fringe Rates |
14214 |
/ors/facostrates.shtml |
| Finding Collaborators |
14216 |
/ors/findingcollaborators.html |
| Post Award Process |
14211 |
/ors/newgrantaward.shtml |
| Proposal Submission |
14222 |
/ors/proposalsubmissioninstructions.shtml |
| Policies and Procedures |
14140 |
/ors/policiesprocedures.shtml |
| Proposal Writing |
14219 |
/ors/a-z.shtml |
| IPRS |
63167 |
https://iprs.luc.edu/Login.aspx |
| Resources |
14221 |
/ors/additionalservices.shtml |
| Cayuse |
202494 |
/ors/cayuse/ |
| Compliance |
14156 |
/ors/compliance.shtml |
| Responsible Conduct in Research and Scholarship |
14229 |
/ors/RCRHome.shtml |
| Animal Oversight (IACUC) |
14157 |
/ors/iacuc/index.shtml |
| Animal Care Facility (ACF) |
204007 |
/secure/ors/animalcarefacilityacf/ |
| Animal Care Facility (Secure) |
203088 |
/secure/ors/animalcarefacilityacf/ |
| Hazard Safety/Biosafety (IBC) |
14158 |
/ors/ibchome.shtml |
| Biosafety Subsections |
52757 |
/ors/biosafetysubsections/ |
| Recombinant DNA Categories |
14226 |
/ors/ibc_guidelines.shtml |
| Human Subjects (IRB) |
199633 |
/irb/ |
| Human Subjects (IRB) |
14159 |
/ors/IRB_Redirect.html |
| Laboratory Safety |
199634 |
/environmentalservices/occupational_health_and_safety.shtml |
| Laboratory Safety |
14160 |
/ors/Laboratorysafety.html |
| Radiation Safety |
14161 |
/ors/radsafetyhome.shtml |
| Radiation Safety Manual |
14208 |
/ors/radiationsafetymanual/index.shtml |
| A. DEFINITIONS |
14146 |
/ors/rad_I.shtml |
| B. REPORTING EMERGENCIES INVOLVING RADIOACTIVE MATERIAL |
14152 |
/ors/rad_II.shtml |
| C. RADIATION SAFETY PROGRAM ORGANIZATION |
14165 |
/ors/rad_III.shtml |
| D. INSTRUMENT CALIBRATION AND OPERABILITY CHECKS |
14168 |
/ors/rad_IV.shtml |
| E. PERSONNEL TRAINING PROGRAM |
14170 |
/ors/rad_V.shtml |
| F. PROCEDURES FOR ORDERING, RECEIVING, AND INVENTORYING RADIOACTIVE MATERIAL |
14174 |
/ors/rad_VI.shtml |
| G. GENERAL RULES FOR SAFE USE OF RADIOACTIVE MATERIAL |
14187 |
/ors/rad_VII.shtml |
| H. EMERGENCY PROCEDURES |
14188 |
/ors/rad_VIII.shtml |
| I. AREA SURVEY PROCEDURE |
14190 |
/ors/rad_IX.shtml |
| J. WASTE DISPOSAL |
14193 |
/ors/rad_X.shtml |
| K. BIOASSAY PROGRAM |
14194 |
/ors/rad_XI.shtml |
| L. PERSONNEL MONITORING |
14197 |
/ors/rad_XII.shtml |
| M. ALARA |
14201 |
/ors/rad_XIII.shtml |
| CAP |
57529 |
https://cap.luc.edu |
| CITI Course |
58211 |
/ors/citicourse/ |
| Federal Guidance |
199637 |
https://www.ecfr.gov/current/title-2/subtitle-A/chapter-II/part-200 |
| Federal Guidance |
110536 |
/ors/federalguidance/ |
| Funding |
110519 |
/ors/funding/ |
| Resources |
14136 |
/ors/about.shtml |
| Definitions |
14138 |
/ors/defintions.shtml |
| Useful Links |
14139 |
/ors/forms.shtml |
| FAQ |
14215 |
/ors/faq.shtml |
| Technology Transfer |
14237 |
/ors/tech_transfer.shtml |
| If you think you have invented something in the course of your research... |
15134 |
/ors/tt_researchinvention.shtml |
| If you think you've produced a copyrightable work under a grant... |
15150 |
/ors/tt_copyrightable.shtml |
| If you're interested in technologies that Loyola has available for licensing... |
15176 |
/ors/tt_licensing.shtml |
| If you'd like more information on the invention review process... |
15191 |
/ors/tt_inventionreview.shtml |
| right_column |
56592 |
/ors/rightcolumn/ |
| University ID Numbers |
14141 |
/ors/uidnumbers.shtml |
| Internal ORS |
14142 |
/ors/usefullinks.shtml |
| Policy Guidance |
52761 |
/ors/policyguidance/ |
| Controlled Substances Policy & Procedures (Lakeside Campuses) |
56213 |
/ors/policyguidance/controlledsubstancespolicyprocedureslakesidecampuses/ |
| Copyright Policy |
14163 |
/ors/copyrightpolicy.shtml |
| Cost Sharing and Matching Funds |
14164 |
/ors/costsharingmatchingfunds.shtml |
| Faculty Salary Charges on Externally Funded Projects |
14172 |
/ors/facultysalary.shtml |
| Financial Conflicts of Interest in Externally Funded Projects Policy |
14162 |
/ors/conflictsinterestpolicy.shtml |
| Intellectual Property and Technology Transfer Policy |
14198 |
/ors/patentpolicy.shtml |
| Patent Policy - OLD |
52768 |
/ors/oldpatentpolicy.shtml |
| Misconduct in Scholarship |
14200 |
/ors/misconductscholar.shtml |
| Paying Individuals from Externally Funded Projects |
14210 |
/ors/payingindividuals.shtml |
| U.S. Export Controls: Background |
14243 |
/ors/ExportControlsBackgr.shtml |
| Proposal Preparation and Award |
52762 |
/ors/proposalpreparationandaward/ |
| University Legal Identification Codes |
14241 |
/ors/universitylicodes.shtml |
| Contacts for Assistance with Grant Related Issues |
23448 |
/ors/proposalpreparationandaward/grant_contacts.shtml |
| Publications |
14224 |
/ors/Newsletters.shtml |
| Research Development |
52759 |
/ors/researchdevelopment/ |
| Additional Grant-Writing Resources |
14144 |
/ors/a-z_resources.shtml |
| Suggestions for Proposal Writers |
14232 |
/ors/a-z_suggestions1.shtml |
| Creating Your Research-Scholarly Interests Profile |
52705 |
/ors/ProfileCreationInstr.shtml |
| Online Forms |
60892 |
/ors/forms/index.shtml |
| Thank You |
60893 |
/ors/forms/thankyou-rfi.shtml |
| Stories |
86752 |
/ors/stories/ |
| archive |
86753 |
/ors/stories/archive/ |
| Documents |
60520 |
/ors/documents/ |
| Office of the Bursar |
19420 |
/bursar/ |
| site_logo |
19639 |
/bursar/sitelogo/ |
| Footer |
19638 |
/bursar/footer/ |
| modules-programming |
199477 |
/bursar/modules-programming/ |
| News |
157870 |
/bursar/news/ |
| archive |
25914 |
/bursar/news/archive/ |
| Board of Trustees Approves 2023-2024 Operating Budget Including Tuition and Fees |
182608 |
/bursar/news/boardoftrusteesapproves2023-2024operatingbudgetincludingtuitionandfees/ |
| Board of Trustees Approves 2024-2025 Operating Budget Including Tuition and Fees |
191120 |
/bursar/news/boardoftrusteesapproves2024-2025operatingbudgetincludingtuitionandfees/ |
| Board of Trustees Approves 2025-2026 Operating Budget Including Tuition and Fees |
201317 |
/bursar/news/boardoftrusteesapproves2025-2026operatingbudgetincludingtuitionandfees/ |
| Board of Trustees Approves 2026-2027 Operating Budget Including Tuition and Fees |
205887 |
/bursar/news/boardoftrusteesapproves2026-2027operatingbudgetincludingtuitionandfees/ |
| The Basics |
19428 |
/bursar/basics.shtml |
| right_column |
87613 |
/bursar/rightcolumn/ |
| About Us |
19422 |
/bursar/about.shtml |
| Locations and Hours |
19439 |
/bursar/location.shtml |
| FAQs |
19424 |
/bursar/faqs.shtml |
| Financial Aid |
199497 |
https://www.luc.edu/finaid |
| Parent/Guest Access |
19426 |
/bursar/parent_access.shtml |
| Contact Us |
19427 |
/bursar/staff.shtml |
| Profiles |
199498 |
/bursar/profiles/ |
| Room & Board Rates |
199501 |
https://www.luc.edu/reslife/futureresidents/roomboardrates/ |
| Documents |
160645 |
/bursar/documents/ |
| Tuition & Fees |
19429 |
/bursar/tuitionfees/ |
| 2026-2027 Tuition & Fees |
205862 |
/bursar/tuitionfees/2026-2027/ |
| Course, Lab & Supplies Fees 2026-2027 |
205880 |
/bursar/tuitionfees/2026-2027/fees/ |
| Graduate Arts and Sciences |
205879 |
/bursar/tuitionfees/2026-2027/graduate-cas/ |
| Graduate Programs at the Health Sciences Campus |
205878 |
/bursar/tuitionfees/2026-2027/graduate-hsc/ |
| Quinlan School of Business |
205877 |
/bursar/tuitionfees/2026-2027/business/ |
| Graduate School of Education |
205876 |
/bursar/tuitionfees/2026-2027/graduate-education/ |
| Environmental Sustainability |
205882 |
/bursar/tuitionfees/2026-2027/graduate-ies/ |
| Graduate School of Nursing |
205875 |
/bursar/tuitionfees/2026-2027/graduate-nursing/ |
| Parkinson Graduate School of Health Sciences and Public Health |
205883 |
/bursar/tuitionfees/2026-2027/parkinsongraduateschoolofhealthsciencesandpublichealth/ |
| Graduate School of Social Work |
205874 |
/bursar/tuitionfees/2026-2027/graduate-social-work/ |
| Institute of Pastoral Studies |
205873 |
/bursar/tuitionfees/2026-2027/ips/ |
| Graduate School of Communication |
205872 |
/bursar/tuitionfees/2026-2027/communication/ |
| School of Continuing and Professional Studies, Undergraduate and Graduate |
205871 |
/bursar/tuitionfees/2026-2027/scps/ |
| School of Law |
205870 |
/bursar/tuitionfees/2026-2027/law/ |
| Rule of Law for Development (PROLAW) |
205881 |
/bursar/tuitionfees/2026-2027/ruleoflawfordevelopmentprolaw/ |
| Undergraduate JFRC Rome Program and Rome Start Program |
205869 |
/bursar/tuitionfees/2026-2027/rome/ |
| Undergraduate School of Nursing |
205868 |
/bursar/tuitionfees/2026-2027/nursing/ |
| Undergraduate School of Nursing ABSN Program |
205867 |
/bursar/tuitionfees/2026-2027/absn/ |
| Undergraduate Schools |
205865 |
/bursar/tuitionfees/2026-2027/undergraduate/ |
| English Language Learning Program |
205864 |
/bursar/tuitionfees/2026-2027/esl/ |
| Stritch School of Medicine |
205863 |
/bursar/tuitionfees/2026-2027/medicine/ |
| Summer 2026 Tuition & Fees |
206467 |
/bursar/tuitionfees/summer2026tuitionfees/ |
| Course, Lab and Supplies Fees Summer 2026 |
206468 |
/bursar/tuitionfees/summer2026tuitionfees/courselabandsuppliesfeessummer2026/ |
| Undergraduate Schools Summer 2026 |
206469 |
/bursar/tuitionfees/summer2026tuitionfees/undergraduateschoolssummer2026/ |
| Graduate Programs Summer 2026 |
206470 |
/bursar/tuitionfees/summer2026tuitionfees/graduateprogramssummer2026/ |
| School of Continuing and Professional Studies, Undergraduate and Graduate Summer 2026 |
206471 |
/bursar/tuitionfees/summer2026tuitionfees/schoolofcontinuingandprofessionalstudiesundergraduateandgraduatesummer2026/ |
| 2025-2026 Tuition & Fees |
201026 |
/bursar/tuitionfees/2025-2026/ |
| Course, Lab & Supplies Fees 2025-2026 |
201044 |
/bursar/tuitionfees/2025-2026/fees/ |
| Graduate Arts and Sciences |
201043 |
/bursar/tuitionfees/2025-2026/graduate-cas/ |
| Graduate Programs at the Health Sciences Campus |
201042 |
/bursar/tuitionfees/2025-2026/graduate-hsc/ |
| Quinlan School of Business |
201041 |
/bursar/tuitionfees/2025-2026/business/ |
| Graduate School of Education |
201040 |
/bursar/tuitionfees/2025-2026/graduate-education/ |
| Environmental Sustainability |
201046 |
/bursar/tuitionfees/2025-2026/graduate-ies/ |
| Graduate School of Nursing |
201039 |
/bursar/tuitionfees/2025-2026/graduate-nursing/ |
| Parkinson Graduate School of Health Sciences and Public Health |
201047 |
/bursar/tuitionfees/2025-2026/parkinsongraduateschoolofhealthsciencesandpublichealth/ |
| Graduate School of Social Work |
201038 |
/bursar/tuitionfees/2025-2026/graduate-social-work/ |
| Institute of Pastoral Studies |
201037 |
/bursar/tuitionfees/2025-2026/ips/ |
| Graduate School of Communication |
201036 |
/bursar/tuitionfees/2025-2026/communication/ |
| School of Continuing and Professional Studies, Undergraduate and Graduate |
201035 |
/bursar/tuitionfees/2025-2026/scps/ |
| School of Law |
201034 |
/bursar/tuitionfees/2025-2026/law/ |
| Rule of Law for Development (PROLAW) |
201045 |
/bursar/tuitionfees/2025-2026/ruleoflawfordevelopmentprolaw/ |
| Undergraduate JFRC Rome Program and Rome Start Program |
201033 |
/bursar/tuitionfees/2025-2026/rome/ |
| Undergraduate School of Nursing |
201032 |
/bursar/tuitionfees/2025-2026/nursing/ |
| Undergraduate School of Nursing ABSN Program |
201031 |
/bursar/tuitionfees/2025-2026/absn/ |
| Undergraduate Schools |
201029 |
/bursar/tuitionfees/2025-2026/undergraduate/ |
| English Language Learning Program |
201028 |
/bursar/tuitionfees/2025-2026/esl/ |
| Stritch School of Medicine |
201027 |
/bursar/tuitionfees/2025-2026/medicine/ |
| Summer 2025 Tuition & Fees |
201637 |
/bursar/tuitionfees/summer2025tuitionfees/ |
| Course, Lab and Supplies Fees Summer 2025 |
201638 |
/bursar/tuitionfees/summer2025tuitionfees/courselabandsuppliesfeessummer2025/ |
| Undergraduate Schools Summer 2025 |
201639 |
/bursar/tuitionfees/summer2025tuitionfees/undergraduateschoolssummer2025/ |
| Graduate Programs Summer 2025 |
201640 |
/bursar/tuitionfees/summer2025tuitionfees/graduateprogramssummer2025/ |
| School of Continuing and Professional Studies, Undergraduate and Graduate Summer 2024 |
201641 |
/bursar/tuitionfees/summer2025tuitionfees/schoolofcontinuingandprofessionalstudiesundergraduateandgraduatesummer2024/ |
| 2024-2025 Tuition & Fees |
191015 |
/bursar/tuitionfees/2024-2025/ |
| Course, Lab & Supplies Fees 2024-2025 |
191033 |
/bursar/tuitionfees/2024-2025/fees/ |
| Graduate Arts and Sciences |
191032 |
/bursar/tuitionfees/2024-2025/graduate-cas/ |
| Graduate Programs at the Health Sciences Campus |
191031 |
/bursar/tuitionfees/2024-2025/graduate-hsc/ |
| Quinlan School of Business |
191030 |
/bursar/tuitionfees/2024-2025/business/ |
| Graduate School of Education |
191029 |
/bursar/tuitionfees/2024-2025/graduate-education/ |
| Environmental Sustainability |
191035 |
/bursar/tuitionfees/2024-2025/graduate-ies/ |
| Graduate School of Nursing |
191028 |
/bursar/tuitionfees/2024-2025/graduate-nursing/ |
| Parkinson Graduate School of Health Sciences and Public Health |
191036 |
/bursar/tuitionfees/2024-2025/parkinsongraduateschoolofhealthsciencesandpublichealth/ |
| Graduate School of Social Work |
191027 |
/bursar/tuitionfees/2024-2025/graduate-social-work/ |
| Institute of Pastoral Studies |
191026 |
/bursar/tuitionfees/2024-2025/ips/ |
| Graduate School of Communication |
191025 |
/bursar/tuitionfees/2024-2025/communication/ |
| School of Continuing and Professional Studies, Undergraduate and Graduate |
191024 |
/bursar/tuitionfees/2024-2025/scps/ |
| School of Law |
191023 |
/bursar/tuitionfees/2024-2025/law/ |
| Rule of Law for Development (PROLAW) |
191034 |
/bursar/tuitionfees/2024-2025/ruleoflawfordevelopmentprolaw/ |
| Undergraduate JFRC Rome Program and Rome Start Program |
191022 |
/bursar/tuitionfees/2024-2025/rome/ |
| Undergraduate School of Nursing |
191021 |
/bursar/tuitionfees/2024-2025/nursing/ |
| Undergraduate School of Nursing ABSN Program |
191020 |
/bursar/tuitionfees/2024-2025/absn/ |
| Undergraduate Schools |
191018 |
/bursar/tuitionfees/2024-2025/undergraduate/ |
| English Language Learning Program |
191017 |
/bursar/tuitionfees/2024-2025/esl/ |
| Stritch School of Medicine |
191016 |
/bursar/tuitionfees/2024-2025/medicine/ |
| Other Tuition & Fees |
91870 |
/bursar/tuitionfees/othertuitionfees/ |
| Billing/Payment |
19449 |
/bursar/payment.shtml |
| 529 and Third Party |
19446 |
/bursar/billingpayment/529andthirdparty/ |
| Billing Information |
19448 |
/bursar/billing_information.shtml |
| Installment Plans |
19450 |
/bursar/iPlan.shtml |
| iPlan Adjust Budget |
97557 |
/bursar/iplanadjustbudget/ |
| Quick Guide: Set Up Payment Plan |
102558 |
/bursar/quickguidesetuppaymentplan/ |
| Payment Methods |
19451 |
/bursar/payment_options.shtml |
| Flywire |
69197 |
/bursar/flywire/ |
| Refunds |
19453 |
/bursar/refunds.shtml |
| Refund Direct Deposit Profile |
19452 |
/bursar/directdeposit.shtml |
| Quick Guide: Billing & Payment |
101340 |
/bursar/quickguidebillingpayment/ |
| Policies |
19456 |
/bursar/policies.shtml |
| Fee Information |
19455 |
/bursar/fees.shtml |
| Red Flag Policy |
19457 |
/bursar/red_flag.shtml |
| Returned Check Policy |
19458 |
/bursar/returned_check.shtml |
| Tuition Payment Policy |
19459 |
/bursar/tuition_policy.shtml |
| Policy For Obtaining a Transcript or Diploma Withheld |
188142 |
/bursar/policyforobtainingatranscriptordiplomawithheld/ |
| Withdrawal & Schedule Change Calendars |
86208 |
/bursar/withdrawalschedulechangecalendars/ |
| Summer Semester/Quarter Term Withdrawal Schedule 2026 |
206773 |
/bursar/withdrawalschedulechangecalendars/summersemesterquartertermwithdrawalschedule2026/ |
| Spring 2026 Semester/Quarter & Winter 2025 Quarter Withdrawal Schedule |
205806 |
/bursar/withdrawalschedulechangecalendars/spring2026semesterquarterwinter2025quarterwithdrawalschedule/ |
| Fall 2025 Semester & Winter 2025 Quarter Withdrawal Schedule |
204010 |
/bursar/withdrawalschedulechangecalendars/fall2025semesterwinter2025quarterwithdrawalschedule/ |
| Summer Semester/Quarter Term Withdrawal Schedule 2025 |
203003 |
/bursar/withdrawalschedulechangecalendars/summersemesterquartertermwithdrawalschedule2025/ |
| Spring 2025 Semester/Quarter & Winter 2024 Quarter Withdrawal Schedule |
200898 |
/bursar/withdrawalschedulechangecalendars/spring2025semesterquarterwinter2024quarterwithdrawalschedule/ |
| Fall 2024 Semester & Winter 2024 Quarter Withdrawal Schedule |
198124 |
/bursar/withdrawalschedulechangecalendars/fall2024semesterwinter2024quarterwithdrawalschedule/ |
| Additional Details Regarding Withdrawal Policies |
86209 |
/bursar/additionaldetailsregardingwithdrawalpolicies/ |
| Student Financial Responsibility Agreement |
206709 |
/bursar/SFRA.shtml |
| Services |
19468 |
/bursar/Services.shtml |
| 1098-T |
158213 |
/bursar/1098t.shtml |
| Dental and Vision Insurance |
19470 |
/bursar/Student_Dental_Insur.shtml |
| ECSI Billing Servicer |
19471 |
/bursar/loan_collection.shtml |
| Forms |
19472 |
/bursar/forms.shtml |
| Health Insurance |
19473 |
/bursar/insurance.shtml |
| Quick Guide: Waive Health Insurance |
101874 |
/bursar/quickguidewaivehealthinsurance/ |
| custom_css |
125856 |
/bursar/customcss/ |
| Tuition Insurance |
19474 |
/bursar/tuition_insurance.shtml |
| Medical Student Disability Insurance |
64500 |
/bursar/medicalstudentdisabilityinsurance/ |
| Electronic Billing |
19431 |
/bursar/ebilling/index.shtml |
| Auditing a Course |
19433 |
/bursar/audit.shtml |
| How to: Disable pop-up blockers |
19438 |
/bursar/popup_blocker.shtml |
| President's Letter |
207022 |
/bursar/news/boardoftrusteesapproves2026-2027operatingbudgetincludingtuitionandfees/ |
| Graduation and Matriculation Fees |
19441 |
/bursar/Matriculation_Fee.shtml |
| Technology Fee |
24209 |
http://www.luc.edu/its/policies/tech_fee_faq.shtml |
| Student Health Insurance Waiver |
19475 |
/bursar/insurance_waiver_mes.shtml |
| Verification Resources |
19553 |
/bursar/Verification.shtml |
| Verification Tutorial: step 1 |
19554 |
/bursar/verification_step1.shtml |
| Verification tutorial: step 2 |
19555 |
/bursar/verification_step2.shtml |
| Verification tutorial: step 3 |
19556 |
/bursar/verification_step3.shtml |
| Holiday Hours 2017-2018 |
99616 |
/bursar/holidayhours2017-2018/ |
| Holiday Hours |
106845 |
/bursar/holidayhours/ |
| Office of the Dean of Students |
181665 |
/deanofstudents/ |
| site_logo |
181666 |
/osccr/sitelogo/ |
| Footer |
181667 |
/osccr/footer/ |
| social media |
181940 |
/osccr/socialmedia/ |
| cta |
184019 |
/osccr/cta/ |
| modules-programming |
181936 |
/osccr/modules-programming/ |
| About the ODOS Area |
181668 |
/deanofstudents/abouttheodosarea/ |
| Mission & Vision |
181669 |
/osccr/aboutthesrcrteam/missionvision/ |
| The Student Promise |
181670 |
/osccr/aboutthesrcrteam/thestudentpromise/ |
| The Creation Story |
181702 |
/osccr/aboutthesrcrteam/thestudentpromise/thecreationstory/ |
| Commitment to Equity |
181671 |
/osccr/aboutthesrcrteam/commitmenttoequity/ |
| Meet Our Team |
181672 |
/deanofstudents/abouttheodosarea/meetourteam/ |
| Student Outreach & Support Team (SOS) |
204073 |
/deanofstudents/abouttheodosarea/meetourteam/studentoutreachsupportteamsos/ |
| Student Rights, Responsibilities & Conflict Resolution Team (SRCR) |
204074 |
/deanofstudents/abouttheodosarea/meetourteam/studentrightsresponsibilitiesconflictresolutionteamsrcr/ |
| Contact Us |
181673 |
/osccr/aboutthesrcrteam/contactus/ |
| Community Standards |
181675 |
/osccr/communitystandards/ |
| General Information |
181676 |
/osccr/communitystandards/generalinformation/ |
| Alcohol, Drugs, and Smoking |
181711 |
/osccr/communitystandards/alcoholdrugsandsmoking/ |
| Good Samaritan Protocol |
195819 |
/osccr/communitystandards/goodsamaritanprotocol/ |
| Identification Policies |
181712 |
/osccr/communitystandards/identificationpolicies/ |
| International Campuses & Study Abroad |
181713 |
/osccr/communitystandards/internationalcampusesstudyabroad/ |
| Physical or Emotional Harm |
181714 |
/osccr/communitystandards/physicaloremotionalharm/ |
| Residence Hall Regulations |
181715 |
/osccr/communitystandards/residencehallregulations/ |
| Rights to Peace and Property |
181716 |
/osccr/communitystandards/rightstopeaceandproperty/ |
| Title IX Notification and Sexual Misconduct Under the Comprehensive Policy |
181717 |
/osccr/communitystandards/titleixnotificationandsexualmisconductunderthecomprehensivepolicy/ |
| Demonstrations & Fixed Exhibits |
198011 |
/osccr/communitystandards/demonstrationsfixedexhibits/ |
| Conflict Resolution |
181725 |
/osccr/conflictresolution/ |
| Conflict Coaching |
181730 |
/osccr/conflictresolution/conflictcoaching/ |
| Mediation |
181731 |
/osccr/conflictresolution/mediation/ |
| Circles |
181732 |
/osccr/conflictresolution/circles/ |
| Restorative Justice Conference |
181733 |
/osccr/conflictresolution/restorativejusticeconference/ |
| Student Conduct |
181726 |
/osccr/studentconduct/ |
| File an Incident Referral |
181735 |
/osccr/studentconduct/fileanincidentreferral/ |
| How To Check Your Conduct Record |
181736 |
/osccr/studentconduct/howtocheckyourconductrecord/ |
| Students Rights in the Hearing Process |
181737 |
/osccr/studentconduct/studentsrightsinthehearingprocess/ |
| The Hearing Process |
181738 |
/osccr/studentconduct/thehearingprocess/ |
| Role of an Advisor |
181739 |
/osccr/studentconduct/roleofanadvisor/ |
| Assigned Outcomes/Sanctions |
181740 |
/osccr/studentconduct/assignedoutcomessanctions/ |
| Appealing a Hearing Decision |
181741 |
/osccr/studentconduct/appealingahearingdecision/ |
| Student Conduct FAQs |
181742 |
/osccr/studentconduct/studentconductfaqs/ |
| Resources |
181727 |
/osccr/resources/ |
| SRCR Student Leaders |
181743 |
/osccr/resources/srcrstudentleaders/ |
| Student Community Board |
181744 |
/osccr/resources/srcrstudentleaders/studentcommunityboard/ |
| Conflict Resolutions Liaisons |
181745 |
/osccr/resources/srcrstudentleaders/conflictresolutionsliaisons/ |
| Student Assistants |
181746 |
/osccr/resources/srcrstudentleaders/studentassistants/ |
| Completing Service Hours |
181747 |
/osccr/resources/completingservicehours/ |
| Parent and Family Information |
181748 |
/osccr/resources/parentandfamilyinformation/ |
| Tips for Talking with Your Student |
181749 |
/osccr/resources/parentandfamilyinformation/tipsfortalkingwithyourstudent/ |
| Workshops, Trainings, and Requests |
181750 |
/osccr/resources/workshopstrainingsandrequests/ |
| Request a Community Circle |
183516 |
/osccr/resources/requestacommunitycircle/ |
| Conduct Check Request Form |
181752 |
/osccr/resources/conductcheckrequestform/ |
| Demonstration & Fixed Exhibit Request Form |
198012 |
/osccr/resources/demonstrationfixedexhibitrequestform/ |
| Student Outreach & Support |
201980 |
/osccr/studentoutreachsupport/ |
| CURA Network |
124300 |
https://www.luc.edu/cura |
| Behavioral Concerns Team (BCT) |
74730 |
/osccr/studentoutreachsupport/behavioralconcernsteambct/ |
| right_column |
76568 |
/osccr/studentoutreachsupport/behavioralconcernsteambct/rightcolumn/ |
| Making a Referral |
76571 |
/osccr/studentoutreachsupport/behavioralconcernsteambct/makingareferral/ |
| Information for Staff & Faculty |
76572 |
/osccr/studentoutreachsupport/behavioralconcernsteambct/informationforstafffaculty/ |
| BCT Policies |
76573 |
/osccr/studentoutreachsupport/behavioralconcernsteambct/bctpolicies/ |
| BCT FAQs |
78358 |
/osccr/studentoutreachsupport/behavioralconcernsteambct/bctfaqs/ |
| Coordinated Assistance & Resource Education (CARE) |
74729 |
/osccr/studentoutreachsupport/coordinatedassistanceresourceeducationcare/ |
| Food Security Resources |
120554 |
/osccr/studentoutreachsupport/coordinatedassistanceresourceeducationcare/foodsecurityresources/ |
| Housing Security Resources |
120868 |
/osccr/studentoutreachsupport/coordinatedassistanceresourceeducationcare/housingsecurityresources/ |
| CARE FAQs |
76566 |
/osccr/studentoutreachsupport/coordinatedassistanceresourceeducationcare/carefaqs/ |
| DOS CARE Fund |
155422 |
/osccr/studentoutreachsupport/emergencyhardshipfund/ |
| LAD Service Indicators (Holds) |
80213 |
/osccr/studentoutreachsupport/ladserviceindicatorsholds/ |
| right_column |
86312 |
/osccr/studentoutreachsupport/ladserviceindicatorsholds/rightcolumn/ |
| Food Pantries |
201982 |
/osccr/studentoutreachsupport/foodpantries/ |
| Office of the President |
177836 |
/president/ |
| site_logo |
177837 |
/president/sitelogo/ |
| Footer |
177838 |
/president/footer/ |
| social media |
177842 |
/president/socialmedia/ |
| modules-programming |
177839 |
/president/modules-programming/ |
| About the President |
180109 |
/president/aboutthepresident/ |
| right_column |
180257 |
/president/aboutthepresident/rightcolumn/ |
| Presidential History |
179313 |
/president/presidentialhistory/ |
| Contact Information |
180108 |
/president/contactinformation/ |
| University Leadership |
186964 |
/president/universityleadership/ |
| Office of the President |
186956 |
/president/ |
| Board of Trustees |
186965 |
/universityleadership/boardoftrustees/ |
| Administrative Offices |
186967 |
/universityleadership/administrativeoffices/ |
| Organizational Charts |
186968 |
/universityleadership/organizationalcharts/ |
| President's Report |
202815 |
https://www.luc.edu/presidentsreport/2024/ |
| Office of the Vice Provost for Research (OVPR) |
182235 |
/ovpr/ |
| site_logo |
182238 |
/ovpr/sitelogo/ |
| social media |
182239 |
/ovpr/socialmedia/ |
| modules-programming |
182237 |
/ovpr/modules-programming/ |
| Footer |
182242 |
/ovpr/footer/ |
| About Us |
201431 |
/ovpr/aboutus/ |
| Directory |
201432 |
/ovpr/aboutus/directory/ |
| Meet the Committees |
201433 |
/ovpr/aboutus/meetthecommittees/ |
| Institution Research Deans |
202624 |
/ovpr/aboutus/institutionresearchdeans/ |
| News and Updates |
201434 |
/ovpr/aboutus/newsandupdates/ |
| Research at Loyola |
201420 |
/ovpr/researchatluc/ |
| Current Initiatives |
201421 |
/ovpr/researchatluc/currentinitiatives/ |
| Centers and Institutes |
201423 |
/ovpr/researchatluc/centersandinstitutes/ |
| Research Support |
201424 |
/ovpr/researchsupport/ |
| Research Support |
201424 |
/ovpr/researchsupport/ |
| Offices & Services |
201425 |
/ovpr/researchsupport/officesservices/ |
| Core Facilities |
201569 |
/ovpr/researchsupport/corefacilities/ |
| Resources |
201435 |
/ovpr/researchsupport/resources/ |
| Cayuse (eRA) |
204511 |
/ovpr/cayuseera/ |
| Funding |
201427 |
/ovpr/funding/ |
| Provost and President Funded Opportunities |
201428 |
/ovpr/funding/provostandpresidentfundedopportunities/ |
| All Funding Opportunities |
201429 |
/ovpr/funding/allfundingopportunities/ |
| Office of Postdoctoral Affairs |
201430 |
/ovpr/officeofpostdoctoralaffairs/ |
| About Loyola University Chicago |
202432 |
/ovpr/officeofpostdoctoralaffairs/aboutluc/ |
| Welcome to Loyola University Chicago |
202433 |
/ovpr/officeofpostdoctoralaffairs/welcometoluc/ |
| Thriving at Loyola University Chicago |
202438 |
/ovpr/officeofpostdoctoralaffairs/thrivingatluc/ |
| Careers Beyond Loyola University Chicago |
202439 |
/ovpr/officeofpostdoctoralaffairs/careersbeyondluc/ |
| Orientation |
13482 |
/orientation/ |
| About us |
14557 |
/orientation/about/ |
| Contact Us |
76649 |
/orientation/about/contactus/ |
| New Student Programs |
19598 |
http://www.luc.edu/firstyearexperience/ |
| Photos |
19587 |
/orientation/photos/ |
| OLs |
21867 |
/orientation/about/olsolsols/ |
| Publications |
68345 |
/orientation/about/publications/ |
| Sustainability at Orientation |
127512 |
/orientation/about/sustainabilityatorientation/ |
| January Orientation |
87854 |
/orientation/januaryorientation/ |
| January Orientation FAQ |
200467 |
/orientation/januaryorientation/faqs/ |
| Family Members |
200497 |
/orientation/januaryorientation/familymembers/ |
| Overnight Lodging |
200498 |
/orientation/januaryorientation/familymembers/overnightlodging/ |
| Before Orientation |
200466 |
/orientation/januaryorientation/preparing/ |
| Placement Assessments |
200469 |
/orientation/januaryorientation/preparing/assessments/ |
| Math Placement Assessment |
200470 |
/orientation/januaryorientation/preparing/assessments/math/ |
| What to Expect |
200474 |
/orientation/januaryorientation/preparing/assessments/math/expect/ |
| MPA Instructions |
200478 |
/orientation/januaryorientation/preparing/assessments/math/mpainstructions/ |
| What's My Placement |
200475 |
/orientation/januaryorientation/preparing/assessments/math/whatsmyplacement/ |
| Retaking the MPA |
200476 |
/orientation/januaryorientation/preparing/assessments/math/retaking-map/ |
| Foreign Language Placement Assessment |
200479 |
/orientation/januaryorientation/preparing/assessments/foreignlang/ |
| Writing Placement Assessment |
200485 |
/orientation/januaryorientation/preparing/assessments/writing/ |
| Overview |
200486 |
/orientation/januaryorientation/preparing/assessments/writing/overview/ |
| Dance Placement Assessment |
200492 |
/orientation/januaryorientation/preparing/assessments/dance/ |
| Technology Roadmap |
200496 |
https://www.luc.edu/its/services/technologyroadmap/newstudents/ |
| Tips for Class Registration |
200468 |
/orientation/januaryorientation/preparing/class-registration/ |
| Summer Orientation |
66019 |
/orientation/summerorientation/ |
| Summer Orientation FAQ |
13517 |
/orientation/summerorientation/faqs/ |
| First-Year Orientation Checklist |
81712 |
/orientation/summerorientation/first-yearorientationchecklist/ |
| Family & Guests |
177444 |
/orientation/summerorientation/familyguests/ |
| Overnight Lodging |
177446 |
/orientation/summerorientation/familyguests/overnightlodging/ |
| Before Orientation |
13520 |
/orientation/summerorientation/preparing/ |
| Placement Assessments |
13528 |
/orientation/summerorientation/preparing/assessments/ |
| Math Placement Assessment |
13545 |
/orientation/summerorientation/preparing/assessments/math/ |
| Majors Requiring Math |
80363 |
/orientation/summerorientation/preparing/assessments/math/majorsrequiringmath/ |
| Overview |
13555 |
/orientation/summerorientation/preparing/assessments/math/overview/ |
| FAQ |
13552 |
/orientation/summerorientation/preparing/assessments/math/map-faq/ |
| Tips |
13558 |
/orientation/summerorientation/preparing/assessments/math/tips/ |
| What to Expect |
13559 |
/orientation/summerorientation/preparing/assessments/math/expect/ |
| MPA Instructions |
142410 |
/orientation/summerorientation/preparing/assessments/math/mpainstructions/ |
| What's My Placement |
13560 |
/orientation/summerorientation/preparing/assessments/math/whatsmyplacement/ |
| Retaking the MPA |
13561 |
/orientation/summerorientation/preparing/assessments/math/retaking-map/ |
| Foreign Language Placement Assessment |
13546 |
/orientation/summerorientation/preparing/assessments/foreignlang/ |
| Overview |
14491 |
/orientation/summerorientation/preparing/assessments/foreignlang/overview/ |
| What is on the Assessment |
14492 |
/orientation/summerorientation/preparing/assessments/foreignlang/whattoexpect/ |
| What's My Placement |
14493 |
/orientation/summerorientation/preparing/assessments/foreignlang/placement/ |
| Can I Retake the Assessment |
14494 |
/orientation/summerorientation/preparing/assessments/foreignlang/retake/ |
| FAQs |
14495 |
/orientation/summerorientation/preparing/assessments/foreignlang/faqs/ |
| Writing Placement Assessment |
13547 |
/orientation/summerorientation/preparing/assessments/writing/ |
| Overview |
14496 |
/orientation/summerorientation/preparing/assessments/writing/overview/ |
| Tips & Information |
14497 |
/orientation/summerorientation/preparing/assessments/writing/tips/ |
| Instructions |
14498 |
/orientation/summerorientation/preparing/assessments/writing/instructions/ |
| What's My Placement |
14499 |
/orientation/summerorientation/preparing/assessments/writing/placement/ |
| Can I Retake the Assessment |
14500 |
/orientation/summerorientation/preparing/assessments/writing/retake/ |
| FAQs |
14501 |
/orientation/summerorientation/preparing/assessments/writing/faqs/ |
| Dance Placement Assessment |
13548 |
/orientation/summerorientation/preparing/assessments/dance/ |
| Technology Roadmap |
146793 |
https://www.luc.edu/its/services/technologyroadmap/newstudents/ |
| Tips for Class Registration |
13525 |
/orientation/summerorientation/preparing/class-registration/ |
| Online Orientation Kickoff Events |
146550 |
/orientation/summerorientation/preparing/onlineorientationkickoffevents/ |
| test |
14538 |
/orientation/summerorientation/preparing/test/ |
| Pre-Orientation Online Modules |
195742 |
/orientation/summerorientation/preparing/pre-orientation-modules/ |
| August 19 Session |
124333 |
/orientation/summerorientation/august19session/ |
| Honors Students |
18330 |
/orientation/summerorientation/honors-learning-community-registration/ |
| Transfers |
66020 |
/orientation/summerorientation/transfers/ |
| Transfer Orientation Checklist |
81714 |
/orientation/summerorientation/transfers/transferorientationchecklist/ |
| Sample Schedule |
81713 |
/orientation/summerorientation/transfers/sampleschedule/ |
| Student-Athletes |
159770 |
/orientation/summerorientation/student-athletes/ |
| Commuter Student Orientations |
194505 |
/orientation/summerorientation/commuterstudentorientations/ |
| After Orientation |
18329 |
/orientation/summerorientation/fallprefall-programs/ |
| Orientation Presentations |
120979 |
/orientation/summerorientation/fallprefall-programs/orientationpresentations/ |
| LUC Resource Rundown |
156391 |
https://www.luc.edu/sas/learningandstudentsuccess/resourcerundown/ |
| Webinar Recordings |
179401 |
/orientation/summerorientation/fallprefall-programs/webinarrecordings/ |
| Register |
13523 |
/orientation/register/ |
| Maps & Directions |
13514 |
/orientation/register/maps/ |
| Lodging |
13519 |
/orientation/register/lodging/ |
| Sample Schedule |
13524 |
/orientation/register/schedule/ |
| For Transfer Students |
13529 |
/orientation/transfer/ |
| Learning Communities |
13540 |
/orientation/lc/ |
| Sample Schedules |
18851 |
/orientation/sample-schedules/ |
| Misc. Photos |
19586 |
/orientation/miscphotosfororientationandfye/ |
| Technology Roadmap |
93800 |
/orientation/technologyroadmap/ |
| Orientation 2020 Icon Assets |
147381 |
/orientation/orientation2020iconassets/ |
| Second-Years |
159996 |
/orientation/second-years/ |
| right_column |
62525 |
/orientation/rightcolumn/ |
| social media |
199486 |
/orientation/socialmedia/ |
| modules-programming |
199487 |
/orientation/modules-programming/ |
| Footer |
199488 |
/orientation/footer/ |
| site_logo |
199489 |
/orientation/sitelogo/ |
| Paralegal Studies |
9906 |
/paralegal-studies/ |
| site_logo |
10184 |
/paralegal-studies/sitelogo/ |
| Footer |
10185 |
/paralegal-studies/footer/ |
| cta |
198526 |
/paralegal-studies/cta/ |
| I Links |
198527 |
/paralegal-studies/ilinks/ |
| social media |
198528 |
/paralegal-studies/socialmedia/ |
| modules-programming |
198529 |
/paralegal-studies/modules-programming/ |
| About Us |
9907 |
/paralegal-studies/aba-approved-paralegal-programs/ |
| right_column |
35823 |
/paralegal-studies/aba-approved-paralegal-programs/rightcolumn/ |
| Why Loyola? |
19560 |
/paralegal-studies/aba-approved-paralegal-programs/why/ |
| Faculty Profiles |
9911 |
/paralegal-studies/certificate-in-paralegal-studies/ |
| Leadership Changes |
101305 |
/paralegal-studies/certificate-in-paralegal-studies/leadershipchanges/ |
| Internships |
9918 |
/paralegal-studies/paralegal-training-programs/ |
| ABA Approved Certificates |
19860 |
/paralegal-studies/aba-approved-paralegal-programs/aba/ |
| Paralegal Profession |
9909 |
/paralegal-studies/become-a-paralegal/ |
| Visit Us |
198547 |
https://www.luc.edu/scps/visitus/ |
| Welcome from the Director |
120828 |
/paralegal-studies/aba-approved-paralegal-programs/welcomefromthedirector/ |
| Academics |
9915 |
/paralegal-studies/academics/ |
| right_column |
68674 |
/paralegal-studies/academics/rightcolumn/ |
| Litigation Practice |
191270 |
https://gpem.luc.edu/portal/program?name=paralegalstudiescertificates |
| Corporate Practice |
191271 |
https://gpem.luc.edu/portal/program?name=paralegalstudiescertificates |
| Litigation and Corporate Practice Certificate |
191272 |
https://gpem.luc.edu/portal/program?name=paralegalstudiescertificates |
| Customized Certificate |
191273 |
https://gpem.luc.edu/portal/program?name=paralegalstudiescertificates |
| BA in Paralegal Studies |
191274 |
https://gpem.luc.edu/portal/program?name=paralegalstudiesba |
| Schedules |
9920 |
/paralegal-studies/paralegal-classes/ |
| Admission |
9923 |
/paralegal-studies/how-to-become-a-paralegal/index.shtml |
| right_column |
120832 |
/paralegal-studies/how-to-become-a-paralegal/rightcolumn/ |
| Admission Requirements |
154404 |
/paralegal-studies/how-to-become-a-paralegal/admissionrequirements/ |
| Deadlines |
9925 |
/paralegal-studies/paralegal-school/ |
| Tuition & Financial Aid |
9926 |
/paralegal-studies/paralegal-certificate-programs/index.shtml |
| Information for Students |
68691 |
/paralegal-studies/informationforstudents/ |
| Resources |
159543 |
https://www.luc.edu/info/bookstore.shtml |
| FERPA |
10052 |
/paralegal-studies/informationforstudents/ferpa/ |
| Financial Aid |
10053 |
/paralegal-studies/informationforstudents/finaid/ |
| Technology |
10055 |
/paralegal-studies/informationforstudents/its/ |
| Transportation |
10061 |
/paralegal-studies/informationforstudents/transportation/ |
| WIA |
10063 |
/paralegal-studies/informationforstudents/wia/ |
| Alumni |
53200 |
/paralegal-studies/alumni/ |
| News |
30365 |
/paralegal-studies/news/ |
| archive |
90386 |
/paralegal-studies/news/archive/ |
| Paralegal Moves Online |
149738 |
/paralegal-studies/archives/paralegalonline/ |
| Parkinson School of Health Sciences and Public Health |
178143 |
/parkinson/ |
| site_logo |
178152 |
/parkinson/sitelogo/ |
| Footer |
178153 |
/parkinson/footer/ |
| cta |
178154 |
/parkinson/cta/ |
| social media |
178157 |
/parkinson/socialmedia/ |
| modules-programming |
178156 |
/parkinson/modules-programming/ |
| About |
178144 |
/parkinson/about/ |
| Our Mission |
178164 |
/parkinson/about/ourmission/ |
| Welcome from the Dean |
178165 |
/parkinson/about/welcomefromthedean/ |
| News & Events |
178166 |
/parkinson/about/newsevents/ |
| archive |
178167 |
/parkinson/about/newsevents/archive/ |
| Loyola Chicago Health Equity Quest tackles cardiovascular health |
207374 |
/parkinson/about/newsevents/archive/health-equity-quest-2025/ |
| 2023 Parkinson Scholars |
188799 |
/parkinson/about/newsevents/2023parkinsonscholars/ |
| 2024 Parkinson Scholars |
199081 |
/parkinson/about/newsevents/2024parkinsonscholars/ |
| 2025 Parkinson Scholars |
205009 |
/parkinson/about/newsevents/2025parkinsonscholars/ |
| Faculty and Staff Awards |
207203 |
/parkinson/about/newsevents/facultyandstaffawards/ |
| News and Events |
207204 |
/parkinson/about/newsevents/ |
| Our Story |
188569 |
/parkinson/about/ourstory/ |
| Parkinson Impact Report |
200452 |
/parkinson/about/parkinsonimpactreport/ |
| Message from the Dean |
200454 |
/parkinson/about/parkinsonimpactreport/messagefromthedean/ |
| Our Story |
200455 |
/parkinson/about/parkinsonimpactreport/ourstory/ |
| Academic Growth |
200456 |
/parkinson/about/parkinsonimpactreport/academicgrowth/ |
| Pillar Events |
200458 |
/parkinson/about/parkinsonimpactreport/pillarevents/ |
| Centers & Institutes |
200459 |
/parkinson/about/parkinsonimpactreport/centersinstitutes/ |
| Community Engagement: Covid-19 |
200461 |
/parkinson/about/parkinsonimpactreport/communityengagementcovid-19/ |
| Experiential Learning |
200457 |
/parkinson/about/parkinsonimpactreport/experientiallearning/ |
| Scholarships |
200460 |
/parkinson/about/parkinsonimpactreport/scholarships/ |
| Student/Alumni Spotlights |
200462 |
/parkinson/about/parkinsonimpactreport/studentalumnispotlights/ |
| Thought Leadership |
200463 |
/parkinson/about/parkinsonimpactreport/thoughtleadership/ |
| Faculty/Staff Spotlights |
200770 |
/parkinson/about/parkinsonimpactreport/facultystaffspotlights/ |
| Community Partnerships |
200771 |
/parkinson/about/parkinsonimpactreport/communitypartnerships/ |
| Alumni |
178249 |
/parkinson/about/alumni/ |
| Contact Us |
178170 |
/parkinson/about/contactus/ |
| Thank You |
178171 |
/parkinson/about/contactus/thankyou/ |
| Dean's Communications |
178248 |
/parkinson/about/deanscommunications/ |
| archive |
178777 |
/parkinson/about/deanscommunications/archive/ |
| Admission |
178145 |
/parkinson/admission/ |
| Apply |
178333 |
/parkinson/admission/apply/ |
| Master of Public Health |
178335 |
/parkinson/admission/apply/masterofpublichealth/ |
| MS in Exercise Science |
178336 |
/parkinson/admission/apply/msinexercisescience/ |
| MS Medical Lab Science |
178337 |
/parkinson/admission/apply/msmedicallabscience/ |
| MS Health Informatics |
178338 |
/parkinson/admission/apply/mshealthinformatics/ |
| MS in Dietetics |
178339 |
/parkinson/admission/apply/msindietetics/ |
| Dietetic Internship |
178340 |
/parkinson/admission/apply/dieteticinternship/ |
| Master of Healthcare Administration |
178342 |
/parkinson/admission/apply/masterofhealthcareadministration/ |
| MS in Implementation Science |
178720 |
/parkinson/academics/msinimplementationscience/ |
| Tuition and Financial Aid |
178334 |
/parkinson/admission/tuitionandfinancialaid/ |
| Scholarships |
189920 |
/parkinson/admission/scholarships/ |
| Accreditation |
178415 |
/parkinson/admission/accreditation/ |
| Visit Us |
178172 |
/parkinson/admission/visitus/ |
| Academics |
178146 |
/parkinson/academics/ |
| Departments |
178392 |
/parkinson/academics/departments/ |
| Public Health Sciences |
178403 |
/parkinson/academics/departments/publichealthsciences/ |
| BA in Public Health |
205781 |
/parkinson/academics/departments/publichealthsciences/bainpublichealth/ |
| BS in Public Health |
207160 |
/parkinson/academics/departments/publichealthsciences/bsinpublichealth/ |
| MPH |
178408 |
/parkinson/academics/departments/publichealthsciences/mph/ |
| MS in Clinical Research Methods and Epidemiology |
178410 |
/parkinson/academics/departments/publichealthsciences/msinclinicalresearchmethodsandepidemiology/ |
| Public Health Certificate |
178411 |
/parkinson/academics/departments/publichealthsciences/publichealthcertificate/ |
| MD/MPH |
178412 |
/parkinson/academics/departments/publichealthsciences/mdmph/ |
| MSW/MPH |
178413 |
/parkinson/academics/departments/publichealthsciences/mswmph/ |
| modules-programming |
178597 |
/parkinson/academics/departments/publichealthsciences/modules-programming/ |
| Health Informatics & Data Science |
178404 |
/parkinson/academics/departments/healthinformaticsdatascience/ |
| MS Health Informatics |
178416 |
/parkinson/academics/departments/healthinformaticsdatascience/mshealthinformatics/ |
| Certificate in Health Informatics |
178417 |
/parkinson/academics/departments/healthinformaticsdatascience/certificateinhealthinformatics/ |
| modules-programming |
178794 |
/parkinson/academics/departments/healthinformaticsdatascience/modules-programming/ |
| Healthcare Administration |
178405 |
/parkinson/academics/departments/healthcareadministration/ |
| BS Healthcare Administration |
178418 |
/parkinson/academics/departments/healthcareadministration/bshealthcareadministration/ |
| right_column |
178463 |
/parkinson/academics/departments/healthcareadministration/bshealthcareadministration/rightcolumn/ |
| External Advisory Board |
178448 |
/parkinson/academics/departments/healthcareadministration/bshealthcareadministration/externaladvisoryboard/ |
| BS Healthcare Administration/MPH |
178419 |
/parkinson/academics/departments/healthcareadministration/bshealthcareadministrationmph/ |
| Master in Healthcare Administration |
178420 |
/parkinson/academics/departments/healthcareadministration/masterinhealthcareadministration/ |
| Master in Healthcare Administration Guide |
178449 |
/parkinson/academics/departments/healthcareadministration/masterinhealthcareadministration/masterinhealthcareadministrationguide/ |
| BS in Healthcare Administration/MBA |
178421 |
/parkinson/academics/departments/healthcareadministration/bsinhealthcareadministrationmba/ |
| BS Healthcare Administration/MHA |
178422 |
/parkinson/academics/departments/healthcareadministration/bshealthcareadministrationmha/ |
| Healthcare Administration Minor |
178423 |
/parkinson/academics/departments/healthcareadministration/healthcareadministrationminor/ |
| modules-programming |
178462 |
/parkinson/academics/departments/healthcareadministration/modules-programming/ |
| Applied Health Sciences |
178406 |
/parkinson/academics/departments/appliedhealthsciences/ |
| Medical Laboratory Science |
178424 |
/parkinson/mls/index.shtml |
| MS in Medical Laboratory Science |
178603 |
/parkinson/mls/msinmedicallaboratoryscience/ |
| MLS Curriculum |
178604 |
/parkinson/mls/mlscurriculum/ |
| Academic Calendar, Handbook, and pdfs |
178619 |
/parkinson/mls/academiccalendarhandbookandpdfs/ |
| Parkinson School Graduate Student Handbook |
181031 |
/parkinson/mls/parkinsonschoolgraduatestudenthandbook/ |
| Information Sessions |
181437 |
/parkinson/mls/informationsessions/ |
| MLS Immersion Experience |
183825 |
/parkinson/mls/mlsimmersionexperience/ |
| Medical Laboratory Science Clinical Certificate Programs |
191147 |
/parkinson/mls/medicallaboratoryscienceclinicalcertificateprograms/ |
| Dietetics |
178425 |
/parkinson/academics/departments/appliedhealthsciences/dietetics/ |
| MS Dietetics |
204419 |
https://gpem.luc.edu/portal/program?name=dieteticsms |
| MS in Dietetics + Dietetic Internship |
204241 |
/parkinson/academics/departments/appliedhealthsciences/dietetics/msindieteticsdieteticinternship/ |
| Tuition and Fees |
204242 |
/parkinson/academics/departments/appliedhealthsciences/dietetics/msindieteticsdieteticinternship/tuitionandfees/ |
| Mission Goals Outcomes |
204243 |
/parkinson/academics/departments/appliedhealthsciences/dietetics/msindieteticsdieteticinternship/missiongoalsoutcomes/ |
| Dietetic Internship Open House |
204244 |
/parkinson/academics/departments/appliedhealthsciences/dietetics/msindieteticsdieteticinternship/dieteticinternshipopenhouse/ |
| Exercise Science |
178426 |
/parkinson/academics/departments/appliedhealthsciences/exercisescience/ |
| BS Exercise Science |
178610 |
/parkinson/academics/departments/appliedhealthsciences/exercisescience/bsexercisescience/ |
| Exercise Science Minor |
178613 |
/parkinson/academics/departments/appliedhealthsciences/exercisescience/bsexercisescience/exercisescienceminor/ |
| MS in Exercise Science |
178611 |
/parkinson/academics/departments/appliedhealthsciences/exercisescience/msinexercisescience/ |
| Exercise Science Laboratories |
178612 |
/parkinson/academics/departments/appliedhealthsciences/exercisescience/exercisesciencelaboratories/ |
| modules-programming |
178615 |
/parkinson/academics/departments/appliedhealthsciences/modules-programming/ |
| Undergraduate Degrees |
185996 |
/parkinson/academics/undergraduatedegrees/ |
| BS in Health Science |
207407 |
/parkinson/academics/undergraduatedegrees/bsinhealthscience/ |
| Graduate Degrees |
185997 |
/parkinson/academics/graduatedegrees/ |
| Dual Degree Programs |
185998 |
/parkinson/academics/dualdegreeprograms/ |
| Non-Degree Programs |
185999 |
/parkinson/academics/non-degreeprograms/ |
| Experiential Learning |
178277 |
/parkinson/academics/experientiallearning/ |
| HCA Internship - one sheeter |
178289 |
https://www.luc.edu/media/lucedu/schoolhealthsciencespublichealth/documents/Loyola%20Parkinson%20HCA%20internship%20flyer.pdf |
| Exercise Science Internship - one sheeter |
178290 |
https://www.luc.edu/media/lucedu/schoolhealthsciencespublichealth/documents/Flyer%20-%20BA%20Exercise%20Science%20Program.pdf |
| Degree Programs |
178391 |
/parkinson/academics/degreeprograms/ |
| MS in Implementation Science |
178393 |
/parkinson/academics/msinimplementationscience/ |
| Academic Advising |
178394 |
/parkinson/academics/academicadvising/ |
| Academic Policies |
178395 |
/parkinson/academics/academicpolicies/ |
| Our People |
178147 |
/parkinson/ourpeople/ |
| Faculty |
178739 |
https://www.luc.edu/parkinson/ourpeople/facultydirectory/?filter=Faculty |
| Staff |
178740 |
https://www.luc.edu/parkinson/ourpeople/staffdirectory/?filter=Staff |
| Join Our Team |
178733 |
/parkinson/ourpeople/joinourteam/ |
| Faculty Directory |
178734 |
/parkinson/ourpeople/facultydirectory/ |
| profiles |
178737 |
/parkinson/ourpeople/facultystaffprofiles/ |
| right_column |
202420 |
/parkinson/ourpeople/facultystaffprofiles/rightcolumn/ |
| Staff Directory |
178735 |
/parkinson/ourpeople/staffdirectory/ |
| Research and Practice |
178148 |
/parkinson/researchandpractice/ |
| Center for Health Innovation and Entrepreneurship (CHIE) |
178355 |
/parkinson/researchandpractice/centerforhealthinnovationandentrepreneurship/ |
| I-CORPS |
178363 |
/parkinson/researchandpractice/centerforhealthinnovationandentrepreneurship/i-corps/ |
| Designing for Implementation and Sustainability Certificate |
202785 |
/parkinson/researchandpractice/centerforhealthinnovationandentrepreneurship/sample1/ |
| right_column |
202924 |
/parkinson/researchandpractice/centerforhealthinnovationandentrepreneurship/sample1/rightcolumn/ |
| Rebuilding Beyond COVID-19 |
178361 |
/parkinson/researchandpractice/centerforhealthinnovationandentrepreneurship/rebuildingbeyondcovid-19/ |
| CHIE - Climate Change Conference |
178362 |
/parkinson/researchandpractice/centerforhealthinnovationandentrepreneurship/chie-climatechangeconference/ |
| Sample 2 - Accordion without info graphic |
202786 |
/parkinson/researchandpractice/centerforhealthinnovationandentrepreneurship/sample2/ |
| Sample 3 - Intro and cards |
202862 |
/parkinson/researchandpractice/centerforhealthinnovationandentrepreneurship/sample3/ |
| Center for Health Outcomes and Informatics Research (CHOIR) |
178352 |
/parkinson/researchandpractice/choir/ |
| Salon: Data Science Day |
205701 |
/parkinson/researchandpractice/choir/salondatascienceday/ |
| Salon '26 |
204918 |
/parkinson/researchandpractice/choir/salondatascienceday/salon26/ |
| Salon '25 |
202360 |
/parkinson/researchandpractice/choir/salon25/ |
| Health Informatics Seminar Series |
178360 |
/parkinson/researchandpractice/choir/health-informatics-seminar-series/ |
| Application of Digital Pathology in Clinical Practice, Education and Research |
178775 |
/parkinson/researchandpractice/choir/health-informatics-seminar-series/applicationofdigitalpathologyinclinicalpracticeeducationandresearch/ |
| Estimating Potential Increase in Hospitalizations and Deaths Associated with the Emergence of the Omicron Variant in North Carolina |
178756 |
/parkinson/researchandpractice/choir/health-informatics-seminar-series/estimatingpotentialincreaseinhospitalizationsanddeathsassociatedwiththeemergenceoftheomicronvariantinnorthcarolina/ |
| Mitigating Emergency Department Overcrowding Problem Using Machine Learning |
178757 |
/parkinson/researchandpractice/choir/health-informatics-seminar-series/mitigatingemergencydepartmentovercrowdingproblemusingmachinelearning/ |
| AI in Digital Pathology |
178755 |
/parkinson/researchandpractice/choir/health-informatics-seminar-series/aiindigitalpathology/ |
| Deep Learning and Natural Language Processing Methods for Mining Electronic Medical Records |
178754 |
/parkinson/researchandpractice/choir/health-informatics-seminar-series/deeplearningandnaturallanguageprocessingmethodsforminingelectronicmedicalrecords/ |
| Understanding and Using Natural Language Processing |
178753 |
/parkinson/researchandpractice/choir/health-informatics-seminar-series/understandingandusingnaturallanguageprocessing/ |
| ECG-AI: Electrocardiographic Artifical Intelligence Model for Prediction of Heart Failure |
178752 |
/parkinson/researchandpractice/choir/health-informatics-seminar-series/ecg-aielectrocardiographicartificalintelligencemodelforpredictionofheartfailure/ |
| Artifical Intelligence Can Predict the Risk of ARDS, ICU Admission, and Mortality |
178751 |
/parkinson/researchandpractice/choir/health-informatics-seminar-series/artificalintelligencecanpredicttheriskofardsicuadmissionandmortality/ |
| Healthcare Analytics with Bandits and Transfer Learning |
178750 |
/parkinson/researchandpractice/choir/health-informatics-seminar-series/healthcareanalyticswithbanditsandtransferlearning/ |
| Diabetes Treatment/Benefit Paradox Exposed by Real-world Data |
178749 |
/parkinson/researchandpractice/choir/health-informatics-seminar-series/diabetestreatmentbenefitparadoxexposedbyreal-worlddata/ |
| Making Free Text Reports Available for Researchers via a De-Identification and Natural Language Processing Pipeline |
178748 |
/parkinson/researchandpractice/choir/health-informatics-seminar-series/makingfreetextreportsavailableforresearchersviaade-identificationandnaturallanguageprocessingpipeline/ |
| Artifical Intelligence in Cardiology |
178746 |
/parkinson/researchandpractice/choir/health-informatics-seminar-series/artificalintelligenceincardiology/ |
| Public Health Informatics, COVID-19, and Vaccination Rollout |
178747 |
/parkinson/researchandpractice/choir/health-informatics-seminar-series/publichealthinformaticscovid-19andvaccinationrollout/ |
| An Introduction to Bayesian Modeling for Biomedical Research via COVID-19 Models |
178745 |
/parkinson/researchandpractice/choir/health-informatics-seminar-series/anintroductiontobayesianmodelingforbiomedicalresearchviacovid-19models/ |
| Enhancing Clinical Care Using Augmented Human Intelligence |
178744 |
/parkinson/researchandpractice/choir/health-informatics-seminar-series/enhancingclinicalcareusingaugmentedhumanintelligence/ |
| An Under the Hood Introduction to Artificial Neural Networks |
178743 |
/parkinson/researchandpractice/choir/health-informatics-seminar-series/anunderthehoodintroductiontoartificialneuralnetworks/ |
| Optum’s Digital Research Network and De-Identified Data Workspace |
178776 |
/parkinson/researchandpractice/choir/health-informatics-seminar-series/optumsdigitalresearchnetworkandde-identifieddataworkspace/ |
| Identifying High-Performance Teamwork |
179616 |
/parkinson/researchandpractice/choir/health-informatics-seminar-series/identifyinghigh-performanceteamwork/ |
| Challenges and Opportunities in Curating Large Administrative and Clinical Datasets for Research Use |
179742 |
/parkinson/researchandpractice/choir/health-informatics-seminar-series/challengesandopportunitiesincuratinglargeadministrativeandclinicaldatasetsforresearchuse/ |
| Designing the MDScan Framework for Mental Health Screening |
181781 |
/parkinson/researchandpractice/choir/health-informatics-seminar-series/designingthemdscanframeworkformentalhealthscreening/ |
| Automating Patient Triage in Mayo Clinic's Multidisciplinary Dizziness Practice |
182455 |
/parkinson/researchandpractice/choir/health-informatics-seminar-series/automatingpatienttriageinmayoclinicsmultidisciplinarydizzinesspractice/ |
| Mining Text Messages to Understand What Matters |
184231 |
/parkinson/researchandpractice/choir/health-informatics-seminar-series/miningtextmessagestounderstandwhatmatters/ |
| Machine Learning to Augment Cardio-Oncology Medical Practice Operations and Advance Medical Science |
184232 |
/parkinson/researchandpractice/choir/health-informatics-seminar-series/machinelearningtoaugmentcardio-oncologymedicalpracticeoperationsandadvancemedicalscience/ |
| Delta Coverage: A Novel Nurse Deployment Solution |
186930 |
/parkinson/researchandpractice/choir/health-informatics-seminar-series/deltacoverageanovelnursedeploymentsolution/ |
| Beyond the Numbers: Navigating the Challenges of Health Informatics in the Post-Pandemic Era |
186931 |
/parkinson/researchandpractice/choir/health-informatics-seminar-series/beyondthenumbersnavigatingthechallengesofhealthinformaticsinthepost-pandemicera/ |
| Review and Updates for the Clinical Natural Language Processing Engines at LUC |
186932 |
/parkinson/researchandpractice/choir/health-informatics-seminar-series/reviewandupdatesfortheclinicalnaturallanguageprocessingenginesatluc/ |
| Generative AI: Review of Large Language Models and their Applications in Biomedical Domain |
186951 |
/parkinson/researchandpractice/choir/health-informatics-seminar-series/generativeaireviewoflargelanguagemodelsandtheirapplicationsinbiomedicaldomain/ |
| Designing Technology for Low Literacy Individuals Understanding Users Before, During, and After the Interaction |
204500 |
/parkinson/researchandpractice/choir/health-informatics-seminar-series/designingtechnologyforlowliteracyindividualsunderstandingusersbeforeduringandaftertheinteraction/ |
| The Clinical Research Database (CRDB): Ron Price |
204501 |
/parkinson/researchandpractice/choir/health-informatics-seminar-series/theclinicalresearchdatabasecrdbronprice/ |
| The Path to Implementation of AI for Prehospital Stroke Triage |
204664 |
/parkinson/researchandpractice/choir/health-informatics-seminar-series/thepathtoimplementationofaiforprehospitalstroketriage/ |
| A Large Dataset of Aggregate Online Job Postings |
205344 |
/parkinson/researchandpractice/choir/health-informatics-seminar-series/alargedatasetofaggregateonlinejobpostings/ |
| CHOIR Impact Report |
202362 |
/parkinson/researchandpractice/choir/choirimpactreport/ |
| Director's Welcome |
202375 |
/parkinson/researchandpractice/choir/choirimpactreport-dev/directorswelcome/ |
| profiles |
202365 |
/parkinson/researchandpractice/choir/choirimpactreport-dev/profiles/ |
| Black Women and Mental Wellness |
202366 |
/parkinson/researchandpractice/choir/choirimpactreport-dev/profiles/blackwomenandmentalwellness/ |
| Depression and Health Equity |
202367 |
/parkinson/researchandpractice/choir/choirimpactreport-dev/profiles/depressionandhealthequity/ |
| Chronic Kidney Disease Mobile App |
202368 |
/parkinson/researchandpractice/choir/choirimpactreport-dev/profiles/chronickidneydiseasemobileapp/ |
| Postoperative Outcomes |
202369 |
/parkinson/researchandpractice/choir/choirimpactreport-dev/profiles/postoperativeoutcomes/ |
| Respiratory Distress and Heart Health |
202370 |
/parkinson/researchandpractice/choir/choirimpactreport-dev/profiles/respiratorydistressandhearthealth/ |
| Delirium Phenotypes |
202371 |
/parkinson/researchandpractice/choir/choirimpactreport-dev/profiles/deliriumphenotypes/ |
| Stress, Racism and Sleep |
202372 |
/parkinson/researchandpractice/choir/choirimpactreport-dev/profiles/stressracismandsleep/ |
| Body Composition, Nutrition and COVID |
202373 |
/parkinson/researchandpractice/choir/choirimpactreport-dev/profiles/bodycompositionnutritionandcovid/ |
| Idiake “Dee” Irumundomon |
202374 |
/parkinson/researchandpractice/choir/choirimpactreport-dev/profiles/idiakedeeirumundomon/ |
| CHOIR Funding Opportunities |
178358 |
/parkinson/researchandpractice/choir/choirfundingopportunities/ |
| Community Equity Response Collaborative (CERCL) |
178356 |
/parkinson/researchandpractice/cercl/ |
| Health EQ Collaborative |
178354 |
/parkinson/researchandpractice/healtheqcollaborative/ |
| Institute for Translational Medicine (ITM) |
178353 |
/parkinson/researchandpractice/itm/ |
| Research Opportunities |
178281 |
/parkinson/researchandpractice/researchopportunities/ |
| Community Engagement |
178151 |
/parkinson/researchandpractice/communityengagement/ |
| Loyola Stands Against Gun Violence |
203954 |
/parkinson/researchandpractice/loyolastandsagainstgunviolence/ |
| Student Experience |
178149 |
/parkinson/studentexperience/ |
| Student Life |
178273 |
/parkinson/studentexperience/studentlife/ |
| Our Campus |
188863 |
/parkinson/studentexperience/ourcampus/ |
| Recognition |
178279 |
/parkinson/studentexperience/recognition/ |
| Career Services |
178274 |
/parkinson/studentexperience/careerservices/ |
| Libraries |
178278 |
/parkinson/studentexperience/libraries/ |
| Commencement Week |
178282 |
/parkinson/studentexperience/commencementweek/ |
| Graduate Student Opportunities |
188231 |
/parkinson/studentexperience/graduatestudentopportunities/ |
| Request for Information |
178150 |
/parkinson/requestforinformation/ |
| Request for Information - Undergraduate Programs |
178330 |
/parkinson/requestforinformation/requestforinformation-undergraduateprograms/ |
| Request for Information - Graduate Programs |
178331 |
/parkinson/requestforinformation/requestforinformation-graduateprograms/ |
| Assets |
205029 |
/parkinson/assets/ |
| Peace, Justice and Conflict Studies |
12370 |
/peace/index.shtml |
| About Us |
94168 |
/peace/aboutus/ |
| About the Program |
154136 |
/peace/aboutus/abouttheprogram/ |
| History of the Program |
154135 |
/peace/aboutus/historyoftheprogram/ |
| Minor Requirements |
94163 |
/peace/minorrequirements/ |
| Course List |
94164 |
/peace/minorrequirements/courselist/ |
| Double-Dipping Course Policy |
154137 |
/peace/minorrequirements/double-dippingcoursepolicy/ |
| Faculty Advisory Board |
94171 |
/peace/facultyadvisoryboard/ |
| Programs and Activities |
154144 |
/peace/programsandactivities/ |
| Past Conferences |
154145 |
/peace/programsandactivities/pastconferences/ |
| Past Speakers |
154146 |
/peace/programsandactivities/pastspeakers/ |
| Resources |
154141 |
/peace/resources/ |
| Organizations |
154142 |
/peace/resources/organizations/ |
| Topics |
154143 |
/peace/resources/topics/ |
| Footer |
12374 |
/peace/footer/ |
| site_logo |
12375 |
/peace/site_logo/ |
| social media |
202543 |
/peace/socialmedia/ |
| cta |
202544 |
/peace/cta/ |
| PeopleGrove Assets |
162991 |
/peoplegroveassets/ |
| Department of Philosophy |
36553 |
/philosophy/index.shtml |
| site_logo |
36779 |
/philosophy/sitelogo/ |
| Footer |
36778 |
/philosophy/footer/ |
| modules-programming |
198559 |
/philosophy/modules-programming/ |
| About Us |
36354 |
/philosophy/about.shtml |
| Welcome & Location |
36396 |
/philosophy/welcome.shtml |
| Contact Us |
36365 |
/philosophy/contactus.shtml |
| Department Administration |
72817 |
/philosophy/departmentadministration/ |
| News and Events |
198775 |
/philosophy/newsandevents/ |
| News Photo Pages |
199272 |
/philosophy/newsandevents/newsphotopages/ |
| Congratulations to our 2024 Award Winners! |
194804 |
/philosophy/newsandevents/newsphotopages/congratulationstoour2024awardwinners/ |
| 2024 Faculty Debate |
199274 |
/philosophy/newsandevents/newsphotopages/2024facultydebate/ |
| Congratulations, Ethics Bowl Team! |
200414 |
/philosophy/newsandevents/newsphotopages/congratulationsethicsbowlteam/ |
| Congratulations, 2025 Award Winners! |
202804 |
/philosophy/newsandevents/newsphotopages/congratulations2025awardwinners/ |
| right_column |
204268 |
/philosophy/newsandevents/newsphotopages/congratulations2025awardwinners/rightcolumn/ |
| Angela Davis Talk at SFSU |
194706 |
/philosophy/newsandevents/newsphotopages/angeladavistalkatsfsu/ |
| 2026 Big Questions Lecture |
203483 |
/philosophy/newsandevents/newsphotopages/2026bigquestionslecture/ |
| Congratulations, 2026 Award Winners! |
207128 |
/philosophy/newsandevents/newsphotopages/congratulations2026awardwinners/ |
| right_column |
207129 |
/philosophy/newsandevents/newsphotopages/congratulations2026awardwinners/rightcolumn/ |
| Congratulations, 2026 Graduates! |
206835 |
/philosophy/newsandevents/newsphotopages/congratulations2026graduates/ |
| right_column |
206836 |
/philosophy/newsandevents/newsphotopages/congratulations2026graduates/rightcolumn/ |
| News Archive |
93281 |
/philosophy/newsarchive/ |
| 2024-2025 |
203488 |
/philosophy/newsarchive/2024-2025/ |
| 2023-2024 |
203132 |
/philosophy/newsarchive/2023-2024/ |
| Department News |
93282 |
/philosophy/newsarchive/departmentnews/ |
| AY 2022-2023 |
194446 |
/philosophy/newsarchive/departmentnews/archive/ay2022-2023/ |
| AY 2021-2022 |
194447 |
/philosophy/newsarchive/departmentnews/archive/ay2021-2022/ |
| AY 2020-2021 |
194448 |
/philosophy/newsarchive/departmentnews/archive/ay2020-2021/ |
| Interviews |
194465 |
/philosophy/newsarchive/departmentnews/archive/interviews/ |
| Interview with MaryKate Brueck |
194771 |
/philosophy/newsarchive/departmentnews/archive/interviews/interviewwithmarykatebrueck/ |
| Interview with Sumaya Noush |
194793 |
/philosophy/newsarchive/departmentnews/archive/interviews/interviewwithsumayanoush/ |
| An Interview with Dr. Naomi Fisher |
194794 |
/philosophy/newsarchive/departmentnews/archive/interviews/aninterviewwithdrnaomifisher/ |
| An Interview with Dr. Kristen Irwin |
194797 |
/philosophy/newsarchive/departmentnews/archive/interviews/aninterviewwithdrkristenirwin/ |
| An Interview with Dr. Johanna Oksala |
194798 |
/philosophy/newsarchive/departmentnews/archive/interviews/aninterviewwithdrjohannaoksala/ |
| An Interview with Dr. Joe Vukov |
194799 |
/philosophy/newsarchive/departmentnews/archive/interviews/aninterviewwithdrjoevukov/ |
| An Interview with Dr. Richard Kim |
194800 |
/philosophy/newsarchive/departmentnews/archive/interviews/aninterviewwithdrrichardkim/ |
| An Interview with Dr. David Ingram |
194801 |
/philosophy/newsarchive/departmentnews/archive/interviews/aninterviewwithdrdavidingram/ |
| An Interview with Dr. Joy Gordon |
194802 |
/philosophy/newsarchive/departmentnews/archive/interviews/aninterviewwithdrjoygordon/ |
| An Interview with Dr. Jacqueline Scott |
194803 |
/philosophy/newsarchive/departmentnews/archive/interviews/aninterviewwithdrjacquelinescott/ |
| 2015-2020 |
194782 |
/philosophy/newsarchive/departmentnews/archive/2015-2020/ |
| AY 2019-2020 |
194449 |
/philosophy/newsarchive/departmentnews/archive/2015-2020/ay2019-2020/ |
| AY 2018-2019 |
194450 |
/philosophy/newsarchive/departmentnews/archive/2015-2020/ay2018-2019/ |
| AY 2017-2018 |
194451 |
/philosophy/newsarchive/departmentnews/archive/2015-2020/ay2017-2018/ |
| AY 2016-2017 |
194452 |
/philosophy/newsarchive/departmentnews/archive/2015-2020/ay2016-2017/ |
| AY 2015-2016 |
194464 |
/philosophy/newsarchive/departmentnews/archive/2015-2020/ay2015-2016/ |
| Pre AY 2015-2016 |
194466 |
/philosophy/newsarchive/departmentnews/archive/2015-2020/preay2015-2016/ |
| right_column |
85312 |
/philosophy/rightcolumn/ |
| People |
72742 |
/philosophy/people/ |
| right_column |
85313 |
/philosophy/people/rightcolumn/ |
| Faculty |
116112 |
/philosophy/people/faculty/ |
| Full-Time Faculty |
36375 |
/philosophy/faculty_fulltime.shtml |
| FT Faculty Profile Aggregate Page |
199592 |
/philosophy/ftfacultyprofileaggregatepage/ |
| Profiles |
198635 |
/philosophy/profiles/ |
| right_column |
198636 |
/philosophy/profiles/rightcolumn/ |
| Professors Emeriti and Others |
36387 |
/philosophy/faculty_emeriti.shtml |
| Emeriti Profile Aggregate Page |
204973 |
/philosophy/emeritiprofileaggregatepage/ |
| Profiles |
203059 |
/philosophy/profiles/ |
| right_column |
203060 |
/philosophy/profiles/rightcolumn/ |
| Faculty and Staff Resources |
72749 |
/philosophy/people/faculty/facultyandstaffresources/ |
| Preparing Syllabi for Core Philosophy Courses |
36561 |
/philosophy/coresyllabi.shtml |
| In Memoriam |
203612 |
/philosophy/people/faculty/inmemoriam/ |
| Faculty Spotlight |
198573 |
/philosophy/people/facultyspotlight/ |
| Current Graduate Students |
124358 |
/philosophy/currentgraduatestudents/ |
| Philosophy Librarian |
61909 |
http://libguides.luc.edu/philosophy |
| Undergraduate |
72743 |
/philosophy/undergraduate/ |
| Majors and Minors |
116113 |
/philosophy/undergraduate/majorsandminors/ |
| BA in Philosophy |
36400 |
/philosophy/ba.shtml |
| Philosophy Major Specializations |
168131 |
/philosophy/undergraduate/majorsandminors/philosophymajorspecializations/ |
| Honors in Philosophy |
36412 |
/philosophy/honors.shtml |
| Minor in Philosophy |
36428 |
/philosophy/minor.shtml |
| Minor in Philosophy Checklist |
36913 |
/philosophy/minorinphilosophychecklist/ |
| Forms and Program Checklists |
72750 |
/philosophy/formsandprogramchecklists/ |
| Minor in Bioethics |
73132 |
/bioethics/ |
| Minor in Ethics and Moral Philosophy |
36427 |
/philosophy/minor_ethics.shtml |
| Accelerated Masters Pathway in Philosophy |
205550 |
/philosophy/phdandmaprograms/amp_philosophy.shtml |
| Accelerated Masters Pathway in Social Philosophy |
205551 |
/philosophy/phdandmaprograms/amp_social.shtml |
| Philosophy at the Rome Center |
36431 |
/philosophy/rome.shtml |
| Honors in Philosophy |
207046 |
/philosophy/honors.shtml |
| Undergraduate Admission |
72751 |
/philosophy/undergraduate/undergraduateadmission/ |
| Undergraduate Testimonials |
109366 |
/philosophy/undergraduate/undergraduateadmission/undergraduatetestimonials/ |
| Undergraduate Course Offerings |
36404 |
/philosophy/undergraduate/undergraduatecourseofferings/ |
| Undergraduate Student Resources |
72747 |
/philosophy/undergraduate/undergraduatestudentresources/ |
| Basic Ethics Reader |
36557 |
/philosophy/basic_ethics_reader.shtml |
| Ethics Readings |
36541 |
/philosophy/Ethics_Readings.shtml |
| BA in Philosophy Checklist |
36909 |
/philosophy/undergraduate/undergraduatestudentresources/bainphilosophychecklist/ |
| Philosophy Club |
36576 |
/philosophy/Club.shtml |
| Phi Sigma Tau Honor Society |
36432 |
/philosophy/phi_sigma_tau.shtml |
| University Libraries |
36565 |
/philosophy/libraries.html |
| University Centers |
36566 |
/philosophy/university_centers.shtml |
| Student Awards and Competitions |
191610 |
/philosophy/undergraduate/studentawardsandcompetitions/ |
| right_column |
124357 |
/philosophy/undergraduate/rightcolumn/ |
| Graduate |
36399 |
/philosophy/academics.shtml |
| How to Apply |
36444 |
/philosophy/graduate_admission.shtml |
| Graduate Program Outcomes |
87820 |
/philosophy/graduateprogramoutcomes/ |
| Research Specializations |
36434 |
/philosophy/specializations.shtml |
| Graduate Faculty |
204532 |
/philosophy/graduatefaculty/ |
| Graduate Student Testimonials |
62516 |
/philosophy/graduatestudenttestimonials/ |
| Graduate Students: Frequently Asked Questions |
36410 |
/philosophy/graduate_faqs.shtml |
| PhD and MA Programs |
116117 |
/philosophy/phdandmaprograms/ |
| PhD in Philosophy |
36430 |
/philosophy/phd.shtml |
| MA in Philosophy |
36425 |
/philosophy/ma.shtml |
| MA in Social Philosophy |
36424 |
/philosophy/ma_social.shtml |
| Accelerated Masters Pathway in Philosophy |
205548 |
/philosophy/phdandmaprograms/amp_philosophy.shtml |
| Accelerated Masters Pathway in Social Philosophy |
205533 |
/philosophy/phdandmaprograms/amp_social.shtml |
| Graduate Course Offerings |
72884 |
/philosophy/graduatecourseofferings/ |
| Graduate Student Resources |
72748 |
/philosophy/graduatestudentresources/ |
| Philosophy Graduate Handbook |
36545 |
/philosophy/Graduate_Student_Handbook.shtml |
| Key Dates & Deadlines |
36550 |
/philosophy/Deadlines.shtml |
| Graduate Program Forms, Instructions, and Rubrics |
36554 |
/philosophy/graduate_program_for.shtml |
| Job Market Application |
36413 |
/philosophy/job_market_application.shtml |
| Graduate Financial Aid |
36445 |
/philosophy/graduate_financial_aid.shtml |
| Association of Graduate Students in Philosophy |
58123 |
/philosophy/graduatestudentresources/associationofgraduatestudentsinphilosophy/ |
| Graduate Student Survival Kit |
36411 |
/philosophy/survival_kit.shtml |
| Current Graduate Students |
117720 |
/philosophy/currentgraduatestudents/ |
| Job Market Candidates |
205348 |
/philosophy/jobmarketcandidates/ |
| Recent Dissertation Defenses |
36551 |
/philosophy/defenses.shtml |
| Graduate Program Outcomes |
180805 |
/philosophy/graduateprogramoutcomes/ |
| right_column |
85322 |
/philosophy/rightcolumn/ |
| Apply Now |
36443 |
/philosophy/admission.shtml |
| right_column |
85326 |
/philosophy/rightcolumn/ |
| Research and Initiatives |
116115 |
/philosophy/researchandinitiatives/ |
| Faculty Book Publications |
36388 |
/philosophy/recent_publications.shtml |
| Research Groups |
73794 |
/philosophy/researchandinitiatives/researchgroups/ |
| History of Philosophy Roundtable (HOPR) |
75925 |
/philosophy/researchandinitiatives/researchgroups/historyofphilosophyroundtablehopr/ |
| Phenomenology Research Group (PRG) |
75926 |
/philosophy/researchandinitiatives/researchgroups/phenomenologyresearchgroupprg/ |
| Loyola Ethics and Values Symposia |
106534 |
/philosophy/researchandinitiatives/researchgroups/loyolaethicsandvaluessymposia/ |
| Midwest Race Theory Workshop |
123242 |
/philosophy/researchandinitiatives/researchgroups/midwestracetheoryworkshop/ |
| Social/Political/Legal Workshop (SPLW) |
188509 |
/philosophy/researchandinitiatives/researchgroups/socialpoliticallegalworkshopsplw/ |
| Undergraduate Conference |
116140 |
/philosophy/researchandinitiatives/undergraduateconference/ |
| Undergraduate Conference 2018 |
119947 |
/philosophy/researchandinitiatives/undergraduateconference/undergraduateconference2018/ |
| Undergraduate Conference 2019 |
119962 |
/philosophy/researchandinitiatives/undergraduateconference/undergraduateconference2019/ |
| Graduate Conference |
116143 |
/philosophy/researchandinitiatives/graduateconference/ |
| Minorities and Philosophy Chapter |
116154 |
/philosophy/researchandinitiatives/minoritiesandphilosophychapter/ |
| Plan for Action |
168221 |
/planforaction/ |
| site_logo |
168222 |
/planforaction/sitelogo/ |
| Footer |
168223 |
/planforaction/footer/ |
| Polish Studies |
14567 |
/polishstudies/ |
| site_logo |
14588 |
/polishstudies/sitelogo/ |
| Footer |
14587 |
/polishstudies/footer/ |
| social media |
202174 |
/polishstudies/socialmedia/ |
| cta |
202175 |
/polishstudies/cta/ |
| modules-programming |
202176 |
/polishstudies/modules-programming/ |
| About |
14575 |
/polishstudies/about/ |
| Calendar of Events |
14568 |
/polishstudies/about/calendarofevents/ |
| Conferences & Lectures |
14569 |
/polishstudies/about/conferenceslectures/ |
| Jan Karski Conference 2014 |
76509 |
/polishstudies/about/conferenceslectures/jankarskiconference2014/ |
| The Chicago Catholic Immigrants Conference: The Poles |
82028 |
/polishstudies/about/conferenceslectures/thechicagocatholicimmigrantsconferencethepoles/ |
| Contact Us |
14570 |
/polishstudies/about/contactus/ |
| Polish Studies Faculty |
62089 |
/polishstudies/about/contactus/polishstudiesfaculty/ |
| right_column |
202213 |
/polishstudies/about/contactus/polishstudiesfaculty/rightcolumn/ |
| Zbigniew Banas |
65048 |
/polishstudies/about/contactus/polishstudiesfaculty/zbigniewbanas/ |
| Jack J. Hutchens |
100495 |
/polishstudies/about/contactus/polishstudiesfaculty/jackjhutchens/ |
| Aleksandra Majkowska-Smith |
74180 |
/polishstudies/about/contactus/polishstudiesfaculty/aleksandramajkowska-smith/ |
| John Merchant |
65047 |
/polishstudies/about/contactus/polishstudiesfaculty/johnmerchant/ |
| Bozena Nowicka McLees |
62092 |
/polishstudies/about/contactus/polishstudiesfaculty/bozenanowickamclees/ |
| Marta Ochyra-Olchawa |
193728 |
/polishstudies/about/contactus/polishstudiesfaculty/martaochyra-olchawa/ |
| Marek Suszko |
62096 |
/polishstudies/about/contactus/polishstudiesfaculty/mareksuszko/ |
| Donate |
121046 |
/polishstudies/about/donate/ |
| News and Stories |
202178 |
/polishstudies/about/newsandstories/ |
| right_column |
48768 |
/polishstudies/about/newsandstories/rightcolumn/ |
| archive |
202179 |
/polishstudies/about/newsandstories/archive/ |
| Physics major participates in prestigious program at CERN |
202180 |
/polishstudies/about/newsandstories/physicsmajorparticipatesinprestigiousprogramatcern/ |
| Academics |
202177 |
/polishstudies/academics/ |
| Courses Offered |
202193 |
/polishstudies/academics/coursesoffered/ |
| Study in Poland |
75506 |
/polishstudies/academics/studyinpoland/ |
| Exploring Poland/Polin Polish-Jewish Heritage Study Tours |
75507 |
/polishstudies/academics/studyinpoland/exploringpolandpolinpolish-jewishheritagestudytours/ |
| JFRC Human Rights and Just Society Poland Study Tours |
126736 |
/polishstudies/academics/studyinpoland/jfrchumanrightsandjustsocietypolandstudytours/ |
| John Felice Poland Study Tour 2024 |
199580 |
/polishstudies/academics/studyinpoland/jfrchumanrightsandjustsocietypolandstudytours/johnfelicepolandstudytour2024/ |
| John Felice Poland Study Tour 2023 |
191587 |
/polishstudies/academics/studyinpoland/jfrchumanrightsandjustsocietypolandstudytours/johnfelicepolandstudytour2023/ |
| John Felice Poland Study Tour 2022 |
191586 |
/polishstudies/academics/studyinpoland/jfrchumanrightsandjustsocietypolandstudytours/johnfelicepolandstudytour2022/ |
| John Felice Poland Study Tour 2017 |
126740 |
/polishstudies/academics/studyinpoland/jfrchumanrightsandjustsocietypolandstudytours/johnfelicepolandstudytour2017/ |
| John Felice Poland Study Tour 2016 |
126739 |
/polishstudies/academics/studyinpoland/jfrchumanrightsandjustsocietypolandstudytours/johnfelicepolandstudytour2016/ |
| John Felice Poland Study Tour 2015 |
126738 |
/polishstudies/academics/studyinpoland/jfrchumanrightsandjustsocietypolandstudytours/johnfelicepolandstudytour2015/ |
| John Felice Poland Study Tour 2014 |
126900 |
/polishstudies/academics/studyinpoland/jfrchumanrightsandjustsocietypolandstudytours/johnfelicepolandstudytour2014/ |
| John Felice Poland Study Tour 2013 |
126737 |
/polishstudies/academics/studyinpoland/jfrchumanrightsandjustsocietypolandstudytours/johnfelicepolandstudytour2013/ |
| NAWA - Narodowa Agencja Wymiany Akademickiej |
126886 |
/polishstudies/academics/studyinpoland/nawa-narodowaagencjawymianyakademickiej/ |
| NAWA - Narodowa Agencja Wymiany Akademickiej |
126886 |
/polishstudies/academics/studyinpoland/nawa-narodowaagencjawymianyakademickiej/ |
| The Kościuszko Foundation |
191588 |
/polishstudies/academics/studyinpoland/thekociuszkofoundation/ |
| Foreign Language Competency Exam |
204271 |
/polishstudies/academics/foreignlanguagecompetencyexam/ |
| Students |
203331 |
/polishstudies/students/ |
| Polish Student Alliance |
14574 |
/polishstudies/polishstudentalliance/ |
| E-Board |
157597 |
/polishstudies/polishstudentalliance/e-board/ |
| Scholarships |
14577 |
/polishstudies/scholarships/ |
| Loyola based Polish Studies Scholarships |
14573 |
/polishstudies/scholarships/loyolabasedpolishstudiesscholarships/ |
| Kosciuszko Foundation |
192016 |
/polishstudies/scholarships/kosciuszkofoundation/ |
| Kosciuszko Foundation Loyola Scholars |
198741 |
/polishstudies/scholarships/kosciuszkofoundation/kosciuszkofoundationloyolascholars/ |
| Polish American Medical Society |
192076 |
/polishstudies/scholarships/polishamericanmedicalsociety/ |
| The American Institute of Polish Culture, Inc |
192282 |
/polishstudies/scholarships/theamericaninstituteofpolishcultureinc/ |
| Polish American Congress |
192291 |
/polishstudies/scholarships/polishamericancongress/ |
| Internships |
203492 |
/polishstudies/students/internships/ |
| Study Abroad |
203491 |
/polishstudies/students/studyabroad/ |
| Alumni |
203330 |
/polishstudies/alumni/ |
| Polish American Alumni Network |
203408 |
/polishstudies/alumni/polishamericanalumninetwork/ |
| Loyola University Chicago Alumni Association |
203409 |
/polishstudies/alumni/loyolauniversitychicagoalumniassociation/ |
| Overview |
203410 |
/polishstudies/alumni/ |
| Engagement |
14576 |
/polishstudies/engagement/ |
| Internship Opportunities |
66273 |
/polishstudies/resources/internshipopportunities/ |
| Political Science, Department of |
20098 |
/politicalscience/ |
| About Us |
20099 |
/politicalscience/about.shtml |
| From the Chair |
76057 |
/politicalscience/fromthechair/ |
| Contact Us |
76070 |
/politicalscience/contactus/ |
| Welcome |
33729 |
/politicalscience/welcome/ |
| Faculty |
20100 |
/politicalscience/faculty.shtml |
| Profiles |
179636 |
/politicalscience/profiles/ |
| right_column |
203044 |
/politicalscience/profiles/rightcolumn/ |
| Undergraduate Programs |
20125 |
/politicalscience/undergraduate.shtml |
| Major in Political Science |
203271 |
https://catalog.luc.edu/undergraduate/arts-sciences/political-science/political-science-ba/ |
| Minor in Political Science |
203272 |
https://catalog.luc.edu/undergraduate/arts-sciences/political-science/political-science-minor/ |
| Minor in Law and Politics |
168387 |
/politicalscience/minorinlawandpolitics/ |
| Fellowships, internships, and other opportunities |
203239 |
/politicalscience/fellowshipsinternshipsandotheropportunities/ |
| Accelerated Masters Pathway |
168261 |
/politicalscience/fellowshipsinternshipsandotheropportunities/acceleratedmasterspathway/ |
| Accelerated Masters Pathway |
156935 |
/politicalscience/fellowshipsinternshipsandotheropportunities/acceleratedmasterspathway/dual_degree.shtml |
| Honors in Political Science |
20242 |
/politicalscience/honors.shtml |
| Mock Trial |
206604 |
https://www.loyolamocktrial.com/index.html |
| Moot Court |
166109 |
/politicalscience/mootcourt/ |
| Preparing for Law School |
207464 |
/politicalscience/fellowshipsinternshipsandotheropportunities/preparingforlawschool/ |
| Rudis Fellowship in Comparative Constitutions |
20134 |
/politicalscience/rudis.shtml |
| Graduate Programs |
20114 |
/politicalscience/graduate.shtml |
| Selective Course Offerings |
60833 |
/politicalscience/selectivecourseofferings/ |
| Placements |
65273 |
/politicalscience/placements/ |
| right_column |
87606 |
/politicalscience/rightcolumn/ |
| Ph.D. in Political Science |
168259 |
/politicalscience/phdinpoliticalscience/ |
| PhD in Political Science |
60681 |
/politicalscience/phd/phdinpoliticalscience/ |
| Current PhD Students |
203122 |
/politicalscience/currentphdstudents/ |
| Profiles |
203124 |
/politicalscience/currentphdstudents/profiles/ |
| right_column |
203125 |
/politicalscience/currentphdstudents/profiles/rightcolumn/ |
| Prospective Doctoral Students |
168231 |
/politicalscience/phd/prospective/ |
| Masters of Arts |
168260 |
/politicalscience/mastersofarts/ |
| MA in Political Science |
203245 |
https://gpem.luc.edu/portal/program?name=politicalsciencema |
| MA in International Affairs |
203251 |
https://gpem.luc.edu/portal/program?name=internationalaffairsma |
| Dual JD/MA Degree Program In Law And Political Science |
20112 |
/politicalscience/graduate_dualdegree.shtml |
| Graduate Student Handbook |
104951 |
https://www.luc.edu/media/lucedu/politicalscience/pdfs/GRAD.STUD.HANDBOOK.Spring.2025.pdf |
| Academics |
20106 |
/politicalscience/academics.shtml |
| comparative politics |
20110 |
/politicalscience/courses/08fall/comparative_politics.shtml |
| graduate seminars |
20115 |
/politicalscience/courses/08fall/graduate_seminars.shtml |
| international politics |
20116 |
/politicalscience/courses/08fall/international_politics.shtml |
| miscellaneous courses |
20118 |
/politicalscience/courses/08fall/miscellaneous_courses.shtml |
| PhD in Political Science (Specialization of Global Politics) |
20119 |
/politicalscience/graduate_phd.shtml |
| PLSC 101: american politics |
20121 |
/politicalscience/courses/08fall/plsc101.shtml |
| plsc 102: international politics |
20122 |
/politicalscience/courses/08fall/plsc102.shtml |
| Admission |
20129 |
/politicalscience/admission.shtml |
| Financial Aid |
20130 |
/politicalscience/finaid.html |
| Apply Now |
76069 |
/politicalscience/applynow/ |
| News and Events |
203240 |
/politicalscience/newsandevents/ |
| Upcoming Events |
206196 |
/politicalscience/newsandevents/ |
| Covey Lectures |
20257 |
/politicalscience/covey.shtml |
| The Hartigan Lecture |
20264 |
/politicalscience/hartigan.shtml |
| 2026 State Politics and Policy Conference |
204667 |
/politicalscience/sppc2026.shtml |
| More Resources |
20261 |
/politicalscience/resources.shtml |
| Promotion and Tenure Guidelines |
159927 |
/politicalscience/promotionandtenureguidelines/ |
| Center for Research on International Affairs |
203254 |
https://www.luc.edu/cria/ |
| European Studies Program |
204016 |
https://www.luc.edu/europeanstudies/ |
| Speak Up Democracy |
191554 |
https://www.luc.edu/politicalscience/speakupdemocracy/ |
| Speak Up Democracy |
182372 |
/politicalscience/speakupdemocracy/ |
| site_logo |
191508 |
/politicalscience/speakupdemocracy/sitelogo/ |
| plsc test |
20253 |
/politicalscience/plsc-test.shtml |
| Footer |
20295 |
/politicalscience/footer/ |
| site_logo |
20296 |
/politicalscience/sitelogo/ |
| Stories |
76075 |
/politicalscience/stories/ |
| archive |
76076 |
/politicalscience/stories/archive/ |
| Documents |
93438 |
/politicalscience/documents/ |
| modules-programming |
198873 |
/politicalscience/modules-programming/ |
| social media |
203042 |
/politicalscience/socialmedia/ |
| cta |
203054 |
/politicalscience/cta/ |
| Pope Francis |
167774 |
/popefrancis/index.shtml |
| site_logo |
167775 |
/popefrancis/sitelogo/ |
| Pope Francis - Portuguese |
168198 |
/popefrancis/portuguese/index.shtml |
| site_logo |
168199 |
/popefrancis/portuguese/sitelogo/ |
| Pope Francis - Spanish |
167865 |
/popefrancis/spanish/index.shtml |
| site_logo |
167866 |
/popefrancis/spanish/sitelogo/ |
| Preschool |
12504 |
/preschool/ |
| site_logo |
12539 |
/preschool/site_logo/ |
| Footer |
12542 |
/preschool/footer/ |
| right_column |
12540 |
/preschool/rightcolumn/ |
| Mission Statement |
12506 |
/preschool/missionstatement/ |
| Philosophy Statement |
12774 |
/preschool/philosophystatement/ |
| Facility |
12508 |
/preschool/facility/ |
| Schedule |
12507 |
/preschool/schedule/ |
| Tuition |
12773 |
/preschool/tuition/ |
| Staffing |
12775 |
/preschool/staffing/ |
| Contact Us |
12505 |
/preschool/contactus/ |
| President’s Medallion |
63508 |
/presidents-medallion/index.shtml |
| site_logo |
63777 |
/presidents-medallion/sitelogo/ |
| site_background |
63524 |
/presidents-medallion/sitebackground/ |
| 2026 |
206614 |
/presidents-medallion/2026/ |
| site_logo |
206640 |
/presidents-medallion/2026/sitelogo/ |
| Arrupe College - Dianee Rameriz |
206620 |
/presidents-medallion/2026/arrupecollege-dianeerameriz/ |
| College of Arts and Sciences - Margaret Gonzalez |
206621 |
/presidents-medallion/2026/collegeofartsandsciences-margaretgonzalez/ |
| College of Arts and Sciences - Grace Loren Kubek |
206643 |
/presidents-medallion/2026/collegeofartsandsciences-gracelorenkubek/ |
| College of Arts and Sciences - Marco Alvarado |
206642 |
/presidents-medallion/2026/collegeofartsandsciences-marcoalvarado/ |
| The Graduate School - Ryan SC Wong |
206625 |
/presidents-medallion/2026/thegraduateschool-ryanscwong/ |
| Institute of Pastoral Studies - Jalen Taylor |
206622 |
/presidents-medallion/2026/instituteofpastoralstudies-jalentaylor/ |
| Marcella Niehoff School of Nursing - Arianna Moen |
206624 |
/presidents-medallion/2026/marcellaniehoffschoolofnursing-ariannamoen/ |
| Parkinson School of Health Sciences and Public Health
- Falak Choudry |
206626 |
/presidents-medallion/2026/parkinsonschoolofhealthsciencesandpublichealth-falakchoudry/ |
| Quinlan School of Business - Jillian Cole |
206627 |
/presidents-medallion/2026/quinlanschoolofbusiness-jilliancole/ |
| School of Communication - Vanesa Hoxha |
206629 |
/presidents-medallion/2026/schoolofcommunication-vanesahoxha/ |
| School of Continuing and Professional Studies - Abigail Green |
206630 |
/presidents-medallion/2026/schoolofcontinuingandprofessionalstudies-abigailgreen/ |
| School of Education - Indigo TenEyck |
206632 |
/presidents-medallion/2026/schoolofeducation-indigoteneyck/ |
| School of Environmental Sustainability - Anna Ries-Roncalli |
206634 |
/presidents-medallion/2026/schoolofenvironmentalsustainability-annaries-roncalli/ |
| School of Law - Anna Patton |
206635 |
/presidents-medallion/2026/schooloflaw-annapatton/ |
| School of Social Work - Rencie Horst |
206637 |
/presidents-medallion/2026/schoolofsocialwork-renciehorst/ |
| Stritch School of Medicine - Megi Maci |
206638 |
/presidents-medallion/2026/stritchschoolofmedicine-megimaci/ |
| Program for Neuroscience and Society |
195933 |
/neuroscienceandsociety/ |
| site_logo |
195934 |
/neuroscienceandsociety/sitelogo/ |
| social media |
195938 |
/neuroscienceandsociety/socialmedia/ |
| modules-programming |
195946 |
/neuroscienceandsociety/modules-programming/ |
| About |
195955 |
/neuroscienceandsociety/about/ |
| Advisory Board |
195994 |
/neuroscienceandsociety/about/advisoryboard/ |
| Meet the Team |
197071 |
/neuroscienceandsociety/about/meettheteam/ |
| Profiles |
197072 |
/neuroscienceandsociety/about/meettheteam/profiles/ |
| ETHOS |
195945 |
/neuroscienceandsociety/ethos/ |
| After School Workshops |
195995 |
/neuroscienceandsociety/ethos/afterschoolworkshops/ |
| Summer ETHOS |
195996 |
/neuroscienceandsociety/ethos/summerethos/ |
| Near-Peer Mentoring |
198008 |
/neuroscienceandsociety/ethos/near-peermentoring/ |
| Research |
203443 |
/neuroscienceandsociety/ethos/research/ |
| Competitions |
195939 |
/neuroscienceandsociety/competitions/ |
| Hot Topics |
195953 |
/neuroscienceandsociety/hottopics/ |
| Contributors |
198055 |
/neuroscienceandsociety/hottopics/contributors/ |
| Essays |
198057 |
/neuroscienceandsociety/hottopics/essays/ |
| archive |
198058 |
/neuroscienceandsociety/hottopics/essays/archive/ |
| News and Events |
198726 |
/neuroscienceandsociety/newsandevents/ |
| archive |
198727 |
/neuroscienceandsociety/newsandevents/archive/ |
| Journalism Winners |
203690 |
/neuroscienceandsociety/newsandevents/journalismwinners/ |
| Science Journalism Panel |
204533 |
/neuroscienceandsociety/newsandevents/sciencejournalismpanel/ |
| GRADUATES |
203337 |
/neuroscienceandsociety/graduates/ |
| 2025 |
203983 |
/neuroscienceandsociety/graduates/2025/ |
| profiles |
203984 |
/neuroscienceandsociety/graduates/2025/profiles/ |
| 2024 |
204925 |
/neuroscienceandsociety/graduates/2024/ |
| profiles |
204926 |
/neuroscienceandsociety/graduates/2024/profiles/ |
| Psychology of Crime & Justice Minor |
101708 |
/psych-cj/ |
| Footer |
101710 |
/psych-cj/footer/ |
| site_logo |
101712 |
/psych-cj/sitelogo/ |
| About Us |
101729 |
/psych-cj/aboutus/ |
| Program Goals |
107449 |
/psych-cj/aboutus/programgoals/ |
| Curriculum and Program Overview: Minor of the Psychology of Crime and Justice |
156197 |
/psych-cj/aboutus/curriculumandprogramoverviewminorofthepsychologyofcrimeandjustice/ |
| Minor Requirements |
101720 |
/psych-cj/minorrequirements/ |
| Required Classes |
101731 |
/psych-cj/minorrequirements/requiredclasses/ |
| Psyc Majors |
101732 |
/psych-cj/minorrequirements/psycmajors/ |
| CJC Majors |
101733 |
/psych-cj/minorrequirements/cjcmajors/ |
| All Other Majors |
101734 |
/psych-cj/minorrequirements/allothermajors/ |
| Approved Electives |
101750 |
/psych-cj/minorrequirements/approvedelectives/ |
| Double Dipping Policy |
104241 |
/psych-cj/minorrequirements/doubledippingpolicy/ |
| Resources |
101730 |
/psych-cj/resources/ |
| Graduate Training Materials |
105605 |
/psych-cj/resources/graduatetrainingmaterials/ |
| Career Aspirations |
101736 |
/psych-cj/careeraspirations/ |
| cta |
202604 |
/psych-cj/cta/ |
| social media |
202606 |
/psych-cj/socialmedia/ |
| Psychology, Department of |
98106 |
/psychology/ |
| site_logo |
98107 |
/psychology/sitelogo/ |
| Footer |
98110 |
/psychology/footer/ |
| cta |
200891 |
/psychology/cta/ |
| social media |
200890 |
/psychology/socialmedia/ |
| modules-programming |
200892 |
/psychology/modules-programming/ |
| right_column |
105156 |
/psychology/rightcolumn/ |
| About |
98291 |
/psychology/about/ |
| Welcome |
98455 |
/psychology/about/welcome/ |
| Website Introduction |
163498 |
/psychology/about/websiteintroduction/ |
| Diversity |
105886 |
/psychology/about/diversity/ |
| Admissions |
105189 |
/psychology/about/admissions/ |
| News |
105831 |
/psychology/news/ |
| Stories |
105834 |
/psychology/stories/ |
| archive |
105836 |
/psychology/stories/archive/ |
| Thinking outside the box |
66276 |
/psychology/stories/story/creativity.html |
| Contact |
99437 |
/psychology/about/contact/ |
| People |
98293 |
/psychology/people/ |
| Faculty and Staff Directory |
200745 |
/psychology/people/facultyandstaffdirectory/ |
| right_column |
200909 |
/psychology/people/facultyandstaffdirectory/rightcolumn/ |
| Profiles |
200749 |
/psychology/people/facultyandstaffdirectory/profiles/ |
| Part-Time Faculty |
200792 |
/psychology/people/facultyandstaffdirectory/part-timefaculty/ |
| Graduate Students |
105680 |
/psychology/people/graduatestudents/ |
| Applied Social Psychology Graduate Students |
105681 |
/psychology/people/graduatestudents/appliedsocialpsychologygraduatestudents/ |
| profiles |
204538 |
/psychology/people/graduatestudents/appliedsocialpsychologygraduatestudents/profiles/ |
| Clinical Psychology Graduate Students |
105683 |
/psychology/people/graduatestudents/clinicalpsychologygraduatestudents/ |
| profiles |
204651 |
/psychology/people/graduatestudents/clinicalpsychologygraduatestudents/profiles/ |
| Developmental Psychology Graduate Students |
105685 |
/psychology/people/graduatestudents/developmentalpsychologygraduatestudents/ |
| profiles |
204652 |
/psychology/people/graduatestudents/developmentalpsychologygraduatestudents/profiles/ |
| Postdoctoral Fellows |
105733 |
/psychology/people/postdoctoralfellows/ |
| archive |
105734 |
/psychology/people/postdoctoralfellows/archive/ |
| Alumni |
98454 |
/psychology/people/alumni/ |
| Undergraduate |
98436 |
/psychology/undergraduate/ |
| Overview |
98441 |
/psychology/undergraduate/overview/ |
| Admissions |
105198 |
/psychology/undergraduate/admissions/ |
| Careers in Psychology |
201582 |
/psychology/resources/careersinpsychology/ |
| Advising |
105623 |
/psychology/undergraduate/advising/ |
| Internship and Job Listings |
159055 |
/psychology/undergraduate/internshipandjoblistings/ |
| Psychology Major after July 2021 |
159334 |
/psychology/undergraduate/psychologymajorafterjuly2021/ |
| Psychology Major before July 2021 |
98442 |
/psychology/undergraduate/psychologymajorbeforejuly2021/ |
| Course Offerings |
198545 |
/psychology/undergraduate/courseofferings/ |
| J-Term and Summer Course Offerings |
204768 |
/psychology/undergraduate/courseoffierings/j-termandsummercourseofferings/ |
| J-Term 2026 |
204769 |
/psychology/undergraduate/courseoffierings/j-termandsummercourseofferings/j-term2026/ |
| Summer 2026 |
204771 |
/psychology/undergraduate/courseoffierings/j-termandsummercourseofferings/summer2026/ |
| Undergraduate Clubs |
105707 |
/psychology/undergraduate/undergraduateclubs/ |
| Loyola University Psychology Association |
105709 |
/psychology/undergraduate/undergraduateclubs/loyolauniversitypsychologyassociation/ |
| Psi Chi |
105710 |
/psychology/undergraduate/undergraduateclubs/psichi/ |
| Psychology Minor |
98443 |
/psychology/undergraduate/psychologyminor/ |
| Interdisciplinary Majors/Minors |
105883 |
/psychology/undergraduate/interdisciplinarymajorsminors/ |
| 5-year Program in Applied Social Psychology |
105260 |
/psychology/undergraduate/5-yearprograminappliedsocialpsychology/ |
| Internship in Psychology |
98446 |
/psychology/undergraduate/internshipinpsychology/ |
| PSYC 390 Application Instructions |
99443 |
/psychology/undergraduate/internshipinpsychology/psyc390applicationinstructions/ |
| PSYC 390 Previous Internship Sites |
99446 |
/psychology/undergraduate/internshipinpsychology/psyc390previousinternshipsites/ |
| Psychology Course Offerings |
98444 |
/psychology/undergraduate/internshipinpsychology/psychologycourseofferings/ |
| Independent Research |
98445 |
/psychology/undergraduate/independentresearch/ |
| PSYC 397 - Independent Research |
99440 |
/psychology/undergraduate/independentresearch/psyc397-independentresearch/ |
| PSYC 399 - Special Studies in Psychology |
99441 |
/psychology/undergraduate/independentresearch/psyc399-specialstudiesinpsychology/ |
| Research Participants (SONA) |
125749 |
/psychology/undergraduate/researchparticipantssona/ |
| Honors in Psychology |
98447 |
/psychology/undergraduate/honorsinpsychology/ |
| Major/Minor Fair |
156149 |
/psychology/undergraduate/majorminorfair/ |
| FAQ |
98457 |
/psychology/undergraduate/faq/ |
| Graduate |
98437 |
/psychology/graduate/ |
| Overview |
98458 |
/psychology/graduate/overview/ |
| Applied Social Psychology Program |
98461 |
/psychology/graduate/appliedsocialpsychology/ |
| Applied Social Psychology PhD |
105242 |
/psychology/graduate/appliedsocialpsychology/appliedsocialpsychologyphd/ |
| Applied Social Psychology MA |
188090 |
https://gpem.luc.edu/portal/program?name=psychologyappliedsocialpsychologyma |
| 5-Year BS/MA in Applied Social Psychology |
188091 |
https://gpem.luc.edu/portal/abm?name=psychologyappliedsocialpsychologyma |
| Applied Social Psychology Faculty |
105243 |
/psychology/graduate/appliedsocialpsychology/appliedsocialpsychologyfaculty/ |
| Clinical Psychology Program |
98462 |
/psychology/graduate/clinicalpsychologyprogram/ |
| Program Information |
105319 |
/psychology/graduate/clinicalpsychologyprogram/programinformation/ |
| Internships and Postdoctoral Fellowships |
105321 |
/psychology/graduate/clinicalpsychologyprogram/programinformation/internshipsandpostdoctoralfellowships/ |
| Student Admissions, Outcomes, and Other Data |
105261 |
/psychology/graduate/clinicalpsychologyprogram/studentadmissionsoutcomesandotherdata/ |
| Prospective Graduate Students |
122434 |
/psychology/graduate/clinicalpsychologyprogram/prospectivegraduatestudents/ |
| Clinical Psychology Faculty |
105262 |
/psychology/graduate/clinicalpsychologyprogram/clinicalpsychologyfaculty/ |
| Clinical Documents and Forms |
105264 |
/psychology/graduate/clinicalpsychologyprogram/clinicaldocumentsandforms/ |
| Diversity in Clinical Psychology |
107453 |
/psychology/graduate/clinicalpsychologyprogram/diversityinclinicalpsychology/ |
| Give Back to Our Program! |
177359 |
/psychology/graduate/clinicalpsychologyprogram/givebacktoourprogram/ |
| Developmental Psychology Program |
98463 |
/psychology/graduate/developmentalpsychologyprogram/ |
| Developmental Psychology PhD Program |
105317 |
/psychology/graduate/developmentalpsychologyprogram/developmentalpsychologyphdprogram/ |
| Developmental Psychology Faculty Interests |
105318 |
/psychology/graduate/developmentalpsychologyprogram/developmentalpsychologyfacultyinterests/ |
| Graduate Resources |
98469 |
/psychology/graduate/graduateresources/ |
| FAQ |
99466 |
/psychology/graduate/faq/ |
| Research |
98438 |
/psychology/research/ |
| Research Laboratories |
98492 |
/psychology/research/researchlaboratories/ |
| Participate in Research |
98479 |
/psychology/research/participateinresearch/ |
| Independent Research |
99452 |
/psychology/research/independentresearch/ |
| PSYC 397. Independent Research |
99454 |
/psychology/research/independentresearch/psyc-397/ |
| PSYC 399. Special Studies in Psychology |
99453 |
/psychology/research/independentresearch/psyc-399/ |
| Loyola Undergraduate Research Opportunities Program (LUROP) |
98477 |
/psychology/research/loyolaundergraduateresearchopportunitiesprogramlurop/ |
| Resources |
98439 |
/psychology/resources/ |
| Careers in Psychology |
105701 |
/psychology/resources/careersinpsychology/ |
| Psychology Career Finder |
99474 |
/psychology/resources/psychologycareerfinder/ |
| Internship and Job Listings |
159051 |
/psychology/resources/internshipandjoblistings/ |
| Preparing for Graduate School |
105702 |
/psychology/resources/preparingforgraduateschool/ |
| Undergraduate Clubs |
98480 |
/psychology/resources/undergraduateclubs/ |
| Loyola University Psychology Association |
98483 |
/psychology/resources/undergraduateclubs/loyolauniversitypsychologyassociation/ |
| Psi Chi |
98482 |
/psychology/resources/undergraduateclubs/psichi/ |
| Committee on Diversity Affairs (CODA) |
98481 |
/psychology/resources/committeeondiversityaffairscoda/ |
| Diversity and Inclusion Resources |
126479 |
/psychology/resources/diversityandinclusionresources/ |
| Faculty Resources |
98485 |
/psychology/resources/facultyresources/ |
| Faculty Searches |
163066 |
/psychology/resources/facultysearches/ |
| Purchasing |
29086 |
/purchasing/index.shtml |
| About Us |
29087 |
/purchasing/about.shtml |
| Mission Statement |
61939 |
/purchasing/missionstatement/ |
| Contact Us |
29089 |
/purchasing/contacts.shtml |
| Mail Rooms |
29093 |
/purchasing/mailroom.shtml |
| Printing Services |
29096 |
/purchasing/printing.shtml |
| Vending |
86160 |
/purchasing/vending/ |
| Policies & Procedures |
37320 |
/purchasing/policiesprocedures/ |
| Policy Principles |
29092 |
/purchasing/purch_policy.shtml |
| Procedures |
197105 |
/purchasing/procedures/ |
| Purchasing Manual |
61968 |
/purchasing/purchmanual/index.shtml |
| Introduction to the Purchasing Function |
62034 |
/purchasing/purchmanual/intro/index.shtml |
| General Policies on Ethics, Conflicts of Interest and Gifts |
62043 |
/purchasing/purchmanual/genpolicies/index.shtml |
| University and Purchasing Policies and Guidelines |
62056 |
/purchasing/purchmanual/univpolicies/index.shtml |
| Supplier Selection |
62060 |
/purchasing/purchmanual/supplier/index.shtml |
| Purchasing Options |
62061 |
/purchasing/purchmanual/options/index.shtml |
| Restricted Purchases |
62062 |
/purchasing/purchmanual/restricted/index.shtml |
| Requisition Guidelines |
61934 |
/purchasing/reqguidelines/index.shtml |
| University Contract Policy |
56097 |
/purchasing/contractpolicy/index.shtml |
| Gift Card Policy |
70177 |
/purchasing/policiesprocedures/giftcardpolicy/ |
| Standard Terms for Purchases |
59415 |
/purchasing/standardterms/index.shtml |
| Buyer Actions Matrix |
56540 |
https://www.luc.edu/media/lucedu/purchasing/pdfs/Procurement%20Action%20Matrix.pdf |
| Contracts - ECM Procedures |
179608 |
https://www.luc.edu/media/lucedu/purchasing/pdfs/Contracts_ECM_Procedure.pdf |
| ProCard Program |
56541 |
/finance/procard.shtml |
| Independent Contractors |
61942 |
http://www.luc.edu/finance/workersclassificationprocedure/ |
| Interior Furnishings |
61969 |
http://www.luc.edu/purchasing/programs.shtml#d.en.241493 |
| Supplier Programs |
37321 |
/purchasing/supplierprograms/ |
| Pre-Qualified Supplier Program |
29091 |
/purchasing/pqsupplier_prog.shtml |
| Pre-Qualified/Cooperative Suppliers |
29094 |
/purchasing/pqsupplier_directory.shtml |
| Purchase Cooperatives |
61952 |
/purchasing/supplierprograms/purchasecooperatives/ |
| Information for Suppliers |
37325 |
/purchasing/supplier_info/index.shtml |
| Personal Purchase Discounts |
61953 |
/purchasing/personaldiscounts/index.shtml |
| Loyola Partners for Need Based Scholarships |
61954 |
/purchasing/loyolapartners/index.shtml |
| Resources |
37322 |
/purchasing/resources/ |
| Forms |
62053 |
http://www.luc.edu/finance/forms.shtml |
| FAQs |
29090 |
/purchasing/faqs.shtml |
| Useful Links |
61958 |
/purchasing/resources/usefullinks/ |
| Methods to Determine Price Reasonableness |
29120 |
/purchasing/price_reasonableness.shtml |
| Purchasing Programs |
29098 |
/purchasing/programs.shtml |
| Rental Cars |
163083 |
/secure/purchasing/rental-cars/index.shtml |
| Purchasing Checklist Instructions |
56584 |
/purchasing/resources/purchasingchecklistinstructions/ |
| Financial Applications |
62085 |
http://www.luc.edu/finance/financialapps.shtml |
| Total Cost of Ownership |
151713 |
/purchasing/resources/totalcostofownership/ |
| Vendor Sustainability |
151714 |
/purchasing/resources/vendorsustainability/ |
| Amazon Business |
159181 |
/purchasing/resources/amazonbusiness/ |
| Training |
37324 |
/purchasing/training/ |
| Footer |
29107 |
/purchasing/footer/ |
| site_logo |
29108 |
/purchasing/sitelogo/ |
| social media |
199853 |
/purchasing/socialmedia/ |
| right_column |
199857 |
/purchasing/rightcolumn/ |
| Quinlan School of Business |
195518 |
/quinlan/ |
| site_logo |
195519 |
/quinlan/sitelogo/ |
| footer |
195522 |
/quinlan/footer/ |
| social media |
195521 |
/quinlan/socialmedia/ |
| cta |
195523 |
/quinlan/cta/ |
| modules-programming |
195525 |
/quinlan/modules-programming/ |
| Why Quinlan |
195526 |
/quinlan/whyquinlan/ |
| Dean's Welcome |
201758 |
/quinlan/whyquinlan/deanswelcome/ |
| Rankings and Reputation |
194378 |
/quinlan/whyquinlan/rankingsandreputation/ |
| Faculty and Staff |
195547 |
/quinlan/whyquinlan/facultyandstaff/ |
| Profiles |
196398 |
/quinlan/whyquinlan/facultyandstaff/profiles/ |
| right_column |
196399 |
/quinlan/whyquinlan/facultyandstaff/rightcolumn/ |
| Clifford Shultz |
196400 |
/quinlan/whyquinlan/facultyandstaff/cliffordshultz/ |
| right_column |
196405 |
/quinlan/whyquinlan/facultyandstaff/cliffordshultz/rightcolumn/ |
| Biography |
196401 |
/quinlan/whyquinlan/facultyandstaff/cliffordshultz/biography/ |
| Editorial and Policy Boards |
196402 |
/quinlan/whyquinlan/facultyandstaff/cliffordshultz/editorialandpolicyboards/ |
| Currently Funded or Pending Sponsored Projects |
196403 |
/quinlan/whyquinlan/facultyandstaff/cliffordshultz/currentlyfundedorpendingsponsoredprojects/ |
| Research, Courses, Teaching Interests and Photos |
196404 |
/quinlan/whyquinlan/facultyandstaff/cliffordshultz/researchcoursesteachinginterestsandphotos/ |
| Chicago |
195548 |
/quinlan/whyquinlan/chicago/ |
| DEI |
195549 |
/quinlan/whyquinlan/dei/ |
| Centers and Labs |
195550 |
/quinlan/whyquinlan/centersandlabs/ |
| Business Leadership Hub |
200886 |
/leadershiphub/ |
| Quinlan Behavioral Lab |
201923 |
/quinlan/whyquinlan/centersandlabs/quinlanbehaviorallab/ |
| CME Group Foundation Business Analytics Lab |
200838 |
/quinlan/whyquinlan/centersandlabs/businessanalyticslab/ |
| Lab for Applied Artificial Intelligence |
200809 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/ |
| Home |
200816 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/ |
| Services |
200810 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/services/ |
| Home |
206576 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/ |
| Upcoming Events |
206577 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/upcomingevents/ |
| Past Events |
206578 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/pastevents/ |
| Institutional Affiliations |
206580 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/institutionalaffiliations/ |
| Published Research |
206581 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publishedresearch/ |
| News |
206582 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/news/ |
| Leadership |
206583 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/leadership/ |
| Steering and Research Committee |
206584 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/steeringandresearchcommittee/ |
| Faculty Affiliates |
206585 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/facultyaffiliates/ |
| Responsible Innovation in Practice |
206586 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/responsibleinnovationinpractice/ |
| Contact Us |
206587 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/contactus/ |
| Ethics, AI, and the Workforce |
200821 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/ethicsaiandtheworkforce/ |
| Upcoming Events |
184227 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/upcomingevents/ |
| Loyola Data Science Initiative |
185604 |
/leadershiphub/centers/aibusinessconsortium/upcomingevents/loyoladatascienceinitiative/ |
| The Path to Implementation of Al for Prehospital Stroke Triage |
204429 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/upcomingevents/thepathtoimplementationofalforprehospitalstroketriage/ |
| Past Events |
184228 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/pastevents/ |
| archive |
185897 |
/leadershiphub/centers/aibusinessconsortium/pastevents/archive/ |
| 2026 |
207233 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/pastevents/2026/ |
| AI in Financial Services 2026 |
204324 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/upcomingevents/aiinfinancialservices2026/ |
| Exploring Applied AI in Action |
204927 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/upcomingevents/exploringappliedaiinaction/ |
| AI and Academic Integrity |
205597 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/upcomingevents/aiandacademicintegrity/ |
| How AI is Transforming Workforce Readiness in Low-Income Communities |
205668 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/upcomingevents/howaiistransformingworkforcereadinessinlow-incomecommunities/ |
| Artificial Intelligence — A Terrific Resource, but are Humans Ready? |
205034 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/upcomingevents/artificialintelligenceaterrificresourcebutarehumansready/ |
| Automation in the Workforce |
205211 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/upcomingevents/automationintheworkforce/ |
| Making Better Decisions |
205661 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/upcomingevents/makingbetterdecisions/ |
| 2025 |
207232 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/pastevents/2025/ |
| The Rise of Agentic Agents in the Financial Services Industry |
204218 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/upcomingevents/theriseofagenticagentsinthefinancialservicesindustry/ |
| AI in the Financial Services Industry 2025 |
201632 |
/leadershiphub/centers/aibusinessconsortium/upcomingevents/aiinthefinancialservicesindustry2025/ |
| Lab Workshop: Multiple Models as Judges to Construct Labeled Datasets |
204432 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/upcomingevents/labworkshopmultiplemodelsasjudgestoconstructlabeleddatasets/ |
| Challenges and Opportunities for Undergraduate AI Education in the U.S. |
204633 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/upcomingevents/challengesandopportunitiesforundergraduateaieducationintheus/ |
| Demystifying AI |
204681 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/upcomingevents/demystifyingai/ |
| Scientific Integrity Verification Through AI and Digital Image Forensics |
205027 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/upcomingevents/scientificintegrityverificationthroughaianddigitalimageforensics/ |
| 2024 |
207231 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/pastevents/2024/ |
| AI in the Financial Services Industry 2024 |
191567 |
/leadershiphub/centers/aibusinessconsortium/pastevents/aiinthefinancialservicesindustry2024/ |
| Navigating Model Risk From a Non-Bank and Third Party Perspective |
191866 |
/leadershiphub/centers/aibusinessconsortium/pastevents/aiinthefinancialservicesindustry2024/navigatingmodelriskfromanon-bankandthirdpartyperspective/ |
| Challenges of Deploying AI in a Heavily Regulated Environment |
192048 |
/leadershiphub/centers/aibusinessconsortium/pastevents/aiinthefinancialservicesindustry2024/challengesofdeployingaiinaheavilyregulatedenvironment/ |
| Performance Is Not All You Need |
192088 |
/leadershiphub/centers/aibusinessconsortium/pastevents/aiinthefinancialservicesindustry2024/performanceisnotallyouneed/ |
| The Regulatory Environment: Artificial Intelligence & Cybersecurity Risk |
192089 |
/leadershiphub/centers/aibusinessconsortium/pastevents/aiinthefinancialservicesindustry2024/theregulatoryenvironmentartificialintelligencecybersecurityrisk/ |
| Evolving AI: Navigating Risks and Opportunities in Financial Services |
197966 |
/leadershiphub/centers/aibusinessconsortium/pastevents/aiinthefinancialservicesindustry2024/evolvingainavigatingrisksandopportunitiesinfinancialservices/ |
| GenAI for Process Improvement and Related Use Cases |
193932 |
/leadershiphub/centers/aibusinessconsortium/pastevents/aiinthefinancialservicesindustry2024/genaiforprocessimprovementandrelatedusecases/ |
| Blueprint for Success: Strategic AI Deployment in Financial Services |
193952 |
/leadershiphub/centers/aibusinessconsortium/pastevents/aiinthefinancialservicesindustry2024/blueprintforsuccessstrategicaideploymentinfinancialservices/ |
| Workshop: Harmonious Human-AI Ecosystems |
198363 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/pastevents/workshopharmonioushuman-aiecosystems/ |
| AI in Health Care |
202771 |
/leadershiphub/centers/aibusinessconsortium/pastevents/aiinhealthcare/ |
| 2023 |
207230 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/pastevents/2023/ |
| AI in the Financial Services Industry 2023 |
185898 |
/leadershiphub/centers/aibusinessconsortium/pastevents/aiinthefinancialservicesindustry2023/ |
| Learning with Leading Experts |
185900 |
/leadershiphub/centers/aibusinessconsortium/pastevents/aiinthefinancialservicesindustry2023/learningwithleadingexperts/ |
| Leveraging Gen AI in Business Operations |
202772 |
/leadershiphub/centers/aibusinessconsortium/pastevents/leveraginggenaiinbusinessoperations/ |
| 2022 |
207234 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/pastevents/2022/ |
| Designing Flexibility to Address Uncertainty in the Supply Chain with AI |
202770 |
/leadershiphub/centers/aibusinessconsortium/pastevents/designingflexibilitytoaddressuncertaintyinthesupplychainwithai/ |
| Addressing Uncertainty with AI |
186447 |
/leadershiphub/centers/aibusinessconsortium/pastevents/designingflexibilitytoaddressuncertaintyinthesupplychainwithai/addressinguncertaintywithai/ |
| Institutional Affiliations |
200811 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/institutionalaffiliations/ |
| Archive |
200812 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/affiliates/archive/ |
| Published Research |
186435 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publishedresearch/ |
| archive |
186805 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/archive/ |
| site_logo |
187166 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/sitelogo/ |
| 2023 |
200746 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/2023/ |
| 4th Quarter 2023 |
189672 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/2023/4thquarter2023/ |
| Research |
189676 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/research/ |
| Submissions and Inquiries |
189678 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/submissions/ |
| archive |
189673 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/2023/4thquarter2023/archive/ |
| site_logo |
189675 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/2023/4thquarter2023/sitelogo/ |
| Chasing AI |
189674 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/2023/4thquarter2023/chasingai/ |
| Educator’s Perspective: Using ChatGPT to Teach Business Analytics |
189679 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/2023/4thquarter2023/educatorsperspectiveusingchatgpttoteachbusinessanalytics/ |
| An Initial AI Checklist for the Modern Firm |
189680 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/2023/4thquarter2023/aninitialaichecklistforthemodernfirm/ |
| Taming the AI Wild West: The Need for AI Governance |
190306 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/2023/4thquarter2023/tamingtheaiwildwesttheneedforaigovernance/ |
| 3rd Quarter 2023 |
186806 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/2023/3rdquarter2023/ |
| Research |
187168 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/research/ |
| Submissions and Inquiries |
187171 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/submissions/ |
| archive |
186807 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/2023/3rdquarter2023/archive/ |
| How To Transform Retail Supply and Demand Planning With AI |
187135 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/2023/3rdquarter2023/howtotransformretailsupplyanddemandplanningwithai/ |
| site_logo |
187167 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/2023/3rdquarter2023/sitelogo/ |
| A Consumer Perspective of Health Care and Artificial Intelligence |
187174 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/2023/3rdquarter2023/aconsumerperspectiveofhealthcareandartificialintelligence/ |
| AI Applications in Business |
187175 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/2023/3rdquarter2023/aiapplicationsinbusiness/ |
| 2024 |
200747 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/2024/ |
| 3rd Quarter 2024 |
197570 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/2024/3rdquarter2024/ |
| Research |
197574 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/research/ |
| Submissions and Inquiries |
197576 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/submissions/ |
| archive |
197571 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/2024/3rdquarter2024/archive/ |
| Good for Machine Learning and/or Good for Business? |
197572 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/2024/3rdquarter2024/goodformachinelearningandorgoodforbusiness/ |
| AI in the Financial Services Industry Conference Summary |
197577 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/2024/3rdquarter2024/aiinthefinancialservicesindustryconferencesummary/ |
| Gen AI Infused Digital Knowledge Workers |
197578 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/2024/3rdquarter2024/genaiinfuseddigitalknowledgeworkers/ |
| 2nd Quarter 2024 |
195789 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/2024/2ndquarter2024/ |
| Research |
195793 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/research/ |
| Submissions and Inquiries |
195795 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/submissions/ |
| archive |
195790 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/2024/2ndquarter2024/archive/ |
| site_logo |
195792 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/2024/2ndquarter2024/sitelogo/ |
| Practical Approaches to Generative AI in Manufacturing |
195791 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/2024/2ndquarter2024/practicalapproachestogenerativeaiinmanufacturing/ |
| If You Want to Know What AI Does… Just Look at the Objective Function |
195796 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/2024/2ndquarter2024/ifyouwanttoknowwhataidoesjustlookattheobjectivefunction/ |
| Next-Generation AI: Large Language Model-Based Autonomous Agents V3.0 |
195797 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/2024/2ndquarter2024/next-generationailargelanguagemodel-basedautonomousagentsv30/ |
| 1st Quarter 2024 |
191900 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/2024/1stquarter2024/ |
| Research |
191904 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/research/ |
| Submissions and Inquiries |
191906 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/submissions/ |
| archive |
191901 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/2024/1stquarter2024/archive/ |
| site_logo |
191903 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/2024/1stquarter2024/sitelogo/ |
| An Introduction to Retrieval-Augmented Generation Models |
191902 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/2024/1stquarter2024/anintroductiontoretrieval-augmentedgenerationmodels/ |
| Supply Chain Visibility: The Key to AI Success |
191907 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/2024/1stquarter2024/supplychainvisibilitythekeytoaisuccess/ |
| Bridging the Gap: A Guide to Machine Learning for Non-Machine Learning Engineers |
191908 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/2024/1stquarter2024/bridgingthegapaguidetomachinelearningfornon-machinelearningengineers/ |
| 4th Quarter 2024 |
200748 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/2024/4thquarter2024/ |
| Crossing the Chasm |
200750 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/2024/4thquarter2024/crossingthechasm/ |
| The Impact of AI on the Future of Work |
200751 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/2024/4thquarter2024/theimpactofaionthefutureofwork/ |
| The Rise of AI: Specialization, Salaries, and Future Trends |
200752 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/2024/4thquarter2024/theriseofaispecializationsalariesandfuturetrends/ |
| Research |
204544 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/research/2024/4thquarter2024/ |
| Submissions and Inquiries |
204545 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/research/2024/4thquarter2024/ |
| 2025 |
201702 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/2025/ |
| 1st Quarter 2025 |
201703 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/2025/1stquarter2025/ |
| All AI is Biased |
201704 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/2025/1stquarter2025/allaiisbiased/ |
| AI Revolution |
201705 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/2025/1stquarter2025/airevolution/ |
| What OpenAI's Operator Means for the Enterprise |
201706 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/2025/1stquarter2025/whatopenaisoperatormeansfortheenterprise/ |
| Research |
204546 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/research/ |
| Submissions and Inquiries |
204547 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/research/submissions/ |
| 2nd Quarter 2025 |
202975 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/2025/2ndquarter2025/ |
| From Exploration to Reliability |
202976 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/2025/2ndquarter2025/fromexplorationtoreliability/ |
| The Catalytic Role of Data science in the Retail Industry |
202988 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/2025/2ndquarter2025/thecatalyticroleofdatascienceintheretailindustry/ |
| The Impact of Generational Leadership on AI and ML Adoption in the Corporate Sector |
202989 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/2025/2ndquarter2025/theimpactofgenerationalleadershiponaiandmladoptioninthecorporatesector/ |
| Research |
204548 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/research/ |
| Submissions and Inquiries |
204550 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/research/submissions/ |
| 3rd Quarter 2025 |
204145 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/2025/3rdquarter2025/ |
| How AI is Reshaping Work and Human Psychology |
204146 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/2025/3rdquarter2025/howaiisreshapingworkandhumanpsychology/ |
| The Quiet Cloud Shift |
204153 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/2025/3rdquarter2025/thequietcloudshift/ |
| The Paradox of Progress |
204147 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/2025/3rdquarter2025/theparadoxofprogress/ |
| AI Impact on High School Learning Outcomes |
204392 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/2025/3rdquarter2025/aiimpactonhighschoollearningoutcomes/ |
| Research |
204549 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/research/ |
| Submissions and Inquiries |
204551 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/research/submissions/ |
| 4th Quarter 2025 |
205529 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/research/2025/4thquarter2025/ |
| Proactive AI Compliance |
205530 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/research/2025/4thquarter2025/proactiveaicompliance/ |
| Why 80% of AI Projects Fail: The C-Suite Guide to Beating the Odds |
205532 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/research/2025/4thquarter2025/why80ofaiprojectsfailthec-suiteguidetobeatingtheodds/ |
| GraphRAG: A Massive Leap in LLM Real-World Intelligence |
205556 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/research/2025/4thquarter2025/graphragamassiveleapinllmreal-worldintelligence/ |
| MIT’s 95% Failure Rate |
205562 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/research/2025/4thquarter2025/mits95failurerate/ |
| 2026 |
206272 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/research/2026/ |
| 1st Quarter 2026 |
206273 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/research/2026/1stquarter2026/ |
| The New Iron Curtain |
206274 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/research/2026/1stquarter2026/thenewironcurtain/ |
| The Trillion-Token Archive |
206277 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/research/2026/1stquarter2026/thetrillion-tokenarchive/ |
| Not So Fast |
206278 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/research/2026/1stquarter2026/notsofast/ |
| 2nd Quarter 2026 |
207090 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publishedresearch/2026/2ndquarter2026/ |
| The Agent Trap |
207091 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publishedresearch/2026/2ndquarter2026/theagenttrap/ |
| What You Picture Matters |
207093 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publishedresearch/2026/2ndquarter2026/whatyoupicturematters/ |
| Transitioning Tax Law into Computational Systems |
207150 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publishedresearch/2026/2ndquarter2026/transitioningtaxlawintocomputationalsystems/ |
| Submissions |
187170 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/submissions/ |
| AI Edge Home Page |
187172 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/ |
| About the AiBC |
187173 |
/leadershiphub/centers/aibusinessconsortium/about/ |
| PDF Links |
191333 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/publications/pdflinks/ |
| News |
204552 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/news/ |
| archive |
204553 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/news/archive/ |
| Newsletter Archive |
204924 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/news/newsletterarchive/ |
| Leadership |
200817 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/leadership/ |
| Steering and Research Committee |
203559 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/steeringandresearchcommittee/ |
| Faculty Affiliates |
203560 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/facultyaffiliates/ |
| Contact Us |
200813 |
/quinlan/whyquinlan/centersandlabs/labforappliedartificialintelligence/contactus/ |
| UX & Biometrics Lab |
200887 |
https://www.uxbiometriclab.com/ |
| Alumni |
195551 |
/quinlan/whyquinlan/alumni/ |
| Advisory and Alumni Boards |
195552 |
/quinlan/whyquinlan/advisoryandalumniboards/ |
| Dean's Board of Advisors |
200689 |
/quinlan/whyquinlan/advisoryandalumniboards/deansboardofadvisors/ |
| Accounting Advisory Board |
200690 |
/quinlan/whyquinlan/advisoryandalumniboards/accountingadvisoryboard/ |
| Economics Advisory Board |
200691 |
/quinlan/whyquinlan/advisoryandalumniboards/economicsadvisoryboard/ |
| Finance Advisory Board |
200899 |
/quinlan/whyquinlan/advisoryandalumniboards/financeadvisoryboard/ |
| Information Systems and Analytics Advisory Board |
200693 |
/quinlan/whyquinlan/advisoryandalumniboards/informationsystemsandanalyticsadvisoryboard/ |
| Management Advisory Boards |
203482 |
/quinlan/whyquinlan/advisoryandalumniboards/managementadvisoryboards/ |
| Marketing Advisory Boards |
200695 |
/quinlan/whyquinlan/advisoryandalumniboards/marketingadvisoryboards/ |
| Supply Chain Management Advisory Board |
200694 |
/quinlan/whyquinlan/advisoryandalumniboards/supplychainmanagementadvisoryboard/ |
| Supply Chain Management Advisory Board |
200694 |
/quinlan/whyquinlan/advisoryandalumniboards/supplychainmanagementadvisoryboard/ |
| News & Events |
195553 |
/quinlan/whyquinlan/newsevents/ |
| archive |
195884 |
/quinlan/whyquinlan/newsevents/archive/ |
| Black Excellence Awards |
196199 |
/quinlan/whyquinlan/newsevents/blackexcellenceawards/ |
| Faculty and Staff Awards |
202916 |
/quinlan/whyquinlan/newsevents/facultyandstaffawards/ |
| Contact |
195554 |
/quinlan/whyquinlan/contact/ |
| Admission |
195527 |
/quinlan/admission/ |
| Apply |
195557 |
/quinlan/admission/apply/ |
| Tuition and Financial Aid |
195555 |
/quinlan/admission/tuitionandfinancialaid/ |
| Scholarships |
195556 |
/quinlan/admission/scholarships/ |
| Visit Us |
195690 |
/quinlan/admission/visit/ |
| Graduate Programs Showcase |
196207 |
/quinlan/admission/graduateprogramsshowcase/ |
| Academics |
195528 |
/quinlan/academics/ |
| Graduate Degrees |
195605 |
/quinlan/academics/graduatedegrees/ |
| MBA |
195606 |
/quinlan/academics/graduatedegrees/mba/ |
| Baumhart Scholars MBA |
195616 |
/quinlan/academics/graduatedegrees/mba/baumhartscholarsmba/ |
| Curriculum |
195617 |
/quinlan/academics/graduatedegrees/mba/baumhartscholarsmba/curriculum/ |
| Faculty |
195619 |
/quinlan/academics/graduatedegrees/mba/baumhartscholarsmba/faculty/ |
| archive |
195621 |
/quinlan/academics/graduatedegrees/mba/baumhartscholarsmba/faculty/archive/ |
| Mentors |
195622 |
/quinlan/academics/graduatedegrees/mba/baumhartscholarsmba/mentors/ |
| archive |
195624 |
/quinlan/academics/graduatedegrees/mba/baumhartscholarsmba/mentors/archive/ |
| Current Scholars |
195633 |
/baumhartcenter/education/baumhartscholarsmba/currentscholars/ |
| Alumni |
195634 |
/baumhartcenter/education/baumhartscholarsmba/alumni/ |
| Network |
195625 |
/quinlan/academics/graduatedegrees/mba/baumhartscholarsmba/network/ |
| Scholarship and Tuition |
195627 |
/quinlan/academics/graduatedegrees/mba/baumhartscholarsmba/scholarshipandtuition/ |
| Application Process |
195629 |
/quinlan/academics/graduatedegrees/mba/baumhartscholarsmba/applicationprocess/ |
| Picking an MBA Program |
195614 |
/quinlan/academics/graduatedegrees/mba/pickinganmbaprogram/ |
| MS |
195639 |
/quinlan/academics/graduatedegrees/ms/ |
| Choosing a Business Data Analytics Program |
195653 |
/quinlan/academics/graduatedegrees/ms/choosingabusinessdataanalyticsprogram/ |
| Dual Degrees |
195655 |
/quinlan/academics/graduatedegrees/dualdegrees/ |
| MBA/MSBA in Business Analytics |
195670 |
/quinlan/academics/graduatedegrees/dualdegrees/mbamsbainbusinessanalytics/ |
| JD/MBA Dual Degree Program |
195662 |
/quinlan/academics/graduatedegrees/dualdegrees/jdmbadualdegreeprogram/ |
| MBA/MSP in Pharmacology |
196208 |
https://www.luc.edu/pharmacology/programs/ms-mba/ |
| 4+1 Programs |
195672 |
/quinlan/academics/graduatedegrees/41programs/ |
| BA/MSM |
196209 |
https://gpem.luc.edu/portal/abm?name=marketingms |
| BS/MBA |
196210 |
https://gpem.luc.edu/portal/abm?name=mbanextgeneration |
| STEM Business Programs |
201408 |
/quinlan/academics/graduatedegrees/stembusinessprograms/ |
| Graduate Certificates |
195888 |
/quinlan/academics/graduatecertificates/ |
| Business Analytics |
196389 |
https://gpem.luc.edu/portal/program?name=businessanalyticscertificate |
| Business Ethics |
196390 |
https://gpem.luc.edu/portal/program?name=businessethicscertificate |
| Environmental, Social, and Governance Certificate |
196391 |
https://gpem.luc.edu/portal/program?name=environmentalsocialandgovernancecertificate |
| Human Resources and Employment Relations |
196392 |
https://gpem.luc.edu/portal/program?name=humanresourcesandemploymentrelationscertificate |
| Supply Chain Fundamentals |
196393 |
https://gpem.luc.edu/portal/program?name=supplychainfundamentalscertificate |
| Undergraduate Degrees |
195563 |
/quinlan/academics/undergraduatedegrees/ |
| BBA |
195564 |
/quinlan/academics/undergraduatedegrees/bba/ |
| BBA in Accounting |
195565 |
/quinlan/academics/undergraduatedegrees/bba/bbainaccounting/ |
| Scholarships |
195566 |
/quinlan/academics/undergraduatedegrees/bba/bbainaccounting/scholarships/ |
| Beta Alpha Psi |
195567 |
/quinlan/academics/undergraduatedegrees/bba/bbainaccounting/betaalphapsi/ |
| BBA in Accounting and Analytics |
195568 |
/quinlan/academics/undergraduatedegrees/bba/bbainaccountingandanalytics/ |
| BBA in Economics |
195569 |
/quinlan/academics/undergraduatedegrees/bba/bbaineconomics/ |
| BBA in Entrepreneurship |
195570 |
/quinlan/academics/undergraduatedegrees/bba/bbainentrepreneurship/ |
| BBA in Finance |
195572 |
/quinlan/academics/undergraduatedegrees/bba/bbainfinance/ |
| BBA in Human Resource Management |
195573 |
/quinlan/academics/undergraduatedegrees/bba/bbainhumanresourcemanagement/ |
| BBA in Information Systems and Analytics |
195574 |
/quinlan/academics/undergraduatedegrees/bba/bbaininformationsystemsandanalytics/ |
| BBA in International Business |
195575 |
/quinlan/academics/undergraduatedegrees/bba/bbaininternationalbusiness/ |
| BBA in Management |
195576 |
/quinlan/academics/undergraduatedegrees/bba/bbainmanagement/ |
| BBA in Marketing |
195577 |
/quinlan/academics/undergraduatedegrees/bba/bbainmarketing/ |
| BBA in Sport Management |
195578 |
/quinlan/academics/undergraduatedegrees/bba/bbainsportmanagement/ |
| BBA in Supply Chain Management |
195579 |
/quinlan/academics/undergraduatedegrees/bba/bbainsupplychainmanagement/ |
| US/Europe BBA |
195580 |
/quinlan/academics/undergraduatedegrees/bba/useuropebba/ |
| Minors |
195581 |
/quinlan/academics/undergraduatedegrees/minors/ |
| Accounting Information Systems Minor |
195582 |
/quinlan/academics/undergraduatedegrees/minors/accountinginformationsystemsminor/ |
| Business Administration Minor |
195583 |
/quinlan/academics/undergraduatedegrees/minors/businessadministrationminor/ |
| Business of Applied Artificial Intelligence Minor |
202595 |
/quinlan/academics/undergraduatedegrees/minors/businessofappliedartificialintelligenceminor/ |
| Economics Minor |
195584 |
/quinlan/academics/undergraduatedegrees/minors/economicsminor/ |
| Entrepreneurship Minor |
195585 |
/quinlan/academics/undergraduatedegrees/minors/entrepreneurshipminor/ |
| Finance Minor |
195586 |
/quinlan/academics/undergraduatedegrees/minors/financeminor/ |
| Human Resource and Employment Relations Minor |
195587 |
/quinlan/academics/undergraduatedegrees/minors/humanresourceandemploymentrelationsminor/ |
| Information Systems Minor |
195588 |
/quinlan/academics/undergraduatedegrees/minors/informationsystemsminor/ |
| International Business Minor |
195589 |
/quinlan/academics/undergraduatedegrees/minors/internationalbusinessminor/ |
| Management Minor |
195591 |
/quinlan/academics/undergraduatedegrees/minors/managementminor/ |
| Marketing Minor |
195590 |
/quinlan/academics/undergraduatedegrees/minors/marketingminor/ |
| Nonprofit Management Minor |
195592 |
/quinlan/academics/undergraduatedegrees/minors/nonprofitmanagementminor/ |
| Sport Management Minor |
195593 |
/quinlan/academics/undergraduatedegrees/minors/sportmanagementminor/ |
| Supply Chain Management Minor |
195594 |
/quinlan/academics/undergraduatedegrees/minors/supplychainmanagementminor/ |
| Sustainability Management Minor |
195595 |
/quinlan/academics/undergraduatedegrees/minors/sustainabilitymanagementminor/ |
| Dual Degree Programs |
195599 |
/quinlan/academics/undergraduatedegrees/dualdegreeprograms/ |
| Business Honors Program |
195596 |
/quinlan/academics/undergraduatedegrees/businesshonorsprogram/ |
| Program Director Message |
203967 |
/quinlan/academics/undergraduatedegrees/businesshonorsprogram/programdirectormessage/ |
| FAQ |
203969 |
/quinlan/academics/undergraduatedegrees/businesshonorsprogram/faq/ |
| Business Honors Program |
201631 |
/quinlan/academics/undergraduatedegrees/businesshonorsprogram/ |
| Areas of Study |
195678 |
/quinlan/academics/areasofstudy/ |
| Student Resources |
196211 |
/quinlan/academics/studentresources/ |
| Undergraduate Resources |
196214 |
/quinlan/academics/studentresources/undergraduateresources/ |
| Academic Advising |
196254 |
/quinlan/academics/studentresources/undergraduateresources/academic-advising/ |
| Quinlan Honors Program |
196260 |
/quinlan/academics/undergraduatedegrees/businesshonorsprogram/ |
| FAQs |
196255 |
/quinlan/academics/studentresources/undergraduateresources/faqs/ |
| Forms |
196241 |
/quinlan/academics/studentresources/undergraduateresources/forms/ |
| Request to Take Additional Hours |
196242 |
/quinlan/academics/studentresources/undergraduateresources/forms/requesttotakeadditionalhours/ |
| Thank You |
196243 |
/quinlan/additionalhours/thankyou.shtml |
| Graduation Information |
196216 |
/quinlan/academics/studentresources/undergraduateresources/graduationinformation/ |
| Internship Credit |
196238 |
/quinlan/academics/studentresources/undergraduateresources/internshipcredit/ |
| Student Activities |
196247 |
/quinlan/academics/studentresources/undergraduateresources/studentactivities/ |
| Study Abroad |
196258 |
/quinlan/studentlife/studyabroad/ |
| Summer Session |
196250 |
/quinlan/academics/studentresources/undergraduateresources/summersession/ |
| Transfer Credit |
196236 |
/quinlan/academics/studentresources/undergraduateresources/transfercredit/ |
| Undergrad Newsletter |
196217 |
/quinlan/academics/studentresources/undergraduateresources/biz_buzz/ |
| right_column |
196248 |
/quinlan/academics/studentresources/undergraduateresources/rightcolumn/ |
| Graduate Resources |
196263 |
/quinlan/academics/studentresources/graduateresources/ |
| Academic Advising |
196271 |
/quinlan/academics/studentresources/graduateresources/academicadvising/ |
| Academic Calendar |
196266 |
/quinlan/academics/studentresources/graduateresources/academiccalendar/ |
| Graduate Announcements |
196285 |
/quinlan/academics/studentresources/graduateresources/graduateannouncements/ |
| Weekly Announcement Request Form |
196287 |
/quinlan/academics/studentresources/graduateresources/graduateannouncements/weeklyannouncementrequestform/ |
| Thank You |
196288 |
/quinlan/academics/studentresources/graduateresources/graduateannouncements/weeklyannouncementrequestform/thankyou/ |
| Graduation |
196282 |
/quinlan/academics/studentresources/graduateresources/graduation/ |
| Housing Options |
196279 |
/quinlan/academics/studentresources/graduateresources/housingoptions/ |
| International Students |
196276 |
/quinlan/academics/studentresources/graduateresources/internationalstudents/ |
| Jesuit MBA Network (Transfer Students) |
196278 |
/quinlan/academics/studentresources/graduateresources/jesuitmbanetworktransferstudents/ |
| New Student Resources |
196269 |
/quinlan/academics/studentresources/graduateresources/new-students/ |
| New Student Sessions |
196270 |
/quinlan/academics/studentresources/graduateresources/new-students/startmeup-orientation/ |
| Registration |
196264 |
/quinlan/academics/studentresources/graduateresources/registration/ |
| Closed Course Request Form |
196265 |
/quinlan/academics/studentresources/graduateresources/registration/closedcourserequestform/ |
| Scholarships |
196283 |
/quinlan/academics/studentresources/graduateresources/scholarships/ |
| Employer Letter Request |
196291 |
/quinlan/academics/studentresources/graduateresources/employerletterrequest/ |
| Thank You |
196292 |
/quinlan/academics/studentresources/graduateresources/employerletterrequest/thankyou/ |
| right_column |
196274 |
/quinlan/academics/studentresources/graduateresources/rightcolumn/ |
| Quinlan Closet |
196293 |
/quinlan/academics/studentresources/quinlancloset/ |
| Quinlan Pantry |
207227 |
/quinlan/academics/studentresources/quinlanpantry/ |
| Student Life |
195529 |
/quinlan/studentlife/ |
| Student Experience |
195560 |
/quinlan/studentlife/studentexperience/ |
| Graduate Student Organizations |
196341 |
/quinlan/studentlife/studentexperience/graduatestudentorganizations/ |
| Undergraduate Student Organizations |
196342 |
/quinlan/studentlife/studentexperience/undergraduatestudentorganizations/ |
| Quinlan Career Week |
204304 |
/quinlan/studentlife/studentexperience/quinlancareerweek/ |
| Quinlan Ramble |
196345 |
/quinlan/studentlife/studentexperience/quinlanramble/ |
| Ramble Blog |
196346 |
/quinlan/studentlife/studentexperience/quinlanramble/rambleblog/ |
| archive |
166466 |
/quinlan/studentlife/studentexperience/quinlanramble/rambleblog/archive/ |
| Quinlan Ramble |
196348 |
/quinlan/studentlife/studentexperience/quinlanramble/ |
| Los Angeles 2026 |
206432 |
/quinlan/studentlife/studentexperience/quinlanramble/rambleblog/losangeles2026/ |
| archive |
206433 |
/quinlan/studentlife/studentexperience/quinlanramble/rambleblog/losangeles2026/archive/ |
| New York 2024 |
191701 |
/quinlan/studentlife/studentexperience/quinlanramble/rambleblog/newyork2024/ |
| archive |
191702 |
/quinlan/studentlife/studentexperience/quinlanramble/rambleblog/newyork2024/archive/ |
| Ramble Blog |
206436 |
/quinlan/studentlife/studentexperience/quinlanramble/rambleblog/ |
| San Francisco 2023 |
184479 |
/quinlan/studentlife/studentexperience/quinlanramble/rambleblog/sanfrancisco2023/ |
| archive |
184480 |
/quinlan/studentlife/studentexperience/quinlanramble/rambleblog/sanfrancisco2023/archive/ |
| Atlanta 2022 |
168459 |
/quinlan/studentlife/studentexperience/quinlanramble/rambleblog/atlanta2022/ |
| archive |
168460 |
/quinlan/studentlife/studentexperience/quinlanramble/rambleblog/atlanta2022/archive/ |
| Los Angeles 2020 |
167518 |
/quinlan/studentlife/studentexperience/quinlanramble/rambleblog/losangeles2020/ |
| archive |
167523 |
/quinlan/studentlife/studentexperience/quinlanramble/rambleblog/losangeles2020/archive/ |
| Boston 2019 |
167519 |
/quinlan/studentlife/studentexperience/quinlanramble/rambleblog/boston2019/ |
| archive |
167524 |
/quinlan/studentlife/studentexperience/quinlanramble/rambleblog/boston2019/archive/ |
| Seattle 2018 |
167520 |
/quinlan/studentlife/studentexperience/quinlanramble/rambleblog/seattle2018/ |
| archive |
167525 |
/quinlan/studentlife/studentexperience/quinlanramble/rambleblog/seattle2018/archive/ |
| New York 2017 |
167521 |
/quinlan/studentlife/studentexperience/quinlanramble/rambleblog/newyork2017/ |
| San Francisco 2016 |
167522 |
/quinlan/studentlife/studentexperience/quinlanramble/rambleblog/sanfrancisco2016/ |
| Calendar |
196373 |
https://lucweb.luc.edu/newsevents/public/calendar.cfm?view=mw&siteid=278 |
| Study Abroad |
195561 |
/quinlan/studentlife/studyabroad/ |
| Graduate Study Abroad |
196374 |
/quinlan/studentlife/studyabroad/graduatestudyabroad/ |
| Career Services |
195562 |
/quinlan/studentlife/careerservices/ |
| Career Education |
196375 |
/quinlan/studentlife/careerservices/careereducation/ |
| International Job Search |
196376 |
/quinlan/studentlife/careerservices/international/ |
| Q Mentorship Program |
196377 |
/quinlan/studentlife/careerservices/qmentorshipprogram/ |
| MBA-Exchange.com Premium Services |
196378 |
/quinlan/studentlife/careerservices/mba-exchangecompremiumservices/ |
| Employer Relations |
200754 |
https://www.luc.edu/career/employers/ |
| Career Outcomes |
196386 |
/quinlan/studentlife/careerservices/careeroutcomes/ |
| Impact |
204536 |
/quinlan/impact/ |
| Impact and Leadership |
206881 |
/quinlan/impact/ |
| Story - Irem Sengul Orgut |
207304 |
/quinlan/impact/optimizingfoodaccess/ |
| Story - Irem Sengul Orgut |
207304 |
/quinlan/impact/optimizingfoodaccess/ |
| Story - Yuxiao (Rain) Luo |
207305 |
/quinlan/impact/analyzingai/ |
| Story - Zongfei (Lisa) Yang |
207303 |
/quinlan/impact/innovatingfintech/ |
| Story - Shabnam Azimi |
207306 |
/quinlan/impact/decodingbehavior/ |
| Breaking ground with biometrics |
204539 |
/quinlan/impact/breakinggroundwithbiometrics/ |
| Elevating behavioral research |
204540 |
/quinlan/impact/elevatingbehavioralresearch/ |
| Leadership tools for the real world |
204680 |
/quinlan/impact/leadershiptoolsfortherealworld/ |
| Marketing and the transformational experience |
204542 |
/quinlan/impact/marketingandthetransformationalexperience/ |
| Stories of Impact |
207415 |
/quinlan/impact/storiesofimpact/ |
| Faculty Research |
196406 |
/quinlan/whyquinlan/facultyandstaff/facultyresearch/ |
| Archive |
196407 |
/quinlan/whyquinlan/facultyandstaff/facultyresearch/archive/ |
| In the News |
196409 |
/quinlan/whyquinlan/facultyandstaff/inthenews/ |
| Older Media Mentions |
196411 |
/quinlan/whyquinlan/facultyandstaff/inthenews/oldermediamentions/ |
| Strengthening Minority-Owned Business |
200805 |
/quinlan/strengtheningminority-ownedbusiness/ |
| Strengthening Minority-Owned Business |
206871 |
/quinlan/impact/strengtheningminority-ownedbusiness/ |
| Capacity Building for Capacity Builders 2026 |
202495 |
/quinlan/strengtheningminority-ownedbusiness/capacitybuildingforcapacitybuilders2026/ |
| Project Team |
200807 |
/quinlan/strengtheningminority-ownedbusiness/projectteam/ |
| Partners |
200808 |
/quinlan/strengtheningminority-ownedbusiness/partners/ |
| Leadership Hub |
195531 |
/quinlan/leadershiphub/ |
| AI Business Consortium |
195689 |
https://www.luc.edu/leadershiphub/centers/aibusinessconsortium |
| Baumhart Center for Social Enterprise & Responsibility |
195683 |
https://www.luc.edu/baumhartcenter |
| Executive and Professional Education |
195684 |
https://www.luc.edu/executiveeducation |
| Family Business Center |
195685 |
https://www.luc.edu/familybusiness |
| Ignite Lab |
200622 |
https://www.luc.edu/leadershiphub/centers/ignitelab/ |
| Kaufman Center for Financial Policy Studies |
200621 |
https://www.luc.edu/kaufmancenter/ |
| Risk Management and Insurance Center |
195688 |
https://www.luc.edu/leadershiphub/centers/riskmanagementandinsurancecenter |
| Supply Chain and Sustainability Center |
195687 |
https://www.luc.edu/supplychaincenter |
| Schreiber Center |
196191 |
/quinlan/schreibercenter/ |
| Request Information |
195691 |
/quinlan/rfi/ |
| Graduate Programs |
195693 |
/quinlan/rfi/graduateprograms/ |
| Mission & Vision |
196192 |
/quinlan/missionvision/ |
| About Michael R. Quinlan |
196193 |
/quinlan/aboutmichaelrquinlan/ |
| Instagram |
196194 |
/quinlan/instagram/ |
| Archive |
161487 |
/quinlan/instagram/archive/ |
| Quinlan - Kaufman Center for Financial Policy Studies |
156998 |
/kaufmancenter/ |
| site_logo |
198161 |
/kaufmancenter/sitelogo/ |
| footer |
198162 |
/kaufmancenter/footer/ |
| right_column |
156999 |
/kaufmancenter/rightcolumn/ |
| Director and Advisory Board |
204061 |
/kaufmancenter/directorandadvisoryboard/ |
| Upcoming Events |
188251 |
/kaufmancenter/upcomingevents/ |
| archive |
188254 |
/kaufmancenter/upcomingevents/archive/ |
| Bank Supervision and Regulation |
204951 |
/kaufmancenter/upcomingevents/banksupervisionandregulation/ |
| Past Events |
157000 |
/kaufmancenter/pastevents/ |
| archive |
189023 |
/kaufmancenter/pastevents/archive/ |
| Annual Policy Conference 2022 |
180923 |
/kaufmancenter/pastevents/annualpolicyconference2022/ |
| Bank Capital Buffers and Lending, Firm Financing and Spending |
181286 |
/kaufmancenter/pastevents/inauguralkick-off2022/bankcapitalbuffersandlendingfirmfinancingandspending/ |
| Private Equity Investment in U.S. Banks |
181289 |
/kaufmancenter/pastevents/inauguralkick-off2022/privateequityinvestmentinusbanks/ |
| Restoring Confidence in Troubled Financial Institutions after a Financial Crisis |
181290 |
/kaufmancenter/pastevents/inauguralkick-off2022/restoringconfidenceintroubledfinancialinstitutionsafterafinancialcrisis/ |
| Do Financial Consumers Discipline Bad Lenders? |
181301 |
/kaufmancenter/pastevents/inauguralkick-off2022/dofinancialconsumersdisciplinebadlenders/ |
| How Important Is Moral Hazard For Distressed Banks? |
181302 |
/kaufmancenter/pastevents/inauguralkick-off2022/howimportantismoralhazardfordistressedbanks/ |
| A New Framework for Banking Competition |
181303 |
/kaufmancenter/pastevents/inauguralkick-off2022/anewframeworkforbankingcompetition/ |
| right_column |
203417 |
/kaufmancenter/pastevents/annualpolicyconference2022/rightcolumn/ |
| Annual Policy Conference 2026 |
204952 |
/kaufmancenter/upcomingevents/annualpolicyconference2026/ |
| Annual Policy Conference 2023 |
188993 |
/kaufmancenter/pastevents/annualpolicyconference2023/ |
| Sheila Bair |
189136 |
/kaufmancenter/pastevents/policyconference2023/sheilabair/ |
| Loretta Mester |
189137 |
/kaufmancenter/pastevents/policyconference2023/lorettamester/ |
| Carl Tannenbaum |
189195 |
/kaufmancenter/pastevents/policyconference2023/carltannenbaum/ |
| Charles W. Calomiris |
189196 |
/kaufmancenter/pastevents/policyconference2023/charleswcalomiris/ |
| Ned S. Prescott |
189197 |
/kaufmancenter/pastevents/policyconference2023/nedsprescott/ |
| Bob Chirinko |
189198 |
/kaufmancenter/pastevents/policyconference2023/bobchirinko/ |
| Robert DeYoung |
189261 |
/kaufmancenter/pastevents/policyconference2023/robertdeyoung/ |
| Brandon Bolen |
189304 |
/kaufmancenter/pastevents/policyconference2023/brandonbolen/ |
| Tom Miller Jr. |
189305 |
/kaufmancenter/pastevents/policyconference2023/tommillerjr/ |
| Gene Amromin |
189331 |
/kaufmancenter/pastevents/policyconference2023/geneamromin/ |
| William Roberds |
189408 |
/kaufmancenter/pastevents/policyconference2023/williamroberds/ |
| Stephen Quinn |
189409 |
/kaufmancenter/pastevents/policyconference2023/stephenquinn/ |
| Charles M. Kahn |
189410 |
/kaufmancenter/pastevents/policyconference2023/charlesmkahn/ |
| Gregor Matvos |
189512 |
/kaufmancenter/pastevents/policyconference2023/gregormatvos/ |
| Jung Sakong |
189513 |
/kaufmancenter/pastevents/policyconference2023/jungsakong/ |
| Lamont Black |
189514 |
/kaufmancenter/pastevents/policyconference2023/lamontblack/ |
| Alexander K. Zentefis |
189739 |
/kaufmancenter/pastevents/policyconference2023/alexanderkzentefis/ |
| right_column |
203421 |
/kaufmancenter/pastevents/annualpolicyconference2023/rightcolumn/ |
| Annual Conference 2025 |
201753 |
/kaufmancenter/pastevents/annualconference2025/ |
| Issues Associated with ESG Investing |
192241 |
/kaufmancenter/pastevents/issuesassociatedwithesginvesting/ |
| Michele Gambera |
192244 |
/kaufmancenter/pastevents/issuesassociatedwithesginvesting/michelegambera/ |
| Bank Supervision and Regulation |
188250 |
/kaufmancenter/pastevents/banksupervisionandregulation/ |
| Business Schools and Public Service |
157004 |
/kaufmancenter/pastevents/business-schools-and-public-service/ |
| Photos |
157005 |
/kaufmancenter/pastevents/business-schools-and-public-service/photos/ |
| Public Policy and Financial Economics |
157006 |
/kaufmancenter/pastevents/publicpolicyandfinancialeconomics/ |
| Registration |
157007 |
/kaufmancenter/pastevents/publicpolicyandfinancialeconomics/registration/ |
| Registration-Speakers |
157008 |
/kaufmancenter/pastevents/publicpolicyandfinancialeconomics/registration-speakers/ |
| The Fed at 100 |
157001 |
/kaufmancenter/pastevents/thefedat100/ |
| Photos |
157002 |
/kaufmancenter/pastevents/thefedat100/photos/ |
| Shadow Regulatory Committee |
202955 |
/kaufmancenter/shadowregulatorycommittee/ |
| Ralph Arnold Gallery |
101480 |
/ralpharnoldgallery/ |
| site_logo |
202496 |
/ralpharnoldgallery/sitelogo/ |
| footer |
101498 |
/ralpharnoldgallery/footer/ |
| social media |
202498 |
/ralpharnoldgallery/socialmedia/ |
| About |
101485 |
/ralpharnoldgallery/about/ |
| Gallery Staff |
101488 |
/ralpharnoldgallery/about/gallerystaff/ |
| Plan Your Visit |
101837 |
/ralpharnoldgallery/about/planyourvisit/ |
| Exhibitions |
202527 |
/ralpharnoldgallery/exhibitions/ |
| Past Exhibitions |
202529 |
/ralpharnoldgallery/exhibitions/pastexhibitions/ |
| archive |
202531 |
/ralpharnoldgallery/exhibitions/pastexhibitions/archive/ |
| Exhibition Title 1 |
202549 |
/ralpharnoldgallery/exhibitions/exhibitiontitle1/ |
| Current Exhibitions |
204009 |
/ralpharnoldgallery/exhibitions/currentexhibitions/ |
| Flor Flores: mirror moment |
204399 |
/ralpharnoldgallery/exhibitions/upcomingexhibitions/florfloresmirrormoment/ |
| Drawing II Exhibition |
204400 |
/ralpharnoldgallery/exhibitions/upcomingexhibitions/drawingiiexhibition/ |
| Upcoming Exhibitions |
204397 |
/ralpharnoldgallery/exhibitions/upcomingexhibitions/ |
| 2026 Annual Juried Student Exhibition |
205207 |
/ralpharnoldgallery/exhibitions/upcomingexhibitions/2026annualjuriedstudentexhibition/ |
| Events |
202528 |
/ralpharnoldgallery/events/ |
| Past Events |
202530 |
/ralpharnoldgallery/events/pastevents/ |
| archive |
102170 |
/ralpharnoldgallery/events/pastevents/archive/ |
| RSVP For Events |
204653 |
https://luc.universitytickets.com/?cid=170 |
| Rambler Day |
146557 |
/ramblerday/ |
| site_logo |
146560 |
/ramblerday/sitelogo/ |
| Rambler Journey |
203031 |
/ramblerjourney/ |
| site_logo |
203033 |
/ramblerjourney/sitelogo/ |
| Partners for Your Support |
203032 |
/ramblerjourney/support/ |
| Reflections |
204348 |
/ramblerjourney/reflections/ |
| Examen - Care for the Whole Person |
204404 |
/ramblerjourney/reflections/examen-careforthewholeperson/ |
| Examen - Commit to Service, Social Justice, and Solidarity |
204408 |
/ramblerjourney/reflections/examen-committoservicesocialjusticeandsolidarity/ |
| Examen - Discern Guided by Faith |
204409 |
/ramblerjourney/reflections/examen-discernguidedbyfaith/ |
| Examen - Expand Knowledge |
204410 |
/ramblerjourney/reflections/examen-expandknowledge/ |
| Examen - Thrive in a Global Community |
204411 |
/ramblerjourney/reflections/examen-thriveinaglobalcommunity/ |
| Mission |
204329 |
/ramblerjourney/mission/ |
| History |
204325 |
/ramblerjourney/history/ |
| Purpose |
204328 |
/ramblerjourney/purpose/ |
| Find Your Bearings |
204339 |
/ramblerjourney/findyourbearings/ |
| Find Your Community |
204340 |
/ramblerjourney/findyourcommunity/ |
| Find Your Purpose |
204341 |
/ramblerjourney/findyourpurpose/ |
| Find Your Future |
204342 |
/ramblerjourney/findyourfuture/ |
| Necessary Milestones |
204343 |
/ramblerjourney/necessarymilestones/ |
| Rambler Success Program |
178512 |
/ramblersuccessprogram/ |
| site_logo |
178513 |
/ramblersuccessprogram/sitelogo/ |
| Footer |
178514 |
/ramblersuccessprogram/footer/ |
| social media |
178515 |
/ramblersuccessprogram/socialmedia/ |
| Who We Are |
203965 |
/ramblersuccessprogram/whoweare/ |
| Program Description |
178691 |
/ramblersuccessprogram/programdescription/ |
| SPARK! |
178693 |
/ramblersuccessprogram/spark/ |
| FAQs |
178694 |
/ramblersuccessprogram/faqs/ |
| Contact Us |
178696 |
/ramblersuccessprogram/contactus/ |
| Registration and Records, Department of |
24938 |
/regrec/ |
| site_logo |
25256 |
/regrec/sitelogo/ |
| Footer |
25255 |
/regrec/footer/ |
| cta |
198708 |
/regrec/cta/ |
| social media |
198710 |
/regrec/socialmedia/ |
| About Us |
24939 |
/regrec/aboutus/ |
| Academic Calendars |
24940 |
/regrec/aboutus/calendars/ |
| Contact Us |
24941 |
/regrec/aboutus/contactus/ |
| FERPA |
24950 |
/regrec/aboutus/ferpa/ |
| Solomon Amendment |
168497 |
/regrec/aboutus/ferpa/solomonamendment/ |
| LOCUS |
24942 |
/regrec/locus.html |
| About LOCUS |
70158 |
/regrec/aboutus/aboutlocus/ |
| Requests and Forms |
24943 |
/regrec/aboutus/forms/ |
| Students |
24967 |
/regrec/students/ |
| Academic Standards |
167862 |
https://www.luc.edu/academics/catalog/undergrad/reg.shtml |
| Apostilles |
69007 |
https://www.luc.edu/regrec/aboutus/forms |
| Archived Course Catalogs |
59894 |
/regrec/students/archivedcoursecatalogs/ |
| Degree and Enrollment Verification |
121886 |
/regrec/students/verification/ |
| Graduation & Diplomas |
24964 |
/regrec/graduation-diplomas/ |
| Immunization Records |
100955 |
http://www.luc.edu/wellness/tools/immunizations/ |
| LOCUS Help |
24966 |
/regrec/locushelp/ |
| LOCUS Q&A General |
25281 |
/regrec/locushelp/regrec/QAGeneral.shtml |
| LOCUS Q&A Registration |
25283 |
/regrec/locushelp/regrec/QARegistration.shtml |
| Transcripts |
24969 |
/regrec/transcripts.html |
| Name Change |
99182 |
https://www.luc.edu/regrec/aboutus/forms |
| Total Withdrawal |
24968 |
/regrec/students/totalwithdrawal/ |
| Preferred Name FAQ |
123475 |
/regrec/students/preferred-name-FAQ.shtml |
| Preferred Name Policy |
123969 |
/regrec/students/preferred-name-policy.shtml |
| Self-Service Pages Displaying Preferred Name |
124799 |
/regrec/students/ss-pn.shtml |
| Shopping Cart Validation |
126047 |
/regrec/students/shopping-cart-validation.shtml |
| Faculty & Staff |
24956 |
/regrec/facultystaff/ |
| Classroom Help |
24954 |
/regrec/facultystaff/classroomhelp/ |
| Class Scheduling |
24944 |
/regrec/facultystaff/scheduling/ |
| University Scheduling Grid |
67832 |
/regrec/facultystaff/scheduling/universityschedulinggrid/ |
| Simple Syllabus FAQ's |
199710 |
/regrec/facultystaff/simplesyllabusfaqs/ |
| Midterm Grade Submission |
201057 |
/regrec/facultystaff/midtermgradesubmission/ |
| Midterm Grade Frequently Asked Questions |
201058 |
/regrec/facultystaff/midtermgradesubmission/midtermgradefrequentlyaskedquestions/ |
| Simple Syllabus Due Dates |
201400 |
/regrec/facultystaff/simplesyllabusduedates/ |
| External Audiences |
24945 |
/regrec/apostilles/ |
| Diploma Availability |
24948 |
/regrec/diplomas/ |
| Degree and Enrollment Verification |
180323 |
https://www.luc.edu/regrec/students/verification/ |
| Residence Life |
190425 |
/reslife/ |
| site_logo |
190426 |
/reslife/sitelogo/ |
| Footer |
190427 |
/reslife/footer/ |
| cta |
190428 |
/reslife/cta/ |
| I Links |
190429 |
/reslife/ilinks/ |
| social media |
190430 |
/reslife/socialmedia/ |
| modules-programming |
190431 |
/reslife/modules-programming/ |
| About Us |
190432 |
/reslife/aboutus/ |
| Mission | Vision | Outcomes |
190499 |
/reslife/aboutus/missionvisionoutcomes/ |
| Diversity Statement |
190501 |
/reslife/aboutus/diversitystatement/ |
| The Meal Plan Requirement |
190497 |
/reslife/aboutus/themealplanrequirement/ |
| The Residency Requirement |
190503 |
/reslife/aboutus/theresidencyrequirement/ |
| Residential Curriculum |
190507 |
/reslife/aboutus/residentialcurriculum/ |
| Directory |
190505 |
/reslife/aboutus/directory/ |
| Future Residents |
190453 |
/reslife/futureresidents/ |
| Living Options |
190455 |
/reslife/futureresidents/livingoptions/ |
| Canisius Hall |
190519 |
/reslife/futureresidents/livingoptions/canisiushall/ |
| Bellarmine Hall |
190536 |
/reslife/futureresidents/livingoptions/bellarminehall/ |
| Baumhart Hall |
190528 |
/reslife/futureresidents/livingoptions/baumharthall/ |
| Francis Hall |
190521 |
/reslife/futureresidents/livingoptions/francishall/ |
| Fordham Hall |
190543 |
/reslife/futureresidents/livingoptions/fordhamhall/ |
| Fairfield Hall |
190537 |
/reslife/futureresidents/livingoptions/fairfieldhall/ |
| de Nobili Hall |
190529 |
/reslife/futureresidents/livingoptions/denobilihall/ |
| Marquette South Hall |
190522 |
/reslife/futureresidents/livingoptions/marquettesouthhall/ |
| Marquette Hall |
190544 |
/reslife/futureresidents/livingoptions/marquettehall/ |
| Le Moyne Hall |
190538 |
/reslife/futureresidents/livingoptions/lemoynehall/ |
| Georgetown Hall |
190530 |
/reslife/futureresidents/livingoptions/georgetownhall/ |
| San Francisco Hall |
190523 |
/reslife/futureresidents/livingoptions/sanfranciscohall/ |
| Regis Hall |
190545 |
/reslife/futureresidents/livingoptions/regishall/ |
| Messina Hall |
190539 |
/reslife/futureresidents/livingoptions/messinahall/ |
| Mertz Hall |
190531 |
/reslife/futureresidents/livingoptions/mertzhall/ |
| Spring Hill Hall |
190524 |
/reslife/futureresidents/livingoptions/springhillhall/ |
| Simpson Living-Learning Center |
190546 |
/reslife/futureresidents/livingoptions/simpsonliving-learningcenter/ |
| Seattle Hall |
190540 |
/reslife/futureresidents/livingoptions/seattlehall/ |
| Santa Clara Hall |
190532 |
/reslife/futureresidents/livingoptions/santaclarahall/ |
| Xavier Hall |
190547 |
/reslife/futureresidents/livingoptions/xavierhall/ |
| St. Louis Hall |
190541 |
/reslife/futureresidents/livingoptions/stlouishall/ |
| St. Joseph's Hall |
190533 |
/reslife/futureresidents/livingoptions/stjosephshall/ |
| Room & Board Rates |
190434 |
/reslife/futureresidents/roomboardrates/ |
| 2026-2027 Rates |
205888 |
/reslife/futureresidents/roomboardrates/2026-2027rates/ |
| 2025-2026 Rates |
200895 |
/reslife/futureresidents/roomboardrates/2025-2026rates/ |
| 2024-2025 Rates |
191677 |
/reslife/futureresidents/roomboardrates/2024-2025rates/ |
| First Year Students |
190509 |
/reslife/futureresidents/firstyearstudents/ |
| Transfer Students |
198481 |
/reslife/futureresidents/transferstudents/ |
| Graduate Students |
190511 |
/reslife/futureresidents/graduatestudents/ |
| Apply for Fall Housing |
190513 |
/reslife/futureresidents/applyforfallhousing/ |
| Apply for Spring Housing |
190515 |
/reslife/futureresidents/applyforspringhousing/ |
| FAQs |
190517 |
/reslife/futureresidents/faqs/ |
| Current Residents |
190457 |
/reslife/currentresidents/ |
| Living Options |
190650 |
/reslife/futureresidents/livingoptions/ |
| Room Care + Facility Policies |
190630 |
/reslife/resources/policiesprocedures/roomcarefacilitypolicies/ |
| Room & Board Rates |
190651 |
/reslife/futureresidents/roomboardrates/ |
| Room Selection (Current Residents) |
190459 |
/reslife/currentresidents/roomselectioncurrentresidents/ |
| Health and Safety Inspections |
190548 |
/reslife/currentresidents/healthandsafetyinspections/ |
| Move In |
190551 |
/reslife/currentresidents/movein/ |
| Emergency Procedures |
190575 |
/reslife/resources/policiesprocedures/emergencyprocedures/ |
| Residence Hall Association |
190624 |
/reslife/currentresidents/residencehallassociation/ |
| Winter Break |
190555 |
/reslife/currentresidents/winterbreak/ |
| Move Out |
190569 |
/reslife/currentresidents/moveout/ |
| Summer Housing |
190582 |
/reslife/currentresidents/summerhousing/ |
| Important Dates |
190584 |
/reslife/currentresidents/importantdates/ |
| Living-Learning Communities |
190461 |
/reslife/living-learningcommunities/ |
| Current LLCs |
190586 |
/reslife/living-learningcommunities/currentllcs/ |
| Arts in Society LLC |
190612 |
/reslife/living-learningcommunities/currentllcs/artsinsocietyllc/ |
| Global LLC |
190618 |
/reslife/living-learningcommunities/currentllcs/globalllc/ |
| Greenhouse LLC |
190594 |
/reslife/living-learningcommunities/currentllcs/greenhousellc/ |
| Kingfisher Catholic Studies LLC |
205702 |
/reslife/living-learningcommunities/kingfishercatholicstudiesllc/ |
| Legacy LLC |
206104 |
/reslife/living-learningcommunities/legacyllc/ |
| Nursing LLC |
205836 |
/reslife/living-learningcommunities/nursingllc/ |
| Rambler Brotherhood Project LLC |
190596 |
/reslife/living-learningcommunities/ramblerbrotherhoodprojectllc/ |
| Technology LLC |
206106 |
/reslife/living-learningcommunities/technologyllc/ |
| Program Affiliated LLCs |
190616 |
/reslife/living-learningcommunities/currentllcs/programaffiliatedllcs/ |
| Apply Now and FAQ |
190571 |
/reslife/living-learningcommunities/applynowandfaq/ |
| Resources |
190465 |
/reslife/resources/ |
| Student Resources |
190467 |
/reslife/resources/studentresources/ |
| Forms + Documents |
190632 |
/reslife/resources/formsdocuments/ |
| Important Dates |
190638 |
/reslife/currentresidents/importantdates/ |
| Join Our Team - Student Positions |
190639 |
/reslife/resources/joinourteam-studentpositions/ |
| Join Our Team - Professional Staff |
190643 |
/reslife/resources/joinourteam-professionalstaff/ |
| Laundry and Maintenance Requests |
190634 |
/reslife/resources/laundryandmaintenancerequests/ |
| Loyola Area Guide |
190628 |
/reslife/resources/loyolaareaguide/ |
| Mail and Deliveries |
191750 |
/reslife/resources/mailanddeliveries/ |
| Off-Campus Housing |
190645 |
/reslife/resources/off-campushousing/ |
| Parent and Guardian Resources |
190622 |
/reslife/resources/parentandguardianresources/ |
| Residence Life Facilities Information |
191749 |
/reslife/resources/residencelifefacilitiesinformation/ |
| Safety on Campus |
191690 |
/reslife/resources/safetyoncampus/ |
| Standard University Furniture |
191699 |
/reslife/resources/standarduniversityfurniture/ |
| Sustainability |
191735 |
/reslife/resources/sustainability/ |
| The Meal Plan Requirement |
190654 |
/reslife/aboutus/themealplanrequirement/ |
| Policies+Procedures |
206966 |
/reslife/resources/policiesprocedures/ |
| Images |
100656 |
/reslife/resources/images/ |
| Retreat & Ecology Campus |
8582 |
/retreatcampus/ |
| About |
36127 |
/retreatcampus/about/ |
| Volunteer Information |
33688 |
/retreatcampus/about/volunteer/ |
| Guest Survey |
49166 |
https://www.surveymonkey.com/s/5BX86B3 |
| Campus Map |
51929 |
http://www.luc.edu/media/lucedu/map-retreat-campus.pdf |
| Contact Us |
7208 |
/retreatcampus/about/contact/ |
| right_column |
45269 |
/retreatcampus/about/contact/rightcolumn/ |
| Request Information |
61829 |
http://luc.edu/retreatcampus/packages/nonloyola/requestinfo/ |
| News |
85157 |
/retreatcampus/news/ |
| right_column |
85167 |
/retreatcampus/news/rightcolumn/ |
| archive |
199681 |
/retreatcampus/news/archive/ |
| right_column |
36844 |
/retreatcampus/about/rightcolumn/ |
| Make a Payment |
93480 |
https://epay.luc.edu/C20996_ustores/web/store_cat.jsp?STOREID=98&CATID=183&SINGLESTORE=true |
| Testimonials |
79864 |
/retreatcampus/about/testimonials/ |
| Ecology |
54208 |
/retreatcampus/ecology/ |
| Biodiversity |
54469 |
/retreatcampus/ecology/biodiversity/ |
| Biodiversity Research |
79750 |
/retreatcampus/ecology/biodiversity/biodiversityresearch/ |
| right_column |
99618 |
/retreatcampus/ecology/biodiversity/biodiversityresearch/rightcolumn/ |
| right_column |
61833 |
/retreatcampus/ecology/biodiversity/rightcolumn/ |
| Ecological Restoration |
53711 |
/retreatcampus/ecology/restoration/ |
| right_column |
53759 |
/retreatcampus/ecology/restoration/rightcolumn/ |
| Restoration Work Days |
87229 |
/retreatcampus/ecology/restoration/restorationworkdays/ |
| right_column |
99617 |
/retreatcampus/ecology/restoration/restorationworkdays/rightcolumn/ |
| right_column |
73588 |
/retreatcampus/ecology/rightcolumn/ |
| Retreat Packages |
36608 |
/retreatcampus/packages/ |
| Day Meetings |
101192 |
/retreatcampus/packages/daymeetings/ |
| Retreat Groups |
8586 |
/retreatcampus/packages/nonloyola/ |
| right_column |
36655 |
/retreatcampus/packages/nonloyola/rightcolumn/ |
| Corporate Groups |
99323 |
/retreatcampus/packages/corporate/ |
| right_column |
99628 |
/retreatcampus/packages/corporate/rightcolumn/ |
| Ministry Groups |
99325 |
/retreatcampus/packages/ministry-groups/ |
| Loyola Faculty & Staff |
8587 |
/retreatcampus/packages/staff-retreats/ |
| right_column |
36657 |
/retreatcampus/packages/staff-retreats/rightcolumn/ |
| Loyola Students |
8589 |
/retreatcampus/packages/students/ |
| right_column |
36660 |
/retreatcampus/packages/students/rightcolumn/ |
| right_column |
36876 |
/retreatcampus/packages/rightcolumn/ |
| Frequently Asked Questions |
8588 |
/retreatcampus/packages/faqs/ |
| Programs & Events |
51969 |
/retreatcampus/programs/ |
| right_column |
76077 |
/retreatcampus/programs/rightcolumn/ |
| LUREC Summer Sessions |
184538 |
/retreatcampus/programs/lurecsummersessions/ |
| Services |
99400 |
/retreatcampus/services/ |
| Dining Services |
8585 |
/retreatcampus/dining/ |
| Housing Accommodations |
21994 |
/retreatcampus/housing-accommodations/ |
| Request Information |
12081 |
/retreatcampus/requestinfo/ |
| Thank You |
12105 |
/retreatcampus/requestinfo/thankyou/ |
| right_column |
99630 |
/retreatcampus/services/rightcolumn/ |
| site_logo |
8614 |
/retreatcampus/site_logo/ |
| Footer |
8630 |
/retreatcampus/footer/ |
| Documents |
69176 |
/retreatcampus/documents/ |
| social media |
199675 |
/retreatcampus/socialmedia/ |
| modules-programming |
199677 |
/retreatcampus/modules-programming/ |
| Ricci Scholars |
15934 |
/riccischolars/ |
| Program Details |
15935 |
/ricci/programdetails/ |
| Timeline |
15931 |
/ricci/timeline/ |
| Proposal and Steps |
56509 |
/ricci/proposalandsteps/ |
| Proposal Formatting and Organization |
203926 |
/ricci/researchproposalandsteps/proposalformattingandorganization/ |
| Awardees' Projects |
105133 |
/ricci/awardeesprojects/ |
| right_column |
105138 |
/ricci/awardeesandtheirprojects/rightcolumn/ |
| 2024-2025 Ricci Scholars |
204191 |
/ricci/awardeesandtheirprojects/2024-2025riccischolars/ |
| 2023-2024 Ricci Scholars |
193714 |
/ricci/awardeesandtheirprojects/2023-2024riccischolars/ |
| 2021-2022 Ricci Scholars |
176958 |
/ricci/awardeesandtheirprojects/2021-2022riccischolars/ |
| 2020-2021 Ricci Scholars |
166785 |
/ricci/awardeesandtheirprojects/2020-2021riccischolars/ |
| 2019-2020 Ricci Scholars |
127336 |
/ricci/awardeesandtheirprojects/2019-2020riccischolars/ |
| 2018-2019 Ricci Scholars |
108159 |
/ricci/awardeesandtheirprojects/2018-2019riccischolars/ |
| 2017-2018 Ricci Scholars |
105139 |
/ricci/2017-2018/index.shtml |
| 2016-2017 Ricci Scholars |
105134 |
/ricci/2016-2017/index.shtml |
| Info Sessions and Events |
202949 |
/ricci/infosessionsandevents/ |
| Events / Contact Us |
202949 |
/ricci/eventscontactus/ |
| modules-programming |
203435 |
/ricci/modules-programming/ |
| site_logo |
203191 |
/riccischolars/sitelogo/ |
| cta |
203192 |
/riccischolars/cta/ |
| I Links |
203193 |
/ricci/ilinks/ |
| Footer |
15937 |
/ricci/footer/ |
| robots.txt |
168663 |
/robots.txt |
| Safety Net Coalition |
19836 |
/safetynet/ |
| site_logo |
19979 |
/safetynet/sitelogo/ |
| Footer |
19982 |
/safetynet/footer/ |
| social media |
198360 |
/safetynet/socialmedia/ |
| cta |
198361 |
/safetynet/cta/ |
| modules-programming |
198362 |
/safetynet/modules-programming/ |
| About Us |
19837 |
/safetynet/about/ |
| Mission, Vision, and Purpose |
19839 |
/safetynet/about/ccai/ |
| Members |
100736 |
/safetynet/about/members/ |
| Contact Us |
19840 |
/safetynet/about/contact/ |
| Activities and Achievements |
122690 |
/safetynet/about/activitiesandachievements/ |
| Policies |
19848 |
/safetynet/policy/ |
| Social Host Law- Illinois |
52901 |
/safetynet/policy/socialhostlaw-illinois/ |
| Social Host Law: for Students |
52908 |
/safetynet/policy/socialhostlaw-illinois/socialhostlawforstudents/ |
| Social Host Law: for Faculty & Staff |
52909 |
/safetynet/policy/socialhostlaw-illinois/socialhostlawforfacultystaff/ |
| Good Samaritan Policy |
19849 |
/safetynet/policy/samaritans/ |
| Good Samaritan Policy FAQs |
37329 |
/safetynet/policy/samaritans/goodsamaritanpolicyfaqs/ |
| Alcohol Policy- Residence Life |
95433 |
/safetynet/policy/alcoholpolicy-residencelife/ |
| Alcohol- JFRC policies |
95437 |
/safetynet/policy/alcohol-jfrcpolicies/ |
| Drug-Free Schools & Campuses Act |
100738 |
/safetynet/policy/drug-freeschoolscampusesact/ |
| Alcohol Policies |
122695 |
/safetynet/policy/alcoholpolicies/ |
| Cannabis and Other Drug Policies |
122696 |
/safetynet/policy/cannabisandotherdrugpolicies/ |
| Resources |
100727 |
/safetynet/resources/ |
| Statistics |
19841 |
/safetynet/resources/faq/ |
| Sexual Assault Prevention for Graduate Students |
94974 |
/safetynet/resources/sexualassaultpreventionforgraduatestudents/ |
| Hosting a Party? Keep It Fun! Keep It Safe! |
19850 |
/safetynet/resources/hosting/ |
| Join the Wolfpack |
64436 |
/safetynet/resources/jointhewolfpack/ |
| Safer Drinking Tips |
71431 |
/safetynet/resources/saferdrinkingtips/ |
| Prevention |
122691 |
/safetynet/prevention/ |
| Responsible Drinking |
122697 |
/safetynet/prevention/responsibledrinking/ |
| Alcohol Free Options |
122698 |
/safetynet/prevention/alcoholfreeoptions/ |
| Cannabis |
122699 |
/safetynet/prevention/cannabis/ |
| New Student Education |
122700 |
/safetynet/prevention/newstudenteducation/ |
| Alcohol Wise and U Got This! Courses |
19846 |
/safetynet/prevention/newstudenteducation/alcoholedu/ |
| Marketing |
122701 |
/safetynet/prevention/marketing/ |
| Alcohol harm reduction posters |
105829 |
/safetynet/prevention/marketing/alcoholharmreductionposters/ |
| Background of Alcohol poster campaign |
105830 |
/safetynet/prevention/marketing/alcoholharmreductionposters/backgroundofalcoholpostercampaign/ |
| Pandemic Lessons Poster Campaign |
166459 |
/safetynet/prevention/marketing/pandemiclessonspostercampaign/ |
| Holiday Safety |
125898 |
/safetynet/prevention/holidaysafety/ |
| St. Patrick's Day Weekend |
120392 |
/safetynet/prevention/holidaysafety/stpatricksdayweekend/ |
| Halloween Safety |
189786 |
/safetynet/prevention/holidaysafety/halloweensafety/ |
| Cannabis Awareness Week 2022 |
168346 |
/safetynet/prevention/cannabisawarenessweek2022/ |
| Support |
122692 |
/safetynet/support/ |
| Emergency/After Hours Care |
122702 |
/safetynet/support/emergencyafterhourscare/ |
| Emergency/Crisis Care |
203466 |
/safetynet/support/emergencyafterhourscare/emergencycrisiscare/ |
| Nearest Emergency Departments |
203467 |
/safetynet/support/emergencyafterhourscare/emergencycrisiscare/nearestemergencydepartments/ |
| Alcohol Resources |
122703 |
/safetynet/support/alcoholresources/ |
| Cannabis Resources |
122704 |
/safetynet/support/cannabisresources/ |
| Self-Assessment Tools |
122705 |
/safetynet/support/self-assessmenttools/ |
| eCHECKUP TO GO |
62222 |
/safetynet/support/self-assessmenttools/echeckuptogo/ |
| For Parents |
122706 |
/safetynet/support/forparents/ |
| AOD 101 |
122693 |
/safetynet/aod101/ |
| Alcohol |
122707 |
/safetynet/aod101/alcohol/ |
| Cannabis |
122708 |
/safetynet/aod101/cannabis/ |
| Other Drugs |
122709 |
/safetynet/aod101/otherdrugs/ |
| LUC Data |
122710 |
/safetynet/aod101/lucdata/ |
| AOD in the news |
123722 |
/safetynet/aod101/aodinthenews/ |
| Trainings |
122694 |
/safetynet/trainings/ |
| Presentations |
122712 |
/safetynet/trainings/presentations/ |
| Wellness Wolfpack |
122713 |
/safetynet/trainings/wellnesswolfpack/ |
| Staff Consultations |
122714 |
/safetynet/trainings/staffconsultations/ |
| Narcan Training |
198424 |
/safetynet/trainings/narcantraining/ |
| For Faculty & Staff |
19843 |
/safetynet/faculty/ |
| Events |
65825 |
/safetynet/events/ |
| Archive |
57874 |
/safetynet/archive/ |
| Resources |
19838 |
/safetynet/archive/resources/ |
| Alcohol & Other Drugs |
19991 |
/safetynet/archive/alcohol-drugs/ |
| home_right_column |
19981 |
/safetynet/archive/homerightcolumn/ |
| site_home_slideshow |
19980 |
/safetynet/archive/sitehomeslideshow/ |
| Scholars Programs |
53552 |
/scholarsprograms/ |
| Scholars Programs |
89778 |
/scholarsprograms/scholarsprograms/ |
| Achieving College Excellence |
163623 |
https://www.luc.edu/ace/index.shtml |
| Arrupe Continuing Scholars |
202925 |
/scholarsprograms/academicenrichmentprograms/arrupecontinuingscholars/ |
| Cristo Rey Scholars |
123299 |
/scholarsprograms/academicenrichmentprograms/cristoreyscholars/ |
| Greer Scholars |
198060 |
/scholarsprograms/academicenrichmentprograms/greerscholars/ |
| Hope Chicago Scholars |
198061 |
/scholarsprograms/academicenrichmentprograms/hopechicagoscholars/ |
| Leadership Scholars Program |
185361 |
/scholarsprograms/leadershipscholarsprogram/ |
| About Us |
196323 |
/scholarsprograms/leadershipscholarsprogram/aboutus/ |
| Program Services and Leadership Curriculum |
196324 |
/scholarsprograms/leadershipscholarsprogram/programservicesandleadershipcurriculum/ |
| Admissions |
196325 |
/scholarsprograms/leadershipscholarsprogram/admissions/ |
| Scholar Cohorts |
196334 |
/scholarsprograms/leadershipscholarsprogram/scholarcohorts/ |
| Student Leader Profiles |
185362 |
/scholarsprograms/leadershipscholarsprogram/studentleaderprofiles/ |
| Profiles |
198864 |
/scholarsprograms/leadershipscholarsprogram/studentleaderprofiles/profiles/ |
| right_column |
203115 |
/scholarsprograms/leadershipscholarsprogram/studentleaderprofiles/profiles/rightcolumn/ |
| Staff Profiles |
185364 |
/scholarsprograms/leadershipscholarsprogram/staffprofiles/ |
| Profiles |
198859 |
/scholarsprograms/leadershipscholarsprogram/staffprofiles/profiles/ |
| Register for Information Session |
185428 |
/scholarsprograms/leadershipscholarsprogram/registerforinformationsession/ |
| Frequently Asked Questions about the Leadership Scholars Program |
205822 |
/scholarsprograms/leadershipscholarsprogram/frequentlyaskedquestionsabouttheleadershipscholarsprogram/ |
| Senn Scholars |
198062 |
/scholarsprograms/academicenrichmentprograms/sennscholars/ |
| Student Academic Services |
198115 |
/scholarsprograms/studentacademicservices/ |
| site_logo |
53679 |
/scholarsprograms/sitelogo/ |
| Footer |
53678 |
/scholarsprograms/footer/ |
| modules-programming |
198852 |
/scholarsprograms/modules-programming/ |
| School of Communication |
189253 |
/soc/index.shtml |
| site_logo |
189254 |
/soc/sitelogo/ |
| Footer |
189255 |
/soc/footer/ |
| cta |
189256 |
/soc/cta/ |
| social media |
189258 |
/soc/socialmedia/ |
| modules-programming |
189259 |
/soc/modules-programming/ |
| AudienceNav |
206547 |
/soc/audiencenav/ |
| About |
189260 |
/soc/about/index.shtml |
| Mission, Vision & Values |
189556 |
/soc/about/missionvisionvalues/ |
| Dean's Message |
189557 |
/soc/about/deansmessage/ |
| Faculty & Staff |
189558 |
/soc/about/facultystaff/ |
| Profiles |
190987 |
/soc/about/facultystaff/profiles/ |
| right_column |
201854 |
/soc/about/facultystaff/profiles/rightcolumn/ |
| Adjunct Faculty Directory |
198132 |
/soc/about/facultystaff/adjunctfacultydirectory/ |
| Profiles |
198133 |
/soc/about/facultystaff/adjunctfacultydirectory/profiles/ |
| Alumni |
189560 |
/soc/about/alumni/ |
| modules-programming |
189928 |
/soc/about/alumni/modules-programming/ |
| News & Stories |
189561 |
/soc/about/newsstories/ |
| Contact |
189562 |
/soc/about/contact/ |
| right_column |
189585 |
/soc/about/contact/rightcolumn/ |
| Schedule a High School Field Trip |
202789 |
/soc/about/scheduleahighschoolfieldtrip/ |
| SOC Spaces |
205911 |
/soc/about/socspaces/ |
| The 2025-26 Impact Report |
205558 |
/soc/about/soc-experience-2026/ |
| Dean's Reflection |
205889 |
/soc/soc-experience-2026-dev/deansreflection/ |
| Program Growth |
205890 |
/soc/soc-experience-2026-dev/programgrowth/ |
| Adaptable by Nature, Anchored in Industry |
205891 |
/soc/soc-experience-2026-dev/programgrowth/adaptablebynatureanchoredinindustry/ |
| Undergraduate Experience |
205892 |
/soc/soc-experience-2026-dev/undergraduateexperience/ |
| Programs & Portfolios |
205931 |
/soc/soc-experience-2026-dev/undergraduateexperience/programsportfolios/ |
| Student-powered. City-connected |
205904 |
/soc/soc-experience-2026-dev/undergraduateexperience/student-poweredcity-connected/ |
| Student Work That Hits Different |
205905 |
/soc/soc-experience-2026-dev/undergraduateexperience/studentworkthathitsdifferent/ |
| Lights. Camera. Story. |
205906 |
/soc/soc-experience-2026-dev/undergraduateexperience/lightscamerastory/ |
| Introducing the SOC Media Fellows |
205930 |
/soc/soc-experience-2026-dev/undergraduateexperience/introducingthesocmediafellows/ |
| Alumni Spotlight |
205893 |
/soc/soc-experience-2026-dev/alumnispotlight/ |
| Evolving with Purpose. Leading with Voice. |
205898 |
/soc/soc-experience-2026-dev/alumnispotlight/evolvingwithpurposeleadingwithvoice/ |
| In the Community |
205894 |
/soc/soc-experience-2026-dev/inthecommunity/ |
| Community in Action. Connection in Motion. |
205899 |
/soc/soc-experience-2026-dev/inthecommunity/communityinactionconnectioninmotion/ |
| Center for Digital Ethics and Policy |
205895 |
/soc/soc-experience-2026-dev/centerfordigitalethicsandpolicy/ |
| Fostering Dialogue. Informing Practice. |
205900 |
/soc/soc-experience-2026-dev/centerfordigitalethicsandpolicy/fosteringdialogueinformingpractice/ |
| Graduate Experience |
205896 |
/soc/soc-experience-2026-dev/graduateexperience/ |
| Adapting. Advancing. Leading into the future. |
205901 |
/soc/soc-experience-2026-dev/graduateexperience/adaptingadvancingleadingintothefuture/ |
| Fast-tracked. Future-focused. |
205902 |
/soc/soc-experience-2026-dev/graduateexperience/fast-trackedfuture-focused/ |
| Partners |
205897 |
/soc/soc-experience-2026-dev/partners/ |
| Rooted in Chicago. Ready for the World |
205903 |
/soc/soc-experience-2026-dev/partners/rootedinchicagoreadyfortheworld/ |
| Admission |
189552 |
/soc/admission/ |
| Apply |
189563 |
/soc/admission/apply/ |
| Tuition and Financial Aid |
189564 |
/soc/admission/tuitionandfinancialaid/ |
| Scholarships |
189565 |
/soc/admission/scholarships/ |
| Transfer Students |
189566 |
/soc/admission/transferstudents/ |
| Academics |
189553 |
/soc/academics/ |
| Undergraduate Degrees |
189567 |
/soc/academics/undergraduatedegrees/ |
| Advertising Creative |
190974 |
/soc/academics/undergraduatedegrees/advertisingcreative/ |
| Advertising and Public Relations |
190975 |
/soc/academics/undergraduatedegrees/advertisingandpublicrelations/ |
| Public Communication and Advocacy |
190976 |
/soc/academics/undergraduatedegrees/publiccommunicationandadvocacy/ |
| Communication Studies |
190977 |
/soc/academics/undergraduatedegrees/communicationstudies/ |
| Film and Digital Media |
190978 |
/soc/academics/undergraduatedegrees/filmanddigitalmedia/ |
| Multimedia Journalism |
190979 |
/soc/academics/undergraduatedegrees/multimediajournalism/ |
| Sports Media |
206563 |
/soc/academics/undergraduatedegrees/sportsmedia/ |
| Accelerated Bachelor's to Master's Programs |
190980 |
/soc/academics/undergraduatedegrees/acceleratedbachelorstomastersprograms/ |
| Digital Media and Storytelling or Global Strategic Communication |
190981 |
/soc/academics/undergraduatedegrees/digitalmediaandstorytellingorglobalstrategiccommunication/ |
| Global Strategic Communication |
190982 |
/soc/academics/undergraduatedegrees/globalstrategiccommunication/ |
| Graduate Degrees |
189568 |
/soc/academics/graduatedegrees/ |
| Course Syllabi |
191927 |
/soc/academics/coursesyllabi/ |
| 2024 Syllabi |
192103 |
/soc/academics/coursesyllabi/2024syllabi/ |
| Spring 2024 Syllabi |
191929 |
/soc/academics/coursesyllabi/2024syllabi/spring2024syllabi/ |
| 2023 Syllabi |
192104 |
/soc/academics/coursesyllabi/2023syllabi/ |
| Fall 2023 Syllabi |
191930 |
/soc/academics/coursesyllabi/2023syllabi/fall2023syllabi/ |
| Spring 2023 Syllabi |
192091 |
/soc/academics/coursesyllabi/2023syllabi/spring2023syllabi/ |
| 2022 Syllabi |
192095 |
/soc/academics/coursesyllabi/2022syllabi/ |
| 2021 Syllabi |
192105 |
/soc/academics/coursesyllabi/2021syllabi/ |
| 2021 Syllabi |
192106 |
/soc/academics/coursesyllabi/2021syllabi/2021syllabi/ |
| 2020 Syllabi |
192107 |
/soc/academics/coursesyllabi/2020syllabi/ |
| Fall 2020 Syllabi |
192108 |
/soc/academics/coursesyllabi/2020syllabi/fall2020syllabi/ |
| Spring 2020 Syllabi |
192113 |
/soc/academics/coursesyllabi/2020syllabi/spring2020syllabi/ |
| 2019 Syllabi |
192120 |
/soc/academics/coursesyllabi/2019syllabi/ |
| Spring 2019 Syllabi |
192121 |
/soc/academics/coursesyllabi/2019syllabi/spring2019syllabi/ |
| Fall 2019 Syllabi |
192122 |
/soc/academics/coursesyllabi/2019syllabi/fall2019syllabi/ |
| 2018 Syllabi |
192123 |
/soc/academics/coursesyllabi/2018syllabi/ |
| Fall 2018 Syllabi |
192124 |
/soc/academics/coursesyllabi/2018syllabi/fall2018syllabi/ |
| 2017 Syllabi |
192126 |
/soc/academics/coursesyllabi/2017syllabi/ |
| Fall 2017 Syllabi |
192127 |
/soc/academics/coursesyllabi/2017syllabi/fall2017syllabi/ |
| Spring 2017 Syllabi |
192128 |
/soc/academics/coursesyllabi/2017syllabi/spring2017syllabi/ |
| 2016 Syllabi |
192129 |
/soc/academics/coursesyllabi/2016syllabi/ |
| Fall 2016 Syllabi |
192130 |
/soc/academics/coursesyllabi/2016syllabi/fall2016syllabi/ |
| Spring 2016 Syllabi |
192131 |
/soc/academics/coursesyllabi/2016syllabi/spring2016syllabi/ |
| 2015 Syllabi |
192132 |
/soc/academics/coursesyllabi/2015syllabi/ |
| Fall 2015 Syllabi |
192133 |
/soc/academics/coursesyllabi/2015syllabi/fall2015syllabi/ |
| Spring 2015 Syllabi |
192134 |
/soc/academics/coursesyllabi/2015syllabi/spring2015syllabi/ |
| 2014 Syllabi |
192135 |
/soc/academics/coursesyllabi/2014syllabi/ |
| Fall 2014 Syllabi |
192136 |
/soc/academics/coursesyllabi/2014syllabi/fall2014syllabi/ |
| Spring 2014 Syllabi |
192137 |
/soc/academics/coursesyllabi/2014syllabi/spring2014syllabi/ |
| Minors |
189569 |
/soc/academics/minors/ |
| Master Class for Media Managers |
189570 |
/soc/academics/masterclassformediamanagers/ |
| Graduation Requirements |
189571 |
/soc/academics/graduationrequirements/ |
| Academic Advising |
189572 |
/soc/academics/academicadvising/ |
| Academic Policies |
189573 |
/soc/academics/academicpolicies/ |
| Forms |
189574 |
/soc/academics/forms/ |
| Assets |
191762 |
/soc/academics/forms/assets/ |
| Engaged Learning |
189554 |
/soc/engagedlearning/ |
| Overview |
189575 |
/soc/engagedlearning/overview/ |
| Study Abroad |
189576 |
/soc/engagedlearning/studyabroad/ |
| International Public Relations: London |
190988 |
/soc/engagedlearning/studyabroad/internationalpublicrelationslondon/ |
| Innovations in Digital Advertising: Nice & Cannes, France |
190989 |
/soc/engagedlearning/studyabroad/innovationsindigitaladvertisingnicecannesfrance/ |
| Global Media & K-Culture |
190990 |
/soc/engagedlearning/studyabroad/globalmediak-culture/ |
| Topics in Global Strategic Communication: Spain |
190991 |
/soc/engagedlearning/studyabroad/topicsinglobalstrategiccommunicationspain/ |
| Washington D.C. Program |
189577 |
/soc/engagedlearning/washingtondcprogram/ |
| Frequently Asked Questions |
190994 |
/soc/engagedlearning/washingtondcprogram/frequentlyaskedquestions/ |
| Internships |
189578 |
/soc/engagedlearning/internships/ |
| Internship Orientation Dates |
192085 |
/soc/engagedlearning/internships/internshiporientationdates/ |
| Media Fellows Program |
200599 |
/soc/engagedlearning/mediafellowsprogram/ |
| SOC Scholarships |
201579 |
/soc/engagedlearning/socscholarships/ |
| Student Research and Creative Works Fund |
201904 |
/soc/engagedlearning/studentresearchandcreativeworksfund/ |
| Student Experience |
189555 |
/soc/studentexperience/ |
| Student Activities |
189579 |
/soc/studentexperience/studentactivities/ |
| Mosaic Magazine |
192067 |
/soc/studentexperience/studentactivities/mosaicmagazine/ |
| archive |
192068 |
/soc/studentexperience/studentactivities/mosaicmagazine/archive/ |
| Debate Society |
199739 |
/soc/studentexperience/studentactivities/debatesociety/ |
| OWL Lab |
189580 |
/soc/studentexperience/owllab/ |
| Policies and Procedures |
189692 |
/soc/studentexperience/owllab/policiesandprocedures/ |
| Rambler Productions |
189581 |
/soc/studentexperience/ramblerproductions/ |
| Center for Digital Ethics & Policy |
190995 |
https://www.luc.edu/digitalethics/ |
| Stories |
191742 |
/soc/stories/ |
| View all Past Stories |
201928 |
/soc/stories/viewallpaststories/ |
| 2025 |
201968 |
/soc/stories/2025/ |
| archive |
201969 |
/soc/stories/2025/archive/ |
| Academy Visits SOC |
201929 |
/soc/stories/2025/academyvisitssoc/ |
| Ethics Meets AI |
202619 |
/soc/stories/2025/ethicsmeetsai/ |
| Global Classroom |
202766 |
/soc/stories/2025/globalclassroom/ |
| Driven to Tell the Story |
203670 |
/soc/stories/2025/driventotellthestory/ |
| Eye of the Storm |
204115 |
/soc/stories/2025/eyeofthestorm/ |
| Beauty of Storytelling |
204239 |
/soc/stories/2025/beautyofstorytelling/ |
| Thinking Globally, Leading Strategically |
204377 |
/soc/stories/2025/thinkinggloballyleadingstrategically/ |
| Media Fellows Cook Up Community at Pizzeria Uno |
204391 |
/soc/stories/2025/mediafellowscookupcommunityatpizzeriauno/ |
| St. Ignatius Prep at SoC |
204492 |
/soc/stories/2025/stignatiusprepatsoc/ |
| What Do We Owe |
204640 |
/soc/stories/2025/whatdoweowe/ |
| Great Pumpkin Pop Up |
204929 |
/soc/stories/2025/greatpumpkinpopup/ |
| The Art of Healing |
205439 |
/soc/stories/2025/theartofhealing/ |
| Legacy in the Making |
205441 |
/soc/stories/2025/legacyinthemaking/ |
| Capturing the Game |
205534 |
/soc/stories/2025/capturingthegame/ |
| Ricci Scholar Rojewski |
205712 |
/soc/stories/2025/riccischolarrojewski/ |
| Lipschultz Social Media |
205713 |
/soc/stories/2025/lipschultzsocialmedia/ |
| Master Class for Media Managers Builds Community |
205917 |
/soc/stories/2025/masterclassformediamanagersbuildscommunity/ |
| 2024 |
191743 |
/soc/stories/2024/ |
| archive |
191744 |
/soc/stories/2024/archive/ |
| Alum Spotlight Vitkin |
205604 |
/soc/stories/2024/alumspotlightvitkin/ |
| 2023 |
191747 |
/soc/stories/2023/ |
| archive |
191748 |
/soc/stories/2023/archive/ |
| 2022 |
158275 |
/soc/stories/2022/ |
| archive |
158276 |
/soc/stories/2022/archive/ |
| 2021 |
158272 |
/soc/stories/2021/ |
| archive |
158274 |
/soc/stories/2021/archive/ |
| 2020 |
155216 |
/soc/stories/2020/ |
| Homefront |
152061 |
/soc/stories/2020/homefront/ |
| archive |
152066 |
/soc/stories/2020/homefront/archive/ |
| archive |
155217 |
/soc/stories/2020/archive/ |
| deleted |
157440 |
/soc/stories/2020/archive/deleted/ |
| 2019 |
152177 |
/soc/stories/2019/ |
| archive |
152178 |
/soc/stories/2019/archive/ |
| 2018 |
152179 |
/soc/stories/2018/ |
| archive |
152180 |
/soc/stories/2018/archive/ |
| 2017 |
152181 |
/soc/stories/2017/ |
| archive |
152182 |
/soc/stories/2017/archive/ |
| 2016 |
152183 |
/soc/stories/2016/ |
| archive |
152184 |
/soc/stories/2016/archive/ |
| 2015 |
152185 |
/soc/stories/2015/ |
| archive |
152186 |
/soc/stories/2015/archive/ |
| 2014 |
152187 |
/soc/stories/2014/ |
| archive |
152188 |
/soc/stories/2014/archive/ |
| 2013 |
152189 |
/soc/stories/2013/ |
| archive |
152190 |
/soc/stories/2013/archive/ |
| 2012 |
152191 |
/soc/stories/2012/ |
| archive |
152192 |
/soc/stories/2012/archive/ |
| 2026 |
206568 |
/soc/stories/2026/ |
| archive |
206569 |
/soc/stories/2026/archive/ |
| The Windy City Watcher with Caroline Lyngen |
206241 |
/soc/stories/2025-26/thewindycitywatcherwithcarolinelyngen/ |
| Robert Kennedy: A Storyteller Across Borders and Back Again |
206242 |
/soc/stories/2025-26/robertkennedyastorytelleracrossbordersandbackagain/ |
| Media Fellows at Billy Goat Tavern |
206261 |
/soc/stories/2025-26/mediafellowsatbillygoattavern/ |
| Media Fellows Take Second City |
206540 |
/soc/stories/2025/mediafellowstakesecondcity/ |
| 2026 Presidents Medallion |
206678 |
/soc/stories/2026/2026presidentsmedallion/ |
| Tomorrow Begins Here |
206701 |
/soc/stories/2026/tomorrowbeginshere/ |
| Inside a Super Bowl Ad with Kate Sheehan |
206763 |
/soc/stories/2026/insideasuperbowladwithkatesheehan/ |
| Media Fellows Hit a Home Run at Wrigley Field |
207095 |
/soc/stories/2026/mediafellowshitahomerunatwrigleyfield/ |
| School of Continuing & Professional Studies (SCPS) |
182413 |
/scps/ |
| site_logo |
182414 |
/scps/sitelogo/ |
| Footer |
182415 |
/scps/footer/ |
| right_column |
182557 |
/scps/rightcolumn/ |
| cta |
182416 |
/scps/cta/ |
| social media |
182418 |
/scps/socialmedia/ |
| modules-programming |
182419 |
/scps/modules-programming/ |
| About |
182437 |
/scps/about/ |
| Dean’s Message |
182553 |
/scps/about/deansmessage/ |
| Faculty and Staff |
182555 |
/scps/about/facultyandstaff/ |
| Profiles |
182556 |
/scps/about/facultyandstaff/profiles/ |
| right_column |
182560 |
/scps/about/facultyandstaff/rightcolumn/ |
| News and Events |
182561 |
/scps/about/newsandevents/ |
| archive |
182563 |
/scps/about/newsandevents/archive/ |
| Alonzo Greene |
177456 |
/scps/about/newsandevents/scpsagreene/ |
| Lindsey Villanueva |
177698 |
/scps/about/newsandevents/scpslvillanueva/ |
| Angela Broadway |
181010 |
/scps/about/newsandevents/scpsabroadway/ |
| Building Better Tomorrows |
188004 |
/scps/about/newsandevents/better-tomorrows/ |
| Thinking Strategically about DEI in Organizations |
188438 |
/scps/about/newsandevents/thinkingstrategicallyaboutdeiinorganizations/ |
| Learning Analytics Unlocked: Explore. Experiment. Employ. |
191236 |
/scps/about/newsandevents/learninganalyticsunlockedexploreexperimentemploy/ |
| Trucking Bees |
194198 |
/scps/about/newsandevents/truckingbees/ |
| Alpha Sigma Nu 2023 |
194366 |
/scps/about/newsandevents/alphasigmanu2023/ |
| Commencement |
194755 |
/scps/about/newsandevents/commencement/ |
| SCPS 2024 Commencement Speaker |
194757 |
/scps/about/newsandevents/commencement/scps2024commencementspeaker/ |
| Loyola Leads the Way |
196448 |
/scps/about/newsandevents/loyolaleadstheway/ |
| Empowering Adult Learners |
196451 |
/scps/about/newsandevents/empoweringadultlearners/ |
| Loyola MPS Programs |
198562 |
/scps/about/newsandevents/loyolampsprograms/ |
| The Power of Legacy |
198889 |
/scps/about/newsandevents/thepoweroflegacy/ |
| Honoring Academic Excellence |
200919 |
/scps/about/newsandevents/honoringacademicexcellence/ |
| Commencement 2025 |
202651 |
/scps/about/newsandevents/commencement2025/ |
| Learning with Purpose Speaker Series |
203173 |
/scps/about/newsandevents/learningwithpurposespeakerseries/ |
| Learning with Purpose Speaker Series Interest Form |
203427 |
/scps/about/newsandevents/learningwithpurposespeakerseries/learningwithpurposespeakerseriesinterestform/ |
| Thank You |
203428 |
/scps/about/newsandevents/learningwithpurposespeakerseries/learningwithpurposespeakerseriesinterestform/thankyou/ |
| Future-Proof: How to Build Financial Security Through Smart Career Moves |
201962 |
/scps/about/newsandevents/learningwithpurposespeakerseries/future-proofhowtobuildfinancialsecuritythroughsmartcareermoves/ |
| Pope Leo and the Future of the Church: A Conversation with James Martin, S.J. |
203401 |
/scps/about/newsandevents/learningwithpurposespeakerseries/popeleoandthefutureofthechurchaconversationwithjamesmartinsj/ |
| Veterans Event |
203402 |
/scps/about/newsandevents/learningwithpurposespeakerseries/veteransevent/ |
| Taking A New Path |
204096 |
/scps/about/newsandevents/takinganewpath/ |
| Danessa Bredicean |
204099 |
/scps/about/newsandevents/danessabredicean/ |
| Eva Mika - 2025 Vincent J. Duminuco, S.J., Award for Assessment Leadership |
204171 |
/scps/about/newsandevents/evamika-2025vincentjduminucosjawardforassessmentleadership/ |
| One Year In |
205512 |
/scps/about/newsandevents/oneyearin/ |
| President's Medallion 2026 |
206639 |
/scps/about/newsandevents/presidentsmedallion2026/ |
| Commencement 2026 |
206770 |
/scps/about/newsandevents/commencement2026/ |
| High Demand for Paralegals |
206839 |
/scps/about/newsandevents/highdemandforparalegals/ |
| Bridget Wake |
206911 |
/scps/about/newsandevents/bridgetwake/ |
| Kia Walton |
206912 |
/scps/about/newsandevents/kiawalton/ |
| Grace Severson |
206945 |
/scps/about/newsandevents/graceseverson/ |
| FAQs |
182559 |
/scps/about/faqs/ |
| Contact |
182562 |
/scps/about/contact/ |
| Mission and Vision |
182554 |
/scps/about/missionandvision/ |
| Students Showcase |
182678 |
/scps/about/studentsshowcase/ |
| Alfredo Arreola Perez |
185572 |
/scps/about/studentsshowcase/alfredoarreolaperez/ |
| Angela Broadway |
182686 |
/scps/about/studentsshowcase/angelabroadway/ |
| Alonzo Greene |
182684 |
/scps/about/studentsshowcase/alonzogreene/ |
| Katherine Underwood |
182683 |
/scps/about/studentsshowcase/katherineunderwood/ |
| LeRoy Chalmers |
182670 |
/scps/about/studentsshowcase/leroychalmers/ |
| Caroline Zaia and Zaia Zaia |
182682 |
/scps/about/studentsshowcase/carolinezaiaandzaiazaia/ |
| Haeley Goldsmith |
182668 |
/scps/about/studentsshowcase/haeleygoldsmith/ |
| Michelle Cygan (BA '18) |
182669 |
/scps/about/studentsshowcase/michellecyganba18/ |
| Robin May-McMorris |
182679 |
/scps/about/studentsshowcase/robinmay-mcmorris/ |
| Vannessa Brown |
182680 |
/scps/about/studentsshowcase/vannessabrown/ |
| Faye Chambers |
182681 |
/scps/about/studentsshowcase/fayechambers/ |
| Chad Kingsbury |
189024 |
/scps/about/studentsshowcase/chadkingsbury/ |
| Akia Segers |
189027 |
/scps/about/studentsshowcase/akiasegers/ |
| Shawn Crump |
189041 |
/scps/about/studentsshowcase/shawncrump/ |
| Cory Bright |
189306 |
/scps/about/studentsshowcase/corybright/ |
| Amy Liesemeyer |
189310 |
/scps/about/studentsshowcase/amyliesemeyer/ |
| Mallory Mavros Gerent |
189314 |
/scps/about/studentsshowcase/mallorymavrosgerent/ |
| Lindsey Villanueva |
189327 |
/scps/about/studentsshowcase/lindseyvillanueva/ |
| Henry Nichols |
189533 |
/scps/about/studentsshowcase/henrynichols/ |
| Jessica Dent |
189536 |
/scps/about/studentsshowcase/jessicadent/ |
| Claire Fey |
189540 |
/scps/about/studentsshowcase/clairefey/ |
| Phillip Franco |
189605 |
/scps/about/studentsshowcase/phillipfranco/ |
| Ellie Zwart |
189608 |
/scps/about/studentsshowcase/elliezwart/ |
| Jacqueline Jasinski |
189626 |
/scps/about/studentsshowcase/jacquelinejasinski/ |
| Krystal Westmoreland |
189654 |
/scps/about/studentsshowcase/krystalwestmoreland/ |
| Michelle Feirn |
189657 |
/scps/about/studentsshowcase/michellefeirn/ |
| Natascha Freeman |
189660 |
/scps/about/studentsshowcase/nataschafreeman/ |
| Asia Adams |
189697 |
/scps/about/studentsshowcase/asiaadams/ |
| Cindy Hahn |
189770 |
/scps/about/studentsshowcase/cindyhahn/ |
| Maxime Louis |
189773 |
/scps/about/studentsshowcase/maximelouis/ |
| 2023 President’s Medallion Recipient |
189915 |
/scps/about/studentsshowcase/2023presidentsmedallionrecipient/ |
| Carissa Kobel |
189916 |
/scps/about/studentsshowcase/carissakobel/ |
| Alexandra Wilson |
190707 |
/scps/about/studentsshowcase/alexandrawilson/ |
| Catherine Nowak |
191008 |
/scps/about/studentsshowcase/catherinenowak/ |
| Shantineq Gatlin |
191361 |
/scps/about/studentsshowcase/shantineqgatlin/ |
| Dan Landsman |
191511 |
/scps/about/studentsshowcase/danlandsman/ |
| Maggie Ozan Rafferty |
191704 |
/scps/about/studentsshowcase/maggieozanrafferty/ |
| Mirta Garcia |
192214 |
/scps/about/studentsshowcase/mirtagarcia/ |
| Yvonne Cuevas |
192499 |
/scps/about/studentsshowcase/yvonnecuevas/ |
| John Chrusciel |
192506 |
/scps/about/studentsshowcase/johnchrusciel/ |
| David Tanner |
193367 |
/scps/about/studentsshowcase/davidtanner/ |
| Eve Erive-Alvarez |
193378 |
/scps/about/studentsshowcase/eveerive-alvarez/ |
| Carla Reed |
193715 |
/scps/about/studentsshowcase/carlareed/ |
| Fjolla Vitia |
193722 |
/scps/about/studentsshowcase/fjollavitia/ |
| Innovative Graduate Programs |
194153 |
/scps/about/studentsshowcase/innovativegraduateprograms/ |
| Morgan Andree |
194362 |
/scps/about/studentsshowcase/morganandree/ |
| Lesley Haynes |
195759 |
/scps/about/studentsshowcase/lesleyhaynes/ |
| Paige Patrick |
195764 |
/scps/about/studentsshowcase/paigepatrick/ |
| Dianne Dawson-Daniels |
195862 |
/scps/about/studentsshowcase/diannedawson-daniels/ |
| Nia Cantey |
197949 |
/scps/about/studentsshowcase/niacantey/ |
| Jeanne Sokolec |
198063 |
/scps/about/studentsshowcase/jeannesokolec/ |
| Ryan Cumming |
198068 |
/scps/about/studentsshowcase/ryancumming/ |
| Dan Vonder Heide |
198172 |
/scps/about/studentsshowcase/danvonderheide/ |
| Chris Fulton |
198175 |
/scps/about/studentsshowcase/chrisfulton/ |
| Jessica DePinto |
198225 |
/scps/about/studentsshowcase/jessicadepinto/ |
| Uriel Robles |
198240 |
/scps/about/studentsshowcase/urielrobles/ |
| Sherry Reynolds-Whitaker |
198253 |
/scps/about/studentsshowcase/sherryreynolds-whitaker/ |
| Jamaica Spencer (Tech) |
198389 |
/scps/about/studentsshowcase/jamaicaspencertech/ |
| Claudine Muchin (Tech) |
198397 |
/scps/about/studentsshowcase/claudinemuchintech/ |
| Chris Coles (Tech) |
198400 |
/scps/about/studentsshowcase/chriscolestech/ |
| Heather New/ Lauren Feilich (Tech) |
198404 |
/scps/about/studentsshowcase/heathernewlaurenfeilichtech/ |
| Jessica Mansbach |
198445 |
/scps/about/studentsshowcase/jessicamansbach/ |
| Chris Dickman |
198516 |
/scps/about/studentsshowcase/chrisdickman/ |
| Fran Ruiz |
198880 |
/scps/about/studentsshowcase/franruiz/ |
| Michael Dubin |
198915 |
/scps/about/studentsshowcase/michaeldubin/ |
| Shweta Singh |
198918 |
/scps/about/studentsshowcase/shwetasingh/ |
| Maggie Wimp |
199090 |
/scps/about/studentsshowcase/maggiewimp/ |
| Tess Troschuk |
199288 |
/scps/about/studentsshowcase/tesstroschuk/ |
| Kisha Williamson |
199345 |
/scps/about/studentsshowcase/kishawilliamson/ |
| Emily Neary |
199352 |
/scps/about/studentsshowcase/emilyneary/ |
| 2024 President’s Medallion Recipient |
199543 |
/scps/about/studentsshowcase/2024presidentsmedallionrecipient/ |
| Smita Gosain |
199594 |
/scps/about/studentsshowcase/smitagosain/ |
| Kristlyn Thomas |
199791 |
/scps/about/studentsshowcase/kristlynthomas/ |
| Dean Robert L. Hasentab |
200423 |
/scps/about/studentsshowcase/deanrobertlhasentab/ |
| Katrice Miller |
201605 |
/scps/about/studentsshowcase/katricemiller/ |
| Washington Week 2025 |
202264 |
/scps/about/studentsshowcase/washingtonweek2025/ |
| Natasha Teetsov |
202615 |
/scps/about/studentsshowcase/natashateetsov/ |
| Yvette Garcia |
202757 |
/scps/about/studentsshowcase/yvettegarcia/ |
| Tyler Marx |
203038 |
/scps/about/studentsshowcase/tylermarx/ |
| Jesse Goodman |
203047 |
/scps/about/studentsshowcase/jessegoodman/ |
| EdMedia 2025 |
203175 |
/scps/about/studentsshowcase/edmedia2025/ |
| Melline Fontes Noronha (Tech) |
203614 |
/scps/about/studentsshowcase/mellinefontesnoronhatech/ |
| Caroline and Zaia Zaia |
203922 |
/scps/about/studentsshowcase/carolineandzaiazaia/ |
| Annual Progress 2024 |
191697 |
/scps/about/annualprogress2024/ |
| Profiles |
193929 |
/scps/about/profiles/ |
| Jackie Gilbert's college story |
194504 |
/scps/about/profiles/jackiegilbertscollegestory/ |
| A Journey of Transformation |
194609 |
/scps/about/profiles/ajourneyoftransformation/ |
| Impact Report |
205280 |
/scps/about/impactreport/ |
| Message from the Dean |
205427 |
/scps/about/impactreport/messagefromthedean/ |
| Academic Excellence |
205539 |
/scps/about/impactreport/academicexcellence/ |
| Access |
205537 |
/scps/about/impactreport/access/ |
| Affordability |
205538 |
/scps/about/impactreport/affordability/ |
| Student Services |
205540 |
/scps/about/impactreport/studentservices/ |
| SCPS Ambassadors |
205541 |
/scps/about/impactreport/scpsambassadors/ |
| Faculty Profiles - Devon Price |
205542 |
/scps/about/impactreport/facultyprofiles-devonprice/ |
| Faculty Profiles - Dianne Dawson Daniels |
205580 |
/scps/about/impactreport/facultyprofiles-diannedawsondaniels/ |
| Faculty Profiles - Eva Mika |
205581 |
/scps/about/impactreport/facultyprofiles-evamika/ |
| Faculty Profiles - Chris Fulton |
205582 |
/scps/about/impactreport/facultyprofiles-chrisfulton/ |
| Veterans |
205543 |
/scps/about/impactreport/veterans/ |
| Student & Alumni Spotlights - Eddie Fay |
205544 |
/scps/about/impactreport/studentalumnispotlights-eddiefay/ |
| Student & Alumni Spotlights - Laurel Gilkerson |
205583 |
/scps/about/impactreport/studentalumnispotlights-laurelgilkerson/ |
| Student & Alumni Spotlights - Genevieve Gonnigan |
205584 |
/scps/about/impactreport/studentalumnispotlights-genevievegonnigan/ |
| Student & Alumni Spotlights - Jackie Gilbert |
205585 |
/scps/about/impactreport/studentalumnispotlights-jackiegilbert/ |
| Featured Programs - MA in Public Service Leadership |
205557 |
/scps/about/impactreport/featuredprograms-mainpublicserviceleadership/ |
| Featured Programs - BA in Paralegal Studies |
205586 |
/scps/about/impactreport/featuredprograms-bainparalegalstudies/ |
| Featured Programs - MPS in IT Leadership & Strategy |
205587 |
/scps/about/impactreport/featuredprograms-mpsinitleadershipstrategy/ |
| Learning Opportunities |
205546 |
/scps/about/impactreport/learningopportunities/ |
| Partnerships & Donors |
205547 |
/scps/about/impactreport/partnershipsdonors/ |
| Admission |
182438 |
/scps/admission/ |
| Admissions |
182564 |
/scps/admission/admissions/ |
| Tuition & Financial Aid |
182568 |
/scps/admission/tuitionfinancialaid/ |
| Veterans Educational Benefits |
182571 |
/scps/admission/financing/veteranseducationalbenefits/ |
| Community and Employer Partnerships |
182572 |
/scps/admission/financing/communityandemployerpartnerships/ |
| Thank You |
203001 |
/scps/admission/financing/communityandemployerpartnerships/thankyou/ |
| Scholarships |
203980 |
/scps/admission/scholarships/ |
| Community & Employer Partnerships |
203100 |
/scps/admission/communityemployerpartnerships/ |
| Community Colleges |
206443 |
/scps/admission/communitycolleges/ |
| Thank You |
206444 |
/scps/admission/communitycolleges/thankyou/ |
| Rankings |
206517 |
/scps/admission/rankings/ |
| Academics |
182439 |
/scps/academics/ |
| Undergraduate Degrees |
182579 |
/scps/academics/undergraduatedegrees/ |
| Graduate Programs |
182580 |
/scps/academics/graduateprograms/ |
| Professional Certificates |
182581 |
/scps/academics/professionalcertificates/ |
| Academic Calendars |
182582 |
/scps/academics/academiccalendars/ |
| Spring Academic Calendars |
182587 |
/scps/academics/academiccalendars/springacademiccalendars/ |
| Fall Academic Calendars |
182588 |
/scps/academics/academiccalendars/fallacademiccalendars/ |
| Course Schedules |
182583 |
/scps/academics/courseschedules/ |
| Academic Advising |
182584 |
/scps/academics/academicadvising/ |
| Student Experience |
182440 |
/scps/studentexperience/ |
| Online Learning |
182573 |
/scps/studentexperience/onlinelearning/ |
| Evening and Weekend Courses |
182574 |
/scps/studentexperience/eveningandweekendcourses/ |
| Connect with SCPS Ambassadors |
182575 |
/scps/studentexperience/connectwithscpsambassadors/ |
| Outcomes |
182441 |
/scps/outcomes/ |
| Overview |
182578 |
/scps/outcomes/ |
| Current Students |
182576 |
/scps/outcomes/currentstudents/ |
| Alumni |
182577 |
/scps/outcomes/alumni/ |
| Course Opportunities |
192467 |
/scps/outcomes/courseopportunities/ |
| Request Information |
182667 |
/scps/rfi/ |
| Visit Us |
182666 |
/scps/visitus/ |
| School of Education |
181383 |
/education/ |
| site_logo |
181626 |
/education/sitelogo/ |
| Footer |
181627 |
/education/footer/ |
| cta |
181628 |
/education/cta/ |
| I Links |
181629 |
/education/ilinks/ |
| social media |
181630 |
/education/socialmedia/ |
| modules-programming |
181631 |
/education/modules-programming/ |
| assets |
182711 |
/education/assets/ |
| About |
181634 |
/education/about/ |
| Mission and Vision |
181635 |
/education/about/missionandvision/ |
| Alumni |
181639 |
/education/about/alumni/ |
| 2023 Distinguished Alumni |
181641 |
/education/about/alumni/2023distinguishedalumni/ |
| Mamie Till-Mobley, MEd '71 |
185796 |
/education/about/alumni/mtm/ |
| 2024 Distinguished Alumni |
198820 |
/education/about/alumni/2024distinguishedalumni/ |
| 2022 Distinguished Alumni |
198822 |
/education/about/alumni/2022distinguishedalumni/ |
| 2025 Distinguished Alumni |
204267 |
/education/about/alumni/2025distinguishedalumni/ |
| Centers and Partnerships |
181643 |
/education/about/centersandpartnerships/ |
| Loyola CITE Partnership |
181644 |
/education/about/centersandpartnerships/loyolacitepartnership/ |
| Partnerships for Teacher Education |
197122 |
/education/about/centersandpartnerships/partnershipsforteachereducation/ |
| News and Events |
181645 |
/education/about/newsandevents/ |
| Stories |
181632 |
/education/about/newsandevents/stories/ |
| archive |
181633 |
/education/about/newsandevents/stories/archive/ |
| Fostering a spirit of collaboration. |
183409 |
/education/about/newsandevents/stories/psych-grant/ |
| Creating a meaningful education. |
183501 |
/education/about/newsandevents/stories/sayani-lcc/ |
| Loyola Future Teacher Club |
183519 |
/education/about/newsandevents/stories/future-teacher/ |
| 2026 Superintendent Profiles |
207102 |
/education/about/newsandevents/stories/2026superintendentprofiles/ |
| The ARtS Initiative |
185008 |
/education/about/newsandevents/stories/theartsinitiative/ |
| From Passion to Progress |
185153 |
/education/about/newsandevents/stories/frompassiontoprogress/ |
| Learning While Teaching |
185184 |
/education/about/newsandevents/stories/learningwhileteaching/ |
| Early Pride Matters |
185327 |
/education/about/newsandevents/stories/earlypridematters/ |
| Combating Racism |
185354 |
/education/about/newsandevents/stories/combatingracism/ |
| LU CHOICE |
185360 |
/education/about/newsandevents/stories/luchoice/ |
| Johnnie's Story |
185422 |
/education/about/newsandevents/stories/johnniesstory/ |
| Timing is everything |
185423 |
/education/about/newsandevents/stories/timingiseverything/ |
| Looking Back and Leading Forward |
185508 |
/education/about/newsandevents/stories/lookingbackandleadingforward/ |
| For the love of teaching |
185532 |
/education/about/newsandevents/stories/fortheloveofteaching/ |
| The Legacy of Mamie Till-Mobley |
189904 |
/education/about/newsandevents/stories/thelegacyofmamietill-mobley/ |
| 2023 President’s Medallion Recipient |
189914 |
/education/about/newsandevents/stories/2023presidentsmedallionrecipient/ |
| Laurel Brooks |
189975 |
/education/about/newsandevents/stories/laurelbrooks/ |
| Norma and Demetri |
190206 |
/education/about/newsandevents/stories/normaanddemetri/ |
| CITE Story |
191127 |
/education/about/newsandevents/stories/citestory/ |
| A Veteran's Passion for Education and Service |
191359 |
/education/about/newsandevents/stories/jesusramos/ |
| Alpha Upsilon Alpha 2024 |
191523 |
/education/about/newsandevents/stories/alphaupsilonalpha2024/ |
| S5 Poster Session |
191698 |
/education/about/newsandevents/stories/s5postersession/ |
| S6 Opportunity Fair |
192102 |
/education/about/newsandevents/stories/s6opportunityfair/ |
| Katarina Alvarado |
193740 |
/education/about/newsandevents/stories/katarinaalvarado/ |
| SOE Rankings 2024 |
193763 |
/education/about/newsandevents/stories/soerankings2024/ |
| SOE Excellence Awards 2024 |
193770 |
/education/about/newsandevents/stories/soeexcellenceawards2024/ |
| PDC Story |
194066 |
/education/about/newsandevents/stories/pdcstory/ |
| Alexandria Brist |
194067 |
/education/about/newsandevents/stories/alexandriabrist/ |
| Mia Gianfrancesco |
194068 |
/education/about/newsandevents/stories/miagianfrancesco/ |
| Elizabeth Usher |
194069 |
/education/about/newsandevents/stories/elizabethusher/ |
| Jeanie Chang |
194243 |
/education/about/newsandevents/stories/jeaniechang/ |
| Jake Bartilad |
194245 |
/education/about/newsandevents/stories/jakebartilad/ |
| Bernhard Walke |
194246 |
/education/about/newsandevents/stories/bernhardwalke/ |
| Candace Kyles |
198712 |
/education/about/newsandevents/stories/candacekyles/ |
| 2024 President’s Medallion Recipient |
199542 |
/education/about/newsandevents/stories/2024presidentsmedallionrecipient/ |
| Midwest Noyce Conference 2024 |
200547 |
/education/about/newsandevents/stories/midwestnoyceconference2024/ |
| Equity-Minded Leaders |
201414 |
/education/about/newsandevents/stories/equity-mindedleaders/ |
| 2025 SOE Excellence Awards |
202361 |
/education/about/newsandevents/stories/2025soeexcellenceawards/ |
| SOE Rankings 2025 |
202404 |
/education/about/newsandevents/stories/soerankings2025/ |
| 2025 Commencement Speaker |
202705 |
/education/about/newsandevents/stories/2025commencementspeaker/ |
| Building Bridges in Education |
202946 |
/education/about/newsandevents/stories/buildingbridgesineducation/ |
| Seungho Moon Award |
204190 |
/education/about/newsandevents/stories/seunghomoonaward/ |
| Chicago to Chiang Rai |
204350 |
/education/about/newsandevents/stories/chicagotochiangrai/ |
| Preparing Future Leaders in Applied Behavior Analysis |
204698 |
/education/about/newsandevents/stories/preparingfutureleadersinappliedbehavioranalysis/ |
| 2026 Illinois Superintendent of the Year |
205513 |
/education/about/newsandevents/stories/2026illinoissuperintendentoftheyear/ |
| SCS Press Release |
205766 |
/education/about/newsandevents/stories/scspressrelease/ |
| When Rome is the Classroom |
206079 |
/education/about/newsandevents/stories/whenromeistheclassroom/ |
| Supporting Local Schools the Loyola Way |
206101 |
/education/about/newsandevents/stories/supportinglocalschoolstheloyolaway/ |
| A Mission in Motion |
206102 |
/education/about/newsandevents/stories/amissioninmotion/ |
| Preparing to Lead in Higher Education |
206528 |
/education/about/newsandevents/stories/preparingtoleadinhighereducation/ |
| 2026 President's Medallion Recipient |
206564 |
/education/about/newsandevents/stories/2026presidentsmedallionrecipient/ |
| Golden Apple Alumnae Finalists |
206619 |
/education/about/newsandevents/stories/goldenapplealumnaefinalists/ |
| Shaping school leaders though collaboration & community |
206859 |
/education/about/newsandevents/stories/shapingschoolleadersthoughcollaborationcommunity/ |
| Golden Apple Award for Excellence in Teaching |
207268 |
/education/about/newsandevents/stories/goldenappleawardforexcellenceinteaching/ |
| Ed Condon Q&A |
207459 |
/education/about/newsandevents/stories/edcondonqa/ |
| Michael Lubelfeld Q&A |
207460 |
/education/about/newsandevents/stories/michaellubelfeldqa/ |
| Eric Twadell Q&A |
207461 |
/education/about/newsandevents/stories/erictwadellqa/ |
| Cindy Whittaker Q&A |
207462 |
/education/about/newsandevents/stories/cindywhittakerqa/ |
| ED Talks |
181646 |
/education/about/newsandevents/edtalks/ |
| Commencement |
181647 |
/education/about/newsandevents/commencement/ |
| Commencement 2023 |
194774 |
/education/about/newsandevents/commencement/commencement2023/ |
| Commencement 2024 |
202626 |
/education/about/newsandevents/commencement/commencement2024/ |
| Commencement 2025 |
206692 |
/education/about/newsandevents/commencement/commencement2025/ |
| 2025 Graduate Profiles |
195104 |
/education/about/newsandevents/commencement/2025graduateprofiles/ |
| Black History Education in Chicago |
181650 |
/education/about/newsandevents/blackhistoryeducationinchicago/ |
| Lifelong Learning - We Will Chicago |
181651 |
/education/about/newsandevents/lifelonglearning-wewillchicago/ |
| Revising Illinois' Social Science Standards |
181652 |
/education/about/newsandevents/revisingillinoissocialsciencestandards/ |
| Graduate Research Month |
183461 |
/education/about/newsandevents/grad-research/ |
| From Passion to Progress |
183485 |
/education/about/newsandevents/passion-progress/ |
| The Wozniak Lecture Series |
188338 |
/education/about/newsandevents/wozniak/ |
| 2023 Wozniak Lecture Series |
197894 |
/education/about/newsandevents/wozniak/2023wozniaklectureseries/ |
| 2025 Wozniak Lecture Series |
204082 |
/education/about/newsandevents/wozniak/2025wozniaklectureseries/ |
| Dr. Steven Isoye |
204165 |
/education/about/newsandevents/wozniak/2025wozniaklectureseries/meetsoe/ |
| Dr. Michael Lubelfeld |
204184 |
/education/about/newsandevents/wozniak/2025wozniaklectureseries/meetsoe/ |
| Dr. Nick Polyak |
204185 |
/education/about/newsandevents/wozniak/2025wozniaklectureseries/meetsoe/ |
| SOE 2026 Impact Report |
206168 |
/education/about/newsandevents/soe2026impactreport/ |
| Message from the Dean |
206171 |
/soe2025experience-dev/messagefromthedean/ |
| Transformative Education - Story |
206172 |
/soe2025experience-dev/transformativeeducation-story/ |
| Transformative Education - Scholars |
206974 |
/soe2025experience-dev/transformativeeducation-scholars/ |
| Transformative Education Spotlight - Study Abroad |
206173 |
/soe2025experience-dev/transformativeeducationspotlight-studyabroad/ |
| Academic Programs - Teaching and Learning |
206174 |
/soe2025experience-dev/academicprograms-teachingandlearning/ |
| Academic Programs - Graduate Programs |
206175 |
/soe2025experience-dev/academicprograms-graduateprograms/ |
| Academic Programs - ABA Spotlight |
206176 |
/soe2025experience-dev/academicprograms-abaspotlight/ |
| Research - Story |
206177 |
/soe2025experience-dev/research-story/ |
| Research - Faculty Profile - 01 |
206178 |
/soe2025experience-dev/research-facultyprofile-01/ |
| Research - Faculty Profile - 02 |
206179 |
/soe2025experience-dev/research-facultyprofile-02/ |
| Research - Faculty Profile - 03 |
206180 |
/soe2025experience-dev/research-facultyprofile-03/ |
| Research - Faculty Profile - 04 |
206182 |
/soe2025experience-dev/research-facultyprofile-04/ |
| Community - Shared spaces |
207023 |
/soe2025experience-dev/community-sharedspaces/ |
| Community - A network for good |
207035 |
/soe2025experience-dev/community-anetworkforgood/ |
| Community - The power of community partnership |
207036 |
/soe2025experience-dev/community-thepowerofcommunitypartnership/ |
| Community - Greely Center |
207041 |
/soe2025experience-dev/community-greelycenter/ |
| Student Profile - Betsy Leong (EdD ’25) |
206185 |
/soe2025experience-dev/studentprofile-betsyleongedd25/ |
| Student Profile - Alicia Oladipo (MEd ’25) |
206186 |
/soe2025experience-dev/studentprofile-aliciaoladipomed25/ |
| Student Profile - Aliki Siao (MEd/EdS ’25) |
206187 |
/soe2025experience-dev/studentprofile-alikisiaomededs25/ |
| Student Profile - Jake Bartilad (BSEd ’25) |
206188 |
/soe2025experience-dev/studentprofile-jakebartiladbsed25/ |
| Student Profile - Katie Emery (BSEd ’25) |
206189 |
/soe2025experience-dev/studentprofile-katieemerybsed25/ |
| Recognition and Support - Wozniak Lecture Series |
206191 |
/soe2025experience-dev/recognitionandsupport-wozniaklectureseries/ |
| Recognition and Support - Distinguished Alumni Awards |
206192 |
/soe2025experience-dev/recognitionandsupport-distinguishedalumniawards/ |
| Recognition and Support - Commencement |
206193 |
/soe2025experience-dev/recognitionandsupport-commencement/ |
| Recognition and Support - Alumni Excellence Celebration |
206194 |
/soe2025experience-dev/recognitionandsupport-alumniexcellencecelebration/ |
| Recognition - Celebrating changemakers |
206195 |
/education/about/newsandevents/soe2026impactreport/recognition-celebratingchangemakers/ |
| Scholarships - Investing in impact |
206197 |
/soe2025experience-dev/scholarships-investinginimpact/ |
| Student Profiles |
206181 |
/education/about/newsandevents/soe2026impactreport/studentprofiles/ |
| Digital Media |
184661 |
/education/about/meetsoe/ |
| Instagram Updates |
184920 |
/education/about/ig/ |
| Admission |
181653 |
/education/admission/ |
| Apply |
181654 |
/education/admission/apply/ |
| Transfer into Loyola's Education Program |
181812 |
/education/admission/apply/transferintoloyolaseducationprogram/ |
| Administration and Supervision Superintendent Endorsement EdD |
181813 |
/education/admission/apply/eddse/ |
| Administration and Supervision Principal Endorsement EdD |
181814 |
/education/admission/apply/eddpe/ |
| EdD in Higher Education |
181862 |
/education/admission/apply/eddinhighereducation/ |
| EdD in Curriculum, Culture, and Communities (3Cs) |
181863 |
/education/admission/apply/eddincurriculumcultureandcommunities3cs/ |
| EdD in School Psychology |
181864 |
/education/admission/apply/eddinschoolpsychology/ |
| PhD in Counseling Psychology |
181865 |
/education/admission/apply/phdincounselingpsychology/ |
| PhD in Higher Education |
181866 |
/education/admission/apply/phdinhighereducation/ |
| PhD in Research Methodology |
181867 |
/education/admission/apply/phdinresearchmethodology/ |
| PhD in School Psychology |
181868 |
/education/admission/apply/phdinschoolpsychology/ |
| MEd/EdS in School Psychology |
181869 |
/education/admission/apply/mededsinschoolpsychology/ |
| EdS in Clinical Mental Health Counseling |
181870 |
/education/admission/apply/edsinclinicalmentalhealthcounseling/ |
| MEd in Secondary Education |
181871 |
/education/admission/apply/medinsecondaryeducation/ |
| MEd in Elementary Education |
181872 |
/education/admission/apply/medinelementaryeducation/ |
| Administration and Supervision for MEd Catholic Principal Preparation |
181873 |
/education/admission/apply/medcpp/ |
| MEd in Administration and Supervision for School Leaders |
181874 |
/education/admission/apply/medinadministrationandsupervisionforschoolleaders/ |
| MEd in Community Counseling |
181882 |
/education/admission/apply/medincommunitycounseling/ |
| MEd in Higher Education |
181875 |
/education/admission/apply/medinhighereducation/ |
| MEd in International Higher Education |
181876 |
/education/admission/apply/medininternationalhighereducation/ |
| MEd in School Counseling |
181877 |
/education/admission/apply/medinschoolcounseling/ |
| MEd in School and Community Counseling |
181878 |
/education/admission/apply/medinschoolandcommunitycounseling/ |
| MEd in Curriculum, Culture, and Communities (3Cs) - Hybrid & In-Person |
181879 |
/education/admission/apply/medincurriculumcultureandcommunities3cs-hybridin-person/ |
| MEd in Catholic School Leadership |
181880 |
/education/admission/apply/medincatholicschoolleadership/ |
| MEd in Language, Culture, and Curriculum |
181881 |
/education/admission/apply/medinlanguagecultureandcurriculum/ |
| MA in Community Counseling |
181883 |
/education/admission/apply/maincommunitycounseling/ |
| MA in Research Methodology |
181885 |
/education/admission/apply/mainresearchmethodology/ |
| Instructional Coaching Certificate |
181884 |
/education/admission/apply/instructionalcoachingcertificate/ |
| Measurement and Quantitative Methodology |
181887 |
/education/admission/apply/measurementandquantitativemethodology/ |
| Organizational Evaluation |
181888 |
/education/admission/apply/organizationalevaluation/ |
| School Discipline Reform Certificate |
181889 |
/education/admission/apply/schooldisciplinereformcertificate/ |
| Administration and Supervision Superintendent Endorsement Certificate |
181891 |
/education/admission/apply/sec/ |
| Administration and Supervision Principal Endorsement Certificate |
181892 |
/education/admission/apply/isbepe/ |
| Director of Special Education Certificate |
181894 |
/education/admission/apply/dsec/ |
| Curriculum and Pedagogy in Higher Education Online Certificate |
181895 |
/education/admission/apply/curriculumandpedagogyinhighereducationonlinecertificate/ |
| Five-Year BS/MEd in Physics and Secondary Education |
181896 |
/education/admission/apply/five-yearbsmedinphysicsandsecondaryeducation/ |
| Five-Year BS/MEd in Math and Secondary Education |
181897 |
/education/admission/apply/five-yearbsmedinmathandsecondaryeducation/ |
| Five-Year BA/MEd in Chemistry and Secondary Education |
181898 |
/education/admission/apply/five-yearbamedinchemistryandsecondaryeducation/ |
| Five-Year BS/MEd in Biology and Secondary Education |
181899 |
/education/admission/apply/five-yearbsmedinbiologyandsecondaryeducation/ |
| Non-Degree Program |
181900 |
/education/admission/apply/non-degreeprogram/ |
| Transformative Education Scholars Program |
182552 |
/education/admission/apply/scholars-program/ |
| Financial Assistance |
181901 |
/education/admission/financialassistance/ |
| Graduate Financial Assistance |
181902 |
/education/admission/financialassistance/graduatefinancialassistance/ |
| Scholarships |
181903 |
/education/admission/financialassistance/scholarships/ |
| Noyce Scholars |
181906 |
/education/admission/financialassistance/scholarships/noycescholars/ |
| Apply |
181909 |
/education/admission/financialassistance/scholarships/noycescholars/apply/ |
| Golden Apple Scholars of Illinois |
181904 |
/education/admission/financialassistance/scholarships/goldenapplescholarsofillinois/ |
| Ratner Endowment for Future Teachers |
181907 |
/education/admission/financialassistance/scholarships/ratnerendowmentforfutureteachers/ |
| Apply |
181910 |
/education/admission/financialassistance/scholarships/ratnerendowmentforfutureteachers/apply/ |
| International Students |
181911 |
/education/admission/internationalstudents/ |
| Admitted Student FAQ |
181912 |
/education/admission/admittedstudentfaq/ |
| Academics |
181913 |
/education/academics/ |
| Undergraduate Degree Programs |
197077 |
/education/academics/undergraduatedegreeprograms/ |
| BSEd in Bilingual/Bicultural Education |
181916 |
/education/academics/undergraduatedegreeprograms/bsedinbilingualbiculturaleducation/ |
| Undergraduate Degrees |
181915 |
/education/academics/undergraduatedegreeprograms/undergraduatedegrees/ |
| Endorsements |
197078 |
/education/academics/undergraduatedegreeprograms/endorsements/ |
| BSEd in Early Childhood Special Education |
181917 |
/education/academics/undergraduatedegreeprograms/bsedinearlychildhoodspecialeducation/ |
| BSEd in Elementary Education |
181918 |
/education/academics/undergraduatedegreeprograms/bsedinelementaryeducation/ |
| BSEd in Secondary Education |
181919 |
/education/academics/undergraduatedegreeprograms/bsedinsecondaryeducation/ |
| BSEd in Special Education |
181920 |
/education/academics/undergraduatedegreeprograms/bsedinspecialeducation/ |
| Minors |
182004 |
/education/academics/undergraduatedegreeprograms/minors/ |
| Education Policy Studies Minor |
182005 |
/education/academics/undergraduatedegreeprograms/minors/educationpolicystudiesminor/ |
| Reading Teacher Minor |
182006 |
/education/academics/undergraduatedegreeprograms/minors/readingteacherminor/ |
| Special Education Minor |
182007 |
/education/academics/undergraduatedegreeprograms/minors/specialeducationminor/ |
| Leadership Studies Minor |
202247 |
/education/academics/undergraduatedegreeprograms/minors/leadershipstudiesminor/ |
| Teaching and Learning Minor |
203344 |
/education/academics/undergraduatedegreeprograms/minors/teachingandlearningminor/ |
| BSEd in Middle Grades Education |
197079 |
/education/academics/undergraduatedegreeprograms/bsedinmiddlegradeseducation/ |
| Electives and Internships |
197099 |
/education/academics/undergraduatedegreeprograms/electivesandinternships/ |
| Graduate Degree Programs |
181914 |
/education/academics/graduatedegreeprograms/ |
| Master Degrees |
181921 |
/education/academics/graduatedegreeprograms/masterdegrees/ |
| Doctoral Degrees |
181986 |
/education/academics/graduatedegreeprograms/doctoraldegrees/ |
| PhD in Counseling Psychology |
181987 |
/education/academics/graduatedegreeprograms/doctoraldegrees/phdincounselingpsychology/ |
| PhD in Higher Education |
181988 |
/education/academics/graduatedegreeprograms/doctoraldegrees/phdinhighereducation/ |
| PhD in Research Methodology |
181989 |
/education/academics/graduatedegreeprograms/doctoraldegrees/phdinresearchmethodology/ |
| PhD in School Psychology |
181990 |
/education/academics/graduatedegreeprograms/doctoraldegrees/phdinschoolpsychology/ |
| Accelerated Bachelor's to Master's Degree Programs |
181996 |
/education/academics/graduatedegreeprograms/acceleratedbachelorstomastersdegreeprograms/ |
| Specialist Degrees |
182001 |
/education/academics/graduatedegreeprograms/specialistdegrees/ |
| Areas of Study |
182008 |
/education/academics/areasofstudy/ |
| Teaching and Learning |
182010 |
/education/academics/areasofstudy/teachingandlearning/ |
| Higher Education |
182012 |
/education/academics/areasofstudy/highereducation/ |
| Teaching, Learning, and Leading with Schools and Communities |
182013 |
/education/academics/areasofstudy/teachinglearningandleadingwithschoolsandcommunities/ |
| BSEd Program Phases |
182014 |
/education/academics/areasofstudy/teachinglearningandleadingwithschoolsandcommunities/bsedprogramphases/ |
| Counseling |
182015 |
/education/academics/areasofstudy/counseling/ |
| Research |
182016 |
/education/academics/areasofstudy/research/ |
| Educational Leadership |
182017 |
/education/academics/areasofstudy/adsu/ |
| School Psychology |
182018 |
/education/academics/areasofstudy/schoolpsychology/ |
| Certificates and Endorsements |
182033 |
/education/academics/certificatesandendorsements/ |
| Online Certificate in Curriculum and Pedagogy in Higher Education |
182034 |
/education/academics/certificatesandendorsements/onlinecertificateincurriculumandpedagogyinhighereducation/ |
| Instructional Coaching Certificate |
182035 |
/education/academics/certificatesandendorsements/instructionalcoachingcertificate/ |
| Measurement and Quantitative Methodology Certificate |
182037 |
/education/academics/certificatesandendorsements/measurementandquantitativemethodologycertificate/ |
| Organizational Evaluation Certificate |
182038 |
/education/academics/certificatesandendorsements/organizationalevaluationcertificate/ |
| School Discipline Reform Certificate |
182039 |
/education/academics/certificatesandendorsements/schooldisciplinereformcertificate/ |
| Educational Leadership: Superintendent Endorsement Certificate |
182051 |
/education/academics/certificatesandendorsements/sec/ |
| Director of Special Education Endorsement |
182048 |
/education/academics/certificatesandendorsements/dsec/ |
| ISBE Principal Endorsement |
182050 |
/education/academics/certificatesandendorsements/isbepe/ |
| Electives for Any Student |
182052 |
/education/academics/electivesforanystudent/ |
| Advising and Course Information |
182053 |
/education/academics/syllabi/ |
| Accreditation |
182091 |
/education/academics/accreditation/ |
| Illinois State Licensure |
182092 |
/education/academics/illinoisstatelicensure/ |
| Teacher Licensure |
182093 |
/education/academics/illinoisstatelicensure/teacherlicensure/ |
| School Psychologist Licensure |
182094 |
/education/academics/illinoisstatelicensure/schoolpsychologistlicensure/ |
| School Counselor Licensure |
182095 |
/education/academics/illinoisstatelicensure/schoolcounselorlicensure/ |
| School Social Work Licensure |
182096 |
/education/academics/illinoisstatelicensure/schoolsocialworklicensure/ |
| Academic Calendar |
182097 |
/education/academics/academiccalendar/ |
| Directory |
182098 |
/education/directory/ |
| Profiles |
182100 |
/education/directory/profiles/ |
| right_column |
182551 |
/education/directory/rightcolumn/ |
| Research |
182101 |
/education/research/ |
| Grants and Projects |
182102 |
/education/research/grantsandprojects/ |
| Pandemic-Era Schooling |
181956 |
/education/research/grantsandprojects/pandemic-eraschooling/ |
| Authentic Partnerships with Families |
181958 |
/education/research/grantsandprojects/pandemic-eraschooling/authenticpartnershipswithfamilies/ |
| Equitable Access to Educational Resources |
181959 |
/education/research/grantsandprojects/pandemic-eraschooling/equitableaccesstoeducationalresources/ |
| Innovative and Personalized Pedagogy |
181960 |
/education/research/grantsandprojects/pandemic-eraschooling/innovativeandpersonalizedpedagogy/ |
| Educator Collaboration and Co-Teaching |
181961 |
/education/research/grantsandprojects/pandemic-eraschooling/educatorcollaborationandco-teaching/ |
| Reasonable Expectations and Workload |
181962 |
/education/research/grantsandprojects/pandemic-eraschooling/reasonableexpectationsandworkload/ |
| Social, Emotional, and Mental Wellness |
181963 |
/education/research/grantsandprojects/pandemic-eraschooling/socialemotionalandmentalwellness/ |
| The Research |
183707 |
/education/research/grantsandprojects/pandemic-eraschooling/theresearch/ |
| Pre-service Teacher Research Experience in Biodiversity Studies |
183470 |
/education/research/grantsandprojects/pre-ret/ |
| Inclusive Teaching Toolkit - DEV |
188413 |
/education/research/grantsandprojects/inclusiveteachingtoolkit-dev/ |
| LGBTQIA+ Teaching Resources |
188414 |
/education/research/grantsandprojects/inclusiveteachingtoolkit-dev/lgbtqiateachingresources/ |
| Anti-Racist Education Resources |
188415 |
/education/research/grantsandprojects/inclusiveteachingtoolkit-dev/anti-racisteducationresources/ |
| Social Justice and Other Resources |
188416 |
/education/research/grantsandprojects/inclusiveteachingtoolkit-dev/socialjusticeandotherresources/ |
| Resources by Topic Area |
191760 |
/education/research/grantsandprojects/inclusiveteachingtoolkit-dev/resourcesbytopicarea/ |
| Professional Development |
197965 |
/education/research/grantsandprojects/inclusiveteachingtoolkit-dev/professionaldevelopment/ |
| Practicing Democracy in Communities |
198231 |
/education/research/grantsandprojects/practicingdemocracyincommunities/ |
| Teacher Support |
198232 |
/education/research/grantsandprojects/practicingdemocracyincommunities/teachersupport/ |
| Student Opportunities |
198233 |
/education/research/grantsandprojects/practicingdemocracyincommunities/studentopportunities/ |
| Community Partners |
198234 |
/education/research/grantsandprojects/practicingdemocracyincommunities/communitypartners/ |
| Puentes Fellows 2025-2026 |
204935 |
/education/research/grantsandprojects/puentesfellows2025-2026/ |
| TeachNOW |
205060 |
/education/research/grantsandprojects/teachnow/ |
| Student Experience |
182103 |
/education/studentexperience/ |
| Chicago |
182104 |
/education/studentexperience/chicago/ |
| Outcomes |
182106 |
/education/studentexperience/outcomes/ |
| Resources |
182199 |
/education/studentexperience/resources/ |
| Academic Policies |
182200 |
/education/studentexperience/resources/academicpolicies/ |
| International Baccalaureate |
182201 |
/education/studentexperience/resources/internationalbaccalaureate/ |
| Visit Us |
182202 |
/education/studentexperience/resources/visitus/ |
| Teacher Preparation Programs |
182203 |
/education/studentexperience/resources/teacherpreparationprograms/ |
| Request Information |
182204 |
/education/studentexperience/resources/requestinformation/ |
| Request Information Graduate |
182205 |
/education/studentexperience/resources/requestinformation/requestinformationgraduate/ |
| Thank you for your request |
182206 |
/education/studentexperience/resources/requestinformation/requestinformationgraduate/thankyouforyourrequest/ |
| Student Organizations, Awards and Honors |
182210 |
/education/studentexperience/studentorganizationsawardsandhonors/ |
| Alpha Sigma Nu |
182211 |
/education/studentexperience/studentorganizationsawardsandhonors/alphasigmanu/ |
| ASN2024 |
189630 |
/education/studentexperience/studentorganizationsawardsandhonors/alphasigmanu/asn2024/ |
| ASN2023 |
198687 |
/education/studentexperience/studentorganizationsawardsandhonors/alphasigmanu/asn2023/ |
| ASN2025 |
205279 |
/education/studentexperience/studentorganizationsawardsandhonors/alphasigmanu/asn2025/ |
| School of Education Excellence Awards |
182212 |
/education/studentexperience/studentorganizationsawardsandhonors/schoolofeducationexcellenceawards/ |
| President's Medallion |
199335 |
/education/studentexperience/studentorganizationsawardsandhonors/presidentsmedallion/ |
| Study Abroad |
182213 |
/education/studentexperience/studyabroad/ |
| School of Environmental Sustainability |
163437 |
/sustainability/ |
| site_logo |
163438 |
/sustainability/sitelogo/ |
| Footer |
163439 |
/sustainability/footer/ |
| cta |
163441 |
/sustainability/cta/ |
| social media |
163442 |
/sustainability/socialmedia/ |
| home_audience |
168192 |
/sustainability/homeaudience/ |
| modules-programming |
166257 |
/sustainability/modules-programming/ |
| About |
163443 |
/sustainability/about/ |
| News & Events |
167126 |
/sustainability/about/newsevents/ |
| archive |
81887 |
/sustainability/about/newsevents/archive/ |
| Web Articles 2022 |
178800 |
/sustainability/about/newsevents/webarticles2022/ |
| LUREC Summer Session 2022 |
178802 |
/sustainability/about/newsevents/webarticles2022/lurecsummersession2022/ |
| THEA Institute 2022 |
179516 |
/sustainability/about/newsevents/webarticles2022/theainstitute2022/ |
| Internships 2022 |
180146 |
/sustainability/about/newsevents/webarticles2022/internships2022/ |
| Urban-Ag-2022-09 |
180487 |
/sustainability/about/newsevents/webarticles2022/urban-ag-2022-09/ |
| 2022-09-Sarah-Ku |
180670 |
/sustainability/about/newsevents/webarticles2022/2022-09-sarah-ku/ |
| Abrams 1st Place |
180881 |
/sustainability/about/newsevents/webarticles2022/abrams1stplace/ |
| grad alum Cranberg |
180906 |
/sustainability/about/newsevents/webarticles2022/gradalumcranberg/ |
| Abrams 2nd place |
181033 |
/sustainability/about/newsevents/webarticles2022/abrams2ndplace/ |
| Healing Earth New Edition |
181477 |
/sustainability/about/newsevents/webarticles2022/healingearthnewedition/ |
| Presidents Medallion |
181701 |
/sustainability/about/newsevents/webarticles2022/presidentsmedallion/ |
| grad alum Samaras |
181708 |
/sustainability/about/newsevents/webarticles2022/gradalumsamaras/ |
| Abrams 3rd place |
181779 |
/sustainability/about/newsevents/webarticles2022/abrams3rdplace/ |
| Engrained 4-Star Rating |
181849 |
/sustainability/about/newsevents/webarticles2022/engrained4-starrating/ |
| Marlene-Brito-Millan |
181955 |
/sustainability/about/newsevents/webarticles2022/marlene-brito-millan/ |
| Bike Friendly Campus |
182044 |
/sustainability/about/newsevents/webarticles2022/bikefriendlycampus/ |
| Web Articles 2023 |
182632 |
/sustainability/about/newsevents/webarticles2023/ |
| Abrams Challenge Classes |
182633 |
/sustainability/about/newsevents/webarticles2023/abramschallengeclasses/ |
| Climate Conference 2023 |
183463 |
/sustainability/about/newsevents/webarticles2023/climateconference2023/ |
| Student Research 2023 |
183548 |
/sustainability/about/newsevents/webarticles2023/studentresearch2023/ |
| Waste Week 2023 |
184208 |
/sustainability/about/newsevents/webarticles2023/wasteweek2023/ |
| Environmental Racism |
184261 |
/sustainability/about/newsevents/webarticles2023/environmentalracism/ |
| Climate Conference 2023 Keynote |
184514 |
/sustainability/about/newsevents/webarticles2023/climateconference2023keynote/ |
| Student Research 2 2023 |
184744 |
/sustainability/about/newsevents/webarticles2023/studentresearch22023/ |
| Climate Conference 2023 Takeaways |
184855 |
/sustainability/about/newsevents/webarticles2023/climateconference2023takeaways/ |
| Urban Ag Alumni |
185119 |
/sustainability/about/newsevents/webarticles2023/urbanagalumni/ |
| Clean Power Commitment |
185372 |
/sustainability/about/newsevents/webarticles2023/cleanpowercommitment/ |
| Schusler Teaching Award |
185403 |
/sustainability/about/newsevents/webarticles2023/schuslerteachingaward/ |
| 2023 Graduates |
185564 |
/sustainability/about/newsevents/webarticles2023/2023graduates/ |
| Abrams Challenge Winners |
185571 |
/sustainability/about/newsevents/webarticles2023/abramschallengewinners/ |
| Ohsowski Teaching Award |
185594 |
/sustainability/about/newsevents/webarticles2023/ohsowskiteachingaward/ |
| Bike Challenge 2023 |
185675 |
/sustainability/about/newsevents/webarticles2023/bikechallenge2023/ |
| Sinche-student-research |
185694 |
/sustainability/about/newsevents/webarticles2023/sinche-student-research/ |
| Food-Justice-student-research |
185870 |
/sustainability/about/newsevents/webarticles2023/food-justice-student-research/ |
| LUREC-2023 |
185990 |
/sustainability/about/newsevents/webarticles2023/lurec-2023/ |
| 2023 Summer Session at LUREC |
186001 |
/sustainability/about/newsevents/webarticles2023/2023summersessionatlurec/ |
| Parkways-for-pollinators |
186451 |
/sustainability/about/newsevents/webarticles2023/parkways-for-pollinators/ |
| STARS 2023 |
187156 |
/sustainability/about/newsevents/webarticles2023/stars2023/ |
| Ecuador-Galapagos |
187287 |
/sustainability/about/newsevents/webarticles2023/ecuador-galapagos/ |
| Laudato-Si-Champions |
187348 |
/sustainability/about/newsevents/webarticles2023/laudato-si-champions/ |
| New Students 2023 |
188068 |
/sustainability/about/newsevents/webarticles2023/newstudents2023/ |
| Team Typha |
188236 |
/sustainability/about/newsevents/webarticles2023/teamtypha/ |
| Internship Vacanti |
188337 |
/sustainability/about/newsevents/webarticles2023/internshipvacanti/ |
| Mackey New Faculty Profile |
188943 |
/sustainability/about/newsevents/webarticles2023/mackeynewfacultyprofile/ |
| Urban Ag Update and video |
189130 |
/sustainability/about/newsevents/webarticles2023/urbanagupdateandvideo/ |
| Abrams Challenge Launch |
189202 |
/sustainability/about/newsevents/webarticles2023/abramschallengelaunch/ |
| Presidents Medallion 2023 |
189548 |
/sustainability/about/newsevents/webarticles2023/presidentsmedallion2023/ |
| Grad student research-Hartnett |
189645 |
/sustainability/about/newsevents/webarticles2023/gradstudentresearch-hartnett/ |
| IDP Event |
189648 |
/sustainability/about/newsevents/webarticles2023/idpevent/ |
| Emma McBride Air Quality Research |
189994 |
/sustainability/about/newsevents/webarticles2023/emmamcbrideairqualityresearch/ |
| Bobbi Lammers Celebration |
190040 |
/sustainability/about/newsevents/webarticles2023/bobbilammerscelebration/ |
| Alex Quebbeman research |
190226 |
/sustainability/about/newsevents/webarticles2023/alexquebbemanresearch/ |
| Web Articles 2024 |
190846 |
/sustainability/about/newsevents/webarticles2024/ |
| CARE video |
190847 |
/sustainability/about/newsevents/webarticles2024/carevideo/ |
| Standing Rock Trip |
191424 |
/sustainability/about/newsevents/webarticles2024/standingrocktrip/ |
| Biodiesel video |
191478 |
/sustainability/about/newsevents/webarticles2024/biodieselvideo/ |
| Belize Trip |
191790 |
/sustainability/about/newsevents/webarticles2024/belizetrip/ |
| Stormwater video |
192178 |
/sustainability/about/newsevents/webarticles2024/stormwatervideo/ |
| Palmquist-Typha-research |
192312 |
/sustainability/about/newsevents/webarticles2024/palmquist-typha-research/ |
| Compost bucket program video |
192362 |
/sustainability/about/newsevents/webarticles2024/compostbucketprogramvideo/ |
| Earth Week 2024 |
193772 |
/sustainability/about/newsevents/webarticles2024/earthweek2024/ |
| Green Campus |
193974 |
/sustainability/about/newsevents/webarticles2024/greencampus/ |
| 2024 Graduates |
194088 |
/sustainability/about/newsevents/webarticles2024/2024graduates/ |
| Climate Action Hero |
194099 |
/sustainability/about/newsevents/webarticles2024/climateactionhero/ |
| Crains Notables |
194150 |
/sustainability/about/newsevents/webarticles2024/crainsnotables/ |
| Monique-Sosnowski |
195721 |
/sustainability/about/newsevents/webarticles2024/monique-sosnowski/ |
| Emma Donnelly |
195746 |
/sustainability/about/newsevents/webarticles2024/emmadonnelly/ |
| Bike Challenge 2024 |
196007 |
/sustainability/about/newsevents/webarticles2024/bikechallenge2024/ |
| Tony Minnick |
196009 |
/sustainability/about/newsevents/webarticles2024/tonyminnick/ |
| Integral Ecology |
197054 |
/sustainability/about/newsevents/webarticles2024/integralecology/ |
| Megan McCawley |
197055 |
/sustainability/about/newsevents/webarticles2024/meganmccawley/ |
| 2024 Welcome Week |
197942 |
/sustainability/about/newsevents/webarticles2024/2024welcomeweek/ |
| Garrett Klepitsch |
197979 |
/sustainability/about/newsevents/webarticles2024/garrettklepitsch/ |
| SES seminar series Food |
197989 |
/sustainability/about/newsevents/webarticles2024/sesseminarseriesfood/ |
| Natalia Szklaruk |
198125 |
/sustainability/about/newsevents/webarticles2024/nataliaszklaruk/ |
| Michaud-research |
198196 |
/sustainability/about/newsevents/webarticles2024/michaud-research/ |
| IDP 2024 |
198396 |
/sustainability/about/newsevents/webarticles2024/idp2024/ |
| Zebrowski |
198413 |
/sustainability/about/newsevents/webarticles2024/zebrowski/ |
| Virrueta |
198416 |
/sustainability/about/newsevents/webarticles2024/virrueta/ |
| Keller |
198489 |
/sustainability/about/newsevents/webarticles2024/keller/ |
| Transportation week |
198524 |
/sustainability/about/newsevents/webarticles2024/transportationweek/ |
| SES seminar series energy |
198808 |
/sustainability/about/newsevents/webarticles2024/sesseminarseriesenergy/ |
| Carolyn Bido alum profile |
198913 |
/sustainability/about/newsevents/webarticles2024/carolynbidoalumprofile/ |
| Standing Rock 2024 |
199080 |
/sustainability/about/newsevents/webarticles2024/standingrock2024/ |
| Energy-week |
199099 |
/sustainability/about/newsevents/webarticles2024/energy-week/ |
| Presidents Medallion 2024 |
199480 |
/sustainability/about/newsevents/webarticles2024/presidentsmedallion2024/ |
| Emma Pierce |
199482 |
/sustainability/about/newsevents/webarticles2024/emmapierce/ |
| SES seminar November |
199779 |
/sustainability/about/newsevents/webarticles2024/sesseminarnovember/ |
| Waste Audit |
200508 |
/sustainability/about/newsevents/webarticles2024/wasteaudit/ |
| Food Internships Grace |
200583 |
/sustainability/about/newsevents/webarticles2024/foodinternshipsgrace/ |
| Team Typha Video |
200591 |
/sustainability/about/newsevents/webarticles2024/teamtyphavideo/ |
| Web Articles 2025 |
200929 |
/sustainability/about/newsevents/webarticles2025/ |
| Food Systems Video |
200930 |
/sustainability/about/newsevents/webarticles2025/foodsystemsvideo/ |
| SES seminar queer ecology |
201328 |
/sustainability/about/newsevents/webarticles2025/sesseminarqueerecology/ |
| Typha Research Video |
201520 |
/sustainability/about/newsevents/webarticles2025/typharesearchvideo/ |
| Waste Week 2025 |
201524 |
/sustainability/about/newsevents/webarticles2025/wasteweek2025/ |
| Farley Internship |
201603 |
/sustainability/about/newsevents/webarticles2025/farleyinternship/ |
| Walsh Profile |
201644 |
/sustainability/about/newsevents/webarticles2025/walshprofile/ |
| Bower Profile |
201775 |
/sustainability/about/newsevents/webarticles2025/bowerprofile/ |
| ABC7 Urban Ag |
201856 |
/sustainability/about/newsevents/webarticles2025/abc7urbanag/ |
| SES seminar brandt |
201978 |
/sustainability/about/newsevents/webarticles2025/sesseminarbrandt/ |
| Conference Film |
202172 |
/sustainability/about/newsevents/webarticles2025/conferencefilm/ |
| Roos internship |
202194 |
/sustainability/about/newsevents/webarticles2025/roosinternship/ |
| Schanz internship |
202347 |
/sustainability/about/newsevents/webarticles2025/schanzinternship/ |
| Bon internship |
202349 |
/sustainability/about/newsevents/webarticles2025/boninternship/ |
| CCC poster session |
202446 |
/sustainability/about/newsevents/webarticles2025/cccpostersession/ |
| 2025 Graduates |
202708 |
/sustainability/about/newsevents/webarticles2025/2025graduates/ |
| Tuchman Scholarship |
202977 |
/sustainability/about/newsevents/webarticles2025/tuchmanscholarship/ |
| Conservation biology |
203045 |
/sustainability/about/newsevents/webarticles2025/conservationbiology/ |
| Restoration Club Video |
203166 |
/sustainability/about/newsevents/webarticles2025/restorationclubvideo/ |
| LUREC Maymester Video |
203425 |
/sustainability/about/newsevents/webarticles2025/lurecmaymestervideo/ |
| Muskrat research |
203530 |
/sustainability/about/newsevents/webarticles2025/muskratresearch/ |
| Food system research |
203905 |
/sustainability/about/newsevents/webarticles2025/foodsystemresearch/ |
| Welcome Week 2025 |
203961 |
/sustainability/about/newsevents/webarticles2025/welcomeweek2025/ |
| Melstrom-research |
204192 |
/sustainability/about/newsevents/webarticles2025/melstrom-research/ |
| SES seminar Hayden |
204216 |
/sustainability/about/newsevents/webarticles2025/sesseminarhayden/ |
| Kath Internship |
204232 |
/sustainability/about/newsevents/webarticles2025/kathinternship/ |
| Walker-internship |
204262 |
/sustainability/about/newsevents/webarticles2025/walker-internship/ |
| Ecuador Video |
204263 |
/sustainability/about/newsevents/webarticles2025/ecuadorvideo/ |
| IDP2025 |
204277 |
/sustainability/about/newsevents/webarticles2025/idp2025/ |
| Mercado Fernandez |
204300 |
/sustainability/about/newsevents/webarticles2025/mercadofernandez/ |
| Sampson Hao |
204402 |
/sustainability/about/newsevents/webarticles2025/sampsonhao/ |
| Kelvakis |
204406 |
/sustainability/about/newsevents/webarticles2025/kelvakis/ |
| Bailey Uttich |
204428 |
/sustainability/about/newsevents/webarticles2025/baileyuttich/ |
| SES seminar 2025 10 |
204480 |
/sustainability/about/newsevents/webarticles2025/sesseminar202510/ |
| SES seminar 2025 11 |
204484 |
/sustainability/about/newsevents/webarticles2025/sesseminar202511/ |
| Emily Hammermeister |
204496 |
/sustainability/about/newsevents/webarticles2025/emilyhammermeister/ |
| Hannah Davidson |
204503 |
/sustainability/about/newsevents/webarticles2025/hannahdavidson/ |
| Emily Braun |
204508 |
/sustainability/about/newsevents/webarticles2025/emilybraun/ |
| Kristina Tsakos |
204518 |
/sustainability/about/newsevents/webarticles2025/kristinatsakos/ |
| Haley Lim |
204649 |
/sustainability/about/newsevents/webarticles2025/haleylim/ |
| Getzinger PFAS |
204669 |
/sustainability/about/newsevents/webarticles2025/getzingerpfas/ |
| Environmental Gentrification Research |
204776 |
/sustainability/about/newsevents/webarticles2025/environmentalgentrificationresearch/ |
| SES seminar 2026-01 |
204953 |
/sustainability/about/newsevents/webarticles2025/sesseminar2026-01/ |
| Keller-Lab-Studies |
205332 |
/sustainability/about/newsevents/webarticles2025/keller-lab-studies/ |
| Biodiesel tour video |
205602 |
/sustainability/about/newsevents/webarticles2025/biodieseltourvideo/ |
| SES seminar 2026-02 |
205738 |
/sustainability/about/newsevents/webarticles2025/sesseminar2026-02/ |
| 2026-News |
205759 |
/sustainability/about/newsevents/2026-news/ |
| FRN video |
205760 |
/sustainability/about/newsevents/2026-news/frnvideo/ |
| Edgewater-market |
205851 |
/sustainability/about/newsevents/2026-news/edgewater-market/ |
| Zebrowski-study |
206094 |
/sustainability/about/newsevents/2026-news/zebrowski-study/ |
| SES seminar 2026-03 |
206276 |
/sustainability/about/newsevents/2026-news/sesseminar2026-03/ |
| Biodiesel career video |
206457 |
/sustainability/about/newsevents/2026-news/biodieselcareervideo/ |
| Presidents-Medallion-2026 |
206534 |
/sustainability/about/newsevents/2026-news/presidents-medallion-2026/ |
| manoomin |
206538 |
/sustainability/about/newsevents/2026-news/manoomin/ |
| Greenhousetour |
206544 |
/sustainability/about/newsevents/2026-news/greenhousetour/ |
| Bridging Business and Sustainability: Inside Loyola’s Net Impact Chapter |
206864 |
/sustainability/about/newsevents/2026-news/bridgingbusinessandsustainabilityinsideloyolasnetimpactchapter/ |
| Indigenous Stewardship Takes Center Stage at Loyola SES Speaker Series |
206866 |
/sustainability/about/newsevents/2026-news/indigenousstewardshiptakescenterstageatloyolasesspeakerseries/ |
| Durnbaugh named to 2026 class of AASHE Fellows |
207020 |
/sustainability/about/newsevents/2026-news/durnbaughnamedto2026classofaashefellows/ |
| Our Reputation |
163444 |
/sustainability/about/ourreputation/ |
| Our Mission |
163697 |
/sustainability/about/ourmission/ |
| Our People |
163730 |
/sustainability/about/ourpeople/ |
| Directory |
166207 |
/sustainability/about/ourpeople/directory/ |
| Our Facilities |
166057 |
/sustainability/about/ourfacilities/ |
| Facility Tours |
167116 |
/sustainability/about/ourfacilities/facilitytours/ |
| Publications |
180232 |
/sustainability/about/publications/ |
| 2025 SES Magazine |
205013 |
/sustainability/about/progressreports/2025sesmagazine/ |
| 0-Modals-2025 |
205081 |
/sustainability/about/publications/2025sesmagazine/0-modals-2025/ |
| 1-deans-message |
205043 |
/sustainability/about/progressreports/2025sesmagazine/0-magazine-toc-2025/1-deans-message/ |
| 2-student-life-grads |
205195 |
/sustainability/about/progressreports/2025sesmagazine/0-magazine-toc-2025/2-student-life-grads/ |
| 3-alum-sectors |
205201 |
/sustainability/about/progressreports/2025sesmagazine/0-magazine-toc-2025/3-alum-sectors/ |
| 4-faculty-awards |
205208 |
/sustainability/about/progressreports/2025sesmagazine/0-magazine-toc-2025/4-faculty-awards/ |
| 2-student-life-restoration |
205082 |
/sustainability/about/progressreports/2025sesmagazine/2-student-life-restoration/ |
| 2-student-life-biodiesel |
205094 |
/sustainability/about/publications/2025sesmagazine/2-student-life-biodiesel/ |
| 2-student-life-glenwood-market |
205188 |
/sustainability/about/publications/2025sesmagazine/2-student-life-glenwood-market/ |
| 3-alumni |
205086 |
/sustainability/about/progressreports/2025sesmagazine/3-alumni/ |
| 4-faculty-staff |
205087 |
/sustainability/about/progressreports/2025sesmagazine/4-faculty-staff/ |
| 5-academics-LUREC-course |
205088 |
/sustainability/about/progressreports/2025sesmagazine/5-academics-lurec-course/ |
| 5-academics-conservation-bio |
205212 |
/sustainability/about/progressreports/2025sesmagazine/5-academics-conservation-bio/ |
| 6-Research Melstrom |
205089 |
/sustainability/about/progressreports/2025sesmagazine/6-researchmelstrom/ |
| 6-Research overview |
205213 |
/sustainability/about/progressreports/2025sesmagazine/6-researchoverview/ |
| 7-sustainability |
205090 |
/sustainability/about/progressreports/2025sesmagazine/7-sustainability/ |
| 2024 Progress Report |
199892 |
/sustainability/about/progressreports/2024progressreport/ |
| From the Dean |
199894 |
/sustainability/about/progressreports/2024progressreport/fromthedean/ |
| Program Growth |
199895 |
/sustainability/about/progressreports/2024progressreport/programgrowth/ |
| Our Students |
199896 |
/sustainability/about/progressreports/2024progressreport/ourstudents/ |
| Alumni |
199898 |
/sustainability/about/progressreports/2024progressreport/alumni/ |
| Faculty |
199899 |
/sustainability/about/progressreports/2024progressreport/faculty/ |
| Research |
199901 |
/sustainability/about/progressreports/2024progressreport/research/ |
| Community Engagement |
199897 |
/sustainability/about/progressreports/2024progressreport/communityengagement/ |
| Green Campus |
199900 |
/sustainability/about/progressreports/2024progressreport/greencampus/ |
| Events |
199902 |
/sustainability/about/progressreports/2024progressreport/events/ |
| Supporters |
199903 |
/sustainability/about/progressreports/2024progressreport/supporters/ |
| 2023 Progress Report |
188628 |
/sustainability/about/progressreports/2023progressreport/ |
| From the Dean |
188629 |
/sustainability/about/progressreports/2023progressreport/fromthedean/ |
| Program Growth |
188634 |
/sustainability/about/progressreports/2023progressreport/programgrowth/ |
| Our Students |
188637 |
/sustainability/about/progressreports/2023progressreport/ourstudents/ |
| Alumni |
188786 |
/sustainability/about/progressreports/2023progressreport/alumni/ |
| Faculty |
188801 |
/sustainability/about/progressreports/2023progressreport/faculty/ |
| Research |
188804 |
/sustainability/about/progressreports/2023progressreport/research/ |
| Curriculum |
188776 |
/sustainability/about/progressreports/2023progressreport/curriculum/ |
| Green Campus |
188803 |
/sustainability/about/progressreports/2023progressreport/greencampus/ |
| Events |
188805 |
/sustainability/about/progressreports/2023progressreport/events/ |
| Supporters |
188806 |
/sustainability/about/progressreports/2023progressreport/supporters/ |
| From the Dean 2022 |
180646 |
/sustainability/about/progressreports/2022progressreport/fromthedean2022/ |
| Program Growth |
180671 |
/sustainability/about/progressreports/2022progressreport/programgrowth/ |
| Students |
180672 |
/sustainability/about/progressreports/2022progressreport/students/ |
| Curriculum |
180694 |
/sustainability/about/progressreports/2022progressreport/curriculum/ |
| Graduate Careers |
180703 |
/sustainability/about/progressreports/2022progressreport/graduatecareers/ |
| Faculty |
180704 |
/sustainability/about/progressreports/2022progressreport/faculty/ |
| Research |
180705 |
/sustainability/about/progressreports/2022progressreport/research/ |
| Staff-Carr-2022 |
180640 |
/sustainability/about/progressreports/2022progressreport/staff-carr-2022/ |
| Green Campus |
180706 |
/sustainability/about/progressreports/2022progressreport/greencampus/ |
| Supporters |
180707 |
/sustainability/about/progressreports/2022progressreport/supporters/ |
| Past Progress Reports |
188825 |
/sustainability/about/progressreports/pastprogressreports/ |
| Diversity, Equity, and Inclusion |
184574 |
/sustainability/about/diversityequityandinclusion/ |
| Contact Us |
166988 |
/sustainability/about/contactus/ |
| Web Articles |
118500 |
/sustainability/about/webarticles/ |
| MSESS Graduate Program |
120932 |
/sustainability/about/webarticles/msessgraduateprogram/ |
| US Department of Education Green Ribbon Schools |
125588 |
/sustainability/about/webarticles/usdepartmentofeducationgreenribbonschools/ |
| Youth Climate Activists |
125902 |
/sustainability/about/webarticles/youthclimateactivists/ |
| Amazon Synod |
126496 |
/sustainability/about/webarticles/amazonsynod/ |
| COVID-19 contest |
129440 |
/sustainability/about/webarticles/covid-19contest/ |
| Earth Day 2020 |
129727 |
/sustainability/about/webarticles/earthday2020/ |
| Bike Pilgrimage |
166267 |
/sustainability/about/webarticles/bikepilgrimage/ |
| Microplastics-2022-06 |
178474 |
/sustainability/about/webarticles/microplastics-2022-06/ |
| Admission |
163446 |
/sustainability/admission/ |
| Apply |
166829 |
/sustainability/admission/apply/ |
| Tuition and Financial Aid |
166997 |
/sustainability/admission/tuitionandfinancialaid/ |
| Scholarships |
168082 |
/sustainability/admission/scholarships/ |
| Visit Us |
178198 |
/sustainability/admission/visitus/ |
| Academics |
163447 |
/sustainability/academics/ |
| Undergraduate Degrees |
163460 |
/sustainability/academics/undergraduatedegrees/ |
| BS in Environmental Science |
163467 |
/sustainability/academics/undergraduatedegrees/bsinenvironmentalscience/ |
| BS in Environmental Science: Conservation and Restoration Ecology |
163469 |
/sustainability/academics/undergraduatedegrees/bsinenvironmentalscienceconservationandrestorationecology/ |
| BS in Environmental Science: Food Systems and Sustainable Agriculture |
163470 |
/sustainability/academics/undergraduatedegrees/bsinenvironmentalsciencefoodsystemsandsustainableagriculture/ |
| BS in Environmental Science: Environmental Health |
163471 |
/sustainability/academics/undergraduatedegrees/bsinenvironmentalscienceenvironmentalhealth/ |
| BS in Environmental Science: Climate and Energy |
203106 |
/sustainability/academics/undergraduatedegrees/bsinenvironmentalscienceclimateandenergy/ |
| BA in Environmental Studies |
163466 |
/sustainability/academics/undergraduatedegrees/bainenvironmentalstudies/ |
| BA in Environmental Policy |
168407 |
/sustainability/academics/undergraduatedegrees/bainenvironmentalpolicy/ |
| BA in Environmental Economics and Sustainability: Governance or Management |
200951 |
/sustainability/academics/undergraduatedegrees/bainenvironmentaleconomicsandsustainabilitygovernanceormanagement/ |
| Minors |
163462 |
/sustainability/academics/minors/ |
| Graduate Degree Programs |
163461 |
/sustainability/academics/graduatedegreeprograms/ |
| MS in Environmental Science & Sustainability |
185703 |
https://gpem.luc.edu/portal/program?name=environmentalscienceandsustainabilityms |
| Accelerated Master's Pathways |
163463 |
/sustainability/academics/acceleratedmasterspathways/ |
| Accelerated Bachelor’s/Master’s with Master of Public Health (MPH) |
163477 |
/sustainability/academics/acceleratedbachelorsmastersprograms/acceleratedbachelorsmasterswithmasterofpublichealthmph/ |
| Graduate Certificates |
166189 |
/sustainability/academics/graduatecertificates/ |
| Experiential Learning |
180918 |
/sustainability/academics/experientiallearning/ |
| Courses at the Loyola University Retreat and Ecology Campus |
180919 |
/sustainability/academics/experientiallearning/coursesattheloyolauniversityretreatandecologycampus/ |
| Solutions to Environmental Problems (STEP) |
163484 |
/sustainability/academics/experientiallearning/solutionstoenvironmentalproblemsstep/ |
| Student Organizations |
206245 |
/sustainability/academics/experientiallearning/studentorganizations/ |
| Internships |
168353 |
/sustainability/academics/internships/ |
| Partners in the Chicago Food System Internships |
191413 |
/sustainability/academics/internships/partnersinthechicagofoodsysteminternships/ |
| Career Outcomes |
205596 |
/sustainability/academics/careeroutcomes/ |
| Alumni Stories |
205595 |
/sustainability/academics/alumnistories/ |
| Research |
163448 |
/sustainability/research/ |
| Focus Areas |
163478 |
/sustainability/research/focusareas/ |
| Biodiversity |
163445 |
/sustainability/research/focusareas/biodiversity/ |
| Environment and Society |
166395 |
/sustainability/research/focusareas/environmentandsociety/ |
| Environmental Health and Toxicology |
166396 |
/sustainability/research/focusareas/environmentalhealthandtoxicology/ |
| Sustainable Food Systems |
166397 |
/sustainability/research/focusareas/sustainablefoodsystems/ |
| Climate and Energy |
166398 |
/sustainability/research/focusareas/climateandenergy/ |
| Featured Projects |
163866 |
/sustainability/research/featuredprojects/ |
| Publications |
163868 |
/sustainability/research/publications/ |
| Student Research Opportunities |
167092 |
/sustainability/research/studentresearchopportunities/ |
| Grants and Funding |
166202 |
/sustainability/research/grantsandfunding/ |
| initiatives |
163449 |
/sustainability/initiatives/ |
| Climate Change Conference |
163481 |
/sustainability/initiatives/climatechangeconference/ |
| Schedule |
201051 |
/sustainability/initiatives/climatechangeconference/schedule/ |
| Keynote Event |
200987 |
/sustainability/initiatives/climatechangeconference/keynoteevent/ |
| Panel 1 |
201516 |
/sustainability/initiatives/climatechangeconference/panel1/ |
| Panel 2 |
201517 |
/sustainability/initiatives/climatechangeconference/panel2/ |
| Panel 3 |
201518 |
/sustainability/initiatives/climatechangeconference/panel3/ |
| Laudato Si' at Ten |
201748 |
/sustainability/initiatives/climatechangeconference/laudatosiatten/ |
| Past Conferences |
168262 |
/sustainability/initiatives/climatechangeconference/pastconferences/ |
| 2023 |
190324 |
/sustainability/initiatives/climatechangeconference/pastconferences/2023/ |
| 2022 |
168425 |
/sustainability/initiatives/climatechangeconference/pastconferences/2022/ |
| 2024 Conferences |
199395 |
/sustainability/initiatives/climatechangeconference/pastconferences/2024conferences/ |
| Keynote Presentation |
191003 |
/sustainability/initiatives/climatechangeconference/pastconferences/2024/keynotepresentation/ |
| Panel 1 2024 |
191004 |
/sustainability/initiatives/climatechangeconference/pastconferences/2024/panel12024/ |
| Panel 2 2024 |
191481 |
/sustainability/initiatives/climatechangeconference/pastconferences/2024/panel22024/ |
| Panel 3 2024 |
191482 |
/sustainability/initiatives/climatechangeconference/pastconferences/2024/panel32024/ |
| Biodiesel Program |
163482 |
/sustainability/initiatives/biodieselprogram/ |
| Urban Agriculture |
163485 |
/sustainability/initiatives/urbanagriculture/ |
| Jesuit Ecology Project |
167009 |
https://www.luc.edu/ijep/index.shtml |
| Food Equity Program |
206080 |
/sustainability/initiatives/foodequityprogram/ |
| International Jesuit Ecology Project |
181481 |
/sustainability/initiatives/internationaljesuitecologyproject/ |
| Farmers Market |
167008 |
http://blogs.luc.edu/farmersmarket/ |
| Sustainability at Loyola |
163450 |
/sustainability/sustainabilityatloyola/ |
| Overview |
167072 |
/sustainability/sustainabilityatloyola/overview/ |
| modules-programming |
167073 |
/sustainability/sustainabilityatloyola/overview/modules-programming/ |
| Loyola’s Campus |
167098 |
/sustainability/sustainabilityatloyola/loyolascampus/ |
| Take Action |
163488 |
/sustainability/sustainabilityatloyola/takeaction/ |
| Recycling |
168357 |
/sustainability/sustainabilityatloyola/takeaction/recycling/ |
| Composting |
168367 |
/sustainability/sustainabilityatloyola/takeaction/composting/ |
| Think Green and Give |
179644 |
/sustainability/sustainabilityatloyola/takeaction/think-green-and-give/index.shtml |
| Water Bounty |
179646 |
/sustainability/sustainabilityatloyola/takeaction/waterbounty/ |
| Loyola Sustainability Initiatives |
179642 |
/sustainability/sustainabilityatloyola/loyolasustainabilityinitiatives/ |
| Climate Action |
179725 |
/sustainability/sustainabilityatloyola/loyolasustainabilityinitiatives/climateaction/ |
| Zero Waste |
179643 |
/sustainability/sustainabilityatloyola/loyolasustainabilityinitiatives/zerowaste/ |
| Water Resources |
179645 |
/sustainability/sustainabilityatloyola/loyolasustainabilityinitiatives/waterresources/ |
| Integrating Sustainability into Teaching & Research |
179724 |
/sustainability/sustainabilityatloyola/loyolasustainabilityinitiatives/integratingsustainabilityintoteachingresearch/ |
| Environmental Justice |
179726 |
/sustainability/sustainabilityatloyola/loyolasustainabilityinitiatives/environmentaljustice/ |
| Mission-Driven Sustainability |
188275 |
/sustainability/sustainabilityatloyola/loyolasustainabilityinitiatives/mission-drivensustainability/ |
| Loyola's Commitments & Recognitions |
163489 |
/sustainability/sustainabilityatloyola/loyolascommitmentsrecognitions/ |
| Campus Sustainability Events |
179573 |
/sustainability/sustainabilityatloyola/campussustainabilityevents/ |
| Resources |
167509 |
/sustainability/sustainabilityatloyola/resources/ |
| News and events |
204274 |
/sustainability/sustainabilityatloyola/newsandevents/ |
| School of Nursing |
127972 |
/nursing/ |
| site_logo |
127975 |
/nursing/sitelogo/ |
| footer |
127976 |
/nursing/footer/ |
| modules-programming |
197622 |
/nursing/modules-programming/ |
| cta |
155410 |
/nursing/cta/ |
| I Links |
157127 |
/nursing/ilinks/ |
| social media |
157141 |
/nursing/socialmedia/ |
| About |
127981 |
/nursing/about/ |
| At a Glance |
149855 |
/nursing/about/ataglance/ |
| Message from the Dean |
128048 |
/nursing/about/messagefromthedean/ |
| Mission, Vision & Core Values |
147949 |
/nursing/about/missionvisioncorevalues/ |
| Inclusive Excellence |
166325 |
/nursing/about/inclusiveexcellence/ |
| News and Events |
127983 |
/nursing/about/newsandevents/ |
| Newsroom |
154320 |
/nursing/about/newsandevents/newsroom/ |
| archive |
154321 |
/nursing/about/newsandevents/newsroom/archive/ |
| Loyola Nursing Magazine |
147962 |
/nursing/about/newsandevents/loyolanursingmagazine/ |
| Loyola Nursing 2023 |
190255 |
/nursing/about/newsandevents/loyolanursingmagazine/loyolanursing2023/ |
| right_column |
190677 |
/nursing/about/newsandevents/loyolanursingmagazine/loyolanursing2023/rightcolumn/ |
| From the Dean |
190257 |
/nursing/about/newsandevents/loyolanursingmagazine/loyolanursing2023/fromthedean/ |
| "It's about who we are" |
190258 |
/nursing/about/newsandevents/loyolanursingmagazine/loyolanursing2023/itsaboutwhoweare/ |
| Meet the new research faculty |
190259 |
/nursing/about/newsandevents/loyolanursingmagazine/loyolanursing2023/meetthenewresearchfaculty/ |
| Power of partnerships |
190264 |
/nursing/about/newsandevents/loyolanursingmagazine/loyolanursing2023/powerofpartnerships/ |
| Investing in the next generation |
190260 |
/nursing/about/newsandevents/loyolanursingmagazine/loyolanursing2023/investinginthenextgeneration/ |
| Scientific method |
190263 |
/nursing/about/newsandevents/loyolanursingmagazine/loyolanursing2023/scientificmethod/ |
| Missions of care |
190265 |
/nursing/about/newsandevents/loyolanursingmagazine/loyolanursing2023/missionsofcare/ |
| Nursing receives diversity award |
190318 |
/nursing/about/newsandevents/loyolanursingmagazine/loyolanursing2023/nursingreceivesdiversityaward/ |
| Loyola Nursing Magazine 2024 |
200372 |
/nursing/about/newsandevents/loyolanursingmagazine/loyolanursingmagazine2024/ |
| From the Dean |
200373 |
/nursing/about/newsandevents/loyolanursingmagazine/loyolanursingmagazine2024/fromthedean/ |
| The Lourdes experience |
200374 |
/nursing/about/newsandevents/loyolanursingmagazine/loyolanursingmagazine2024/thelourdesexperience/ |
| 'I feel closer to Ignatius than I ever have' |
200380 |
/nursing/about/newsandevents/loyolanursingmagazine/loyolanursingmagazine2024/ifeelclosertoignatiusthanieverhave/ |
| Taking a mindful approach |
200381 |
/nursing/about/newsandevents/loyolanursingmagazine/loyolanursingmagazine2024/takingamindfulapproach/ |
| DEI toolkit leads nation in inclusive sim education |
200383 |
/nursing/about/newsandevents/loyolanursingmagazine/loyolanursingmagazine2024/deitoolkitleadsnationininclusivesimeducation/ |
| Change agents |
200388 |
/nursing/about/newsandevents/loyolanursingmagazine/loyolanursingmagazine2024/changeagents/ |
| Spirituality is 'part of palliative care’ |
200390 |
/nursing/about/newsandevents/loyolanursingmagazine/loyolanursingmagazine2024/spiritualityispartofpalliativecare/ |
| 'She lights the way' |
200391 |
/nursing/about/newsandevents/loyolanursingmagazine/loyolanursingmagazine2024/shelightstheway/ |
| Unforgettable journey |
200410 |
/nursing/about/newsandevents/loyolanursingmagazine/loyolanursingmagazine2024/unforgettablejourney/ |
| Alumni Profile: Lauren R. Sorce |
200411 |
/nursing/about/newsandevents/loyolanursingmagazine/loyolanursingmagazine2024/alumniprofilelaurenrsorce/ |
| Compassionate mentors |
200569 |
/nursing/about/newsandevents/loyolanursingmagazine/loyolanursingmagazine2024/compassionatementors/ |
| My story |
200602 |
/nursing/about/newsandevents/loyolanursingmagazine/loyolanursingmagazine2024/mystory/ |
| Reflections |
200604 |
/nursing/about/newsandevents/loyolanursingmagazine/loyolanursingmagazine2024/reflections/ |
| Loyola Nursing Magazine 2025 |
205347 |
/nursing/about/newsandevents/loyolanursingmagazine/loyolanursingmagazine2025/ |
| Message from the Dean |
205362 |
/nursing/about/newsandevents/loyolanursingmagazine/loyolanursingmagazine2025/messagefromthedean/ |
| Excellence in Mission |
205363 |
/nursing/about/newsandevents/loyolanursingmagazine/loyolanursingmagazine2025/excellenceinmission/ |
| Loyola Nursing faculty honored for Pine Ridge immersion |
205369 |
/nursing/about/newsandevents/loyolanursingmagazine/loyolanursingmagazine2025/excellenceinmission/loyolanursingfacultyhonoredforpineridgeimmersion/ |
| Expert inducted into American Academy of Nursing |
205370 |
/nursing/about/newsandevents/loyolanursingmagazine/loyolanursingmagazine2025/excellenceinmission/expertinductedintoamericanacademyofnursing/ |
| Loyola Nursing holds largest Palmer Research Symposium |
205371 |
/nursing/about/newsandevents/loyolanursingmagazine/loyolanursingmagazine2025/excellenceinmission/loyolanursingholdslargestpalmerresearchsymposium/ |
| School hosts film screening about opioid abuse, rural health |
205372 |
/nursing/about/newsandevents/loyolanursingmagazine/loyolanursingmagazine2025/excellenceinmission/schoolhostsfilmscreeningaboutopioidabuseruralhealth/ |
| Program Growth |
205364 |
/nursing/about/newsandevents/loyolanursingmagazine/loyolanursingmagazine2025/programgrowth/ |
| New building to anchor Loyola Nursing expansion |
205373 |
/nursing/about/newsandevents/loyolanursingmagazine/loyolanursingmagazine2025/programgrowth/newbuildingtoanchorloyolanursingexpansion/ |
| Legacy |
205365 |
/nursing/about/newsandevents/loyolanursingmagazine/loyolanursingmagazine2025/legacy/ |
| Across generations |
205374 |
/nursing/about/newsandevents/loyolanursingmagazine/loyolanursingmagazine2025/legacy/acrossgenerations/ |
| 1960s - Mary Ann McDermott |
205375 |
/nursing/about/newsandevents/loyolanursingmagazine/loyolanursingmagazine2025/legacy/1960s-maryannmcdermott/ |
| 1990s - Laura Ferrio |
205376 |
/nursing/about/newsandevents/loyolanursingmagazine/loyolanursingmagazine2025/legacy/1990s-lauraferrio/ |
| 2020s - Damilare Abdulsalam |
205377 |
/nursing/about/newsandevents/loyolanursingmagazine/loyolanursingmagazine2025/legacy/2020s-damilareabdulsalam/ |
| Timeline |
205378 |
/nursing/about/newsandevents/loyolanursingmagazine/loyolanursingmagazine2025/legacy/timeline/ |
| Academics |
205366 |
/nursing/about/newsandevents/loyolanursingmagazine/loyolanursingmagazine2025/academics/ |
| DNP’s difference maker |
205379 |
/nursing/about/newsandevents/loyolanursingmagazine/loyolanursingmagazine2025/academics/dnpsdifferencemaker/ |
| Q and A |
205367 |
/nursing/about/newsandevents/loyolanursingmagazine/loyolanursingmagazine2025/qanda/ |
| Professor Karen Saban |
205380 |
/nursing/about/newsandevents/loyolanursingmagazine/loyolanursingmagazine2025/qanda/professorkarensaban/ |
| Research |
205368 |
/nursing/about/newsandevents/loyolanursingmagazine/loyolanursingmagazine2025/research/ |
| Scientist awarded NIH grant to help premature infants |
205381 |
/nursing/about/newsandevents/loyolanursingmagazine/loyolanursingmagazine2025/research/scientistawardednihgranttohelpprematureinfants/ |
| Grant will allow school to establish rural health program |
205382 |
/nursing/about/newsandevents/loyolanursingmagazine/loyolanursingmagazine2025/research/grantwillallowschooltoestablishruralhealthprogram/ |
| Alumni |
127987 |
/nursing/about/alumni/ |
| Alumni Events & Awards |
149898 |
/nursing/about/alumni/alumnieventsawards/ |
| Contact Us |
149902 |
/nursing/about/alumni/contactus/ |
| Contact Us |
128139 |
/nursing/about/contactus/ |
| stories |
155411 |
/nursing/about/stories/ |
| Professor O’Rourke chosen to edit NLN’s training program |
179730 |
/nursing/about/stories/professororourkechosentoeditnlnstrainingprogram/ |
| U.S. News |
180322 |
/nursing/about/stories/usnews/ |
| Accreditation |
201444 |
/nursing/about/accreditation/ |
| Academics |
127990 |
/nursing/academics/ |
| Degree Programs |
127991 |
/nursing/academics/degreeprograms/ |
| Undergraduate Program |
151933 |
/nursing/academics/degreeprograms/undergraduateprogram/ |
| Four-Year BSN |
151946 |
/nursing/academics/degreeprograms/undergraduateprogram/four-yearbsn/ |
| ABSN |
190999 |
/nursing/academics/degreeprograms/absn/index.shtml |
| site_logo |
191007 |
/nursing/academics/degreeprograms/absn/sitelogo/ |
| Apply |
191354 |
/nursing/academics/degreeprograms/absn/apply/ |
| Graduate Degrees |
151935 |
/nursing/academics/degreeprograms/graduatedegrees/ |
| Master of Science in Nursing |
151937 |
/nursing/academics/degreeprograms/graduatedegrees/masterofscienceinnursing/ |
| Doctor of Philosophy in Nursing |
151939 |
/nursing/academics/degreeprograms/graduatedegrees/doctorofphilosophyinnursing/ |
| Doctor of Nursing Practice |
152164 |
/nursing/academics/degreeprograms/graduatedegrees/doctorofnursingpractice/ |
| Family Nurse Practitioner with Emergency specialty |
154230 |
/nursing/academics/degreeprograms/graduatedegrees/doctorofnursingpractice/familynursepractitionerwithemergencyspecialty/ |
| DNP in Systems Leadership |
154232 |
/nursing/academics/degreeprograms/graduatedegrees/doctorofnursingpractice/dnpinsystemsleadership/ |
| Women's Health/Gender Related Nurse Practitioner |
154233 |
/nursing/academics/degreeprograms/graduatedegrees/doctorofnursingpractice/womenshealthgenderrelatednursepractitioner/ |
| Psychiatric Mental Health Nurse Practitioner |
154235 |
/nursing/academics/degreeprograms/graduatedegrees/doctorofnursingpractice/psychiatricmentalhealthnursepractitioner/ |
| Adult-Gerontology Acute Care Clinical Nurse Specialist |
154237 |
/nursing/academics/degreeprograms/graduatedegrees/doctorofnursingpractice/adult-gerontologyacutecareclinicalnursespecialist/ |
| Adult-Gerontology Clinical Nurse Specialist |
154252 |
/nursing/academics/degreeprograms/graduatedegrees/doctorofnursingpractice/adult-gerontologyclinicalnursespecialist/ |
| Adult-Gerontology Primary Care Nurse Practitioner |
154255 |
/nursing/academics/degreeprograms/graduatedegrees/doctorofnursingpractice/adult-gerontologyprimarycarenursepractitioner/ |
| Adult-Gerontology Acute Care Nurse Practitioner |
154301 |
/nursing/academics/degreeprograms/graduatedegrees/doctorofnursingpractice/adult-gerontologyacutecarenursepractitioner/ |
| Family Nurse Practitioner |
154302 |
/nursing/academics/degreeprograms/graduatedegrees/doctorofnursingpractice/familynursepractitioner/ |
| Substance Use and Addictions specialty |
156513 |
/nursing/academics/degreeprograms/graduatedegrees/doctorofnursingpractice/substanceuseandaddictionsspecialty/ |
| Certificate Programs |
128024 |
/nursing/academics/certificateprograms/ |
| Oncology Nursing |
128025 |
/nursing/academics/certificateprograms/oncologynursing/ |
| Admission |
128035 |
/nursing/admission/ |
| Apply |
128036 |
/nursing/admission/apply/ |
| ABSN |
191006 |
/nursing/admission/apply/absn/ |
| site_logo |
191352 |
/nursing/admission/apply/absn/sitelogo/ |
| Master of Science in Nursing |
154663 |
/nursing/admission/apply/masterofscienceinnursing/ |
| Certificate Programs |
154666 |
/nursing/admission/apply/certificateprograms/ |
| PhD in Nursing |
154669 |
/nursing/admission/apply/phdinnursing/ |
| Doctor of Nursing Practice |
154672 |
/nursing/admission/apply/doctorofnursingpractice/ |
| Request Information |
155148 |
/nursing/admission/apply/nursing/rfi/ |
| Financial Aid |
128148 |
/nursing/admission/financialaid/ |
| Scholarships |
154668 |
/nursing/admission/financialaid/scholarships/ |
| Innovation |
147906 |
/nursing/innovation/ |
| Teaching |
154662 |
/nursing/innovation/teaching/ |
| Research |
154664 |
/nursing/innovation/research/ |
| Join our research study |
185881 |
/nursing/innovation/research/activeresearch/ |
| Form Submission Confirmation |
185880 |
/nursing/innovation/research/activeresearch/formsubmissionconfirmation/ |
| Palmer |
202136 |
/nursing/innovation/research/palmer/ |
| Practice |
154665 |
/nursing/innovation/practice/ |
| Loyola Community Nursing Center |
154402 |
/nursing/innovation/practice/loyolacommunitynursingcenter/ |
| School-Based Health Center |
203241 |
/nursing/innovation/practice/school-basedhealthcenter/ |
| Faculty and Staff |
128037 |
/nursing/facultyandstaff/ |
| Faculty Directory |
159317 |
/nursing/facultyandstaff/facultydirectory/ |
| Profiles |
201934 |
/nursing/facultyandstaff/facultydirectory/profiles/ |
| Staff |
128039 |
/nursing/facultyandstaff/staff/ |
| Profiles |
201953 |
/nursing/facultyandstaff/staff/profiles/ |
| Join Our Team |
157634 |
/nursing/facultyandstaff/joinourteam/ |
| Student Experience |
128040 |
/nursing/studentexperience/ |
| Student Success |
128149 |
/nursing/studentexperience/studentsuccess/ |
| Certification and Licensure |
155242 |
/nursing/studentexperience/certificationandlicensure/ |
| Career Resources |
128047 |
/nursing/studentexperience/careerresources/ |
| Student Success |
155017 |
/nursing/studentexperience/studentsuccess/ |
| Campus Life |
155018 |
/nursing/studentexperience/campuslife/ |
| Student Nurse Organizations |
155022 |
/nursing/studentexperience/campuslife/studentnurseorganizations/ |
| Visit Us |
155023 |
/nursing/studentexperience/campuslife/visitus/ |
| Study Abroad |
155019 |
/nursing/studentexperience/studyabroad/ |
| Lourdes, France |
155025 |
/nursing/studentexperience/studyabroad/lourdesfrance/ |
| England |
155026 |
/nursing/studentexperience/studyabroad/england/ |
| Rome |
155027 |
/nursing/studentexperience/studyabroad/rome/ |
| Support and Advising |
155020 |
/nursing/studentexperience/supportandadvising/ |
| Library Information |
155034 |
/nursing/studentexperience/supportandadvising/libraryinformation/ |
| School of Social Work |
197167 |
/socialwork/ |
| site_logo |
197168 |
/socialwork/sitelogo/ |
| Footer |
197169 |
/socialwork/footer/ |
| social media |
197172 |
/socialwork/socialmedia/ |
| cta |
197171 |
/socialwork/cta/ |
| modules-programming |
197180 |
/socialwork/modules-programming/ |
| right_column |
197175 |
/socialwork/rightcolumn/ |
| About |
197173 |
/socialwork/about/ |
| Mission + Vision |
197176 |
/socialwork/about/missionvision/ |
| Our People |
197199 |
/socialwork/about/ourpeople/ |
| Faculty and Staff |
197200 |
/socialwork/about/ourpeople/facultyandstaff/ |
| Profiles |
197201 |
/socialwork/about/ourpeople/facultyandstaff/profiles/ |
| right_column |
202532 |
/socialwork/about/ourpeople/facultyandstaff/profiles/rightcolumn/ |
| PhD Students |
197202 |
/socialwork/about/ourpeople/phdstudents/ |
| Alumni |
197204 |
/socialwork/about/ourpeople/alumni/ |
| Licensure |
197555 |
/socialwork/about/ourpeople/alumni/licensure/ |
| Give |
197556 |
/socialwork/about/ourpeople/alumni/give/ |
| Meet the Board |
197557 |
/socialwork/about/ourpeople/alumni/meettheboard/ |
| Accreditation and Assessment Data |
197177 |
/socialwork/about/accreditationandassessmentdata/ |
| Assessment of Student Learning Outcomes-MSW |
197229 |
/socialwork/about/accreditationandassessmentdata/assessmentofstudentlearningoutcomes-msw/ |
| Assessment of Student Learning Outcomes-BSW |
197230 |
/socialwork/about/accreditationandassessmentdata/assessmentofstudentlearningoutcomes-bsw/ |
| News & Events |
197181 |
/socialwork/about/newsevents/ |
| archive |
75903 |
/socialwork/about/newsevents/archive/ |
| Maribel Lopez PVSA Award |
203172 |
/socialwork/about/newsevents/maribellopezpvsaaward/ |
| Simulation Lab Grand Opening |
204510 |
/socialwork/about/newsevents/simulationlabgrandopening/ |
| Serving Those Who Served |
204654 |
/socialwork/about/newsevents/servingthosewhoserved/ |
| CADC Grant Renewed |
204711 |
/socialwork/about/newsevents/cadcgrantrenewed/ |
| SSWR 2026 Presentations |
205516 |
/socialwork/about/newsevents/sswr2026presentations/ |
| Abha Rai Named Top 2% Scientist |
205605 |
/socialwork/about/newsevents/abharainamedtop2scientist/ |
| Building Bridges Through Bilingual Social Work |
205704 |
/socialwork/about/newsevents/buildingbridgesthroughbilingualsocialwork/ |
| Introducing Three New Faculty Members |
205859 |
/socialwork/about/newsevents/introducingthreenewfacultymembers/ |
| 2026 President's Medallion Winner Ren Horst |
206913 |
/socialwork/about/newsevents/2026presidentsmedallionwinnerrenhorst/ |
| Noor Paracha Hayat Found Home at Loyola |
207181 |
/socialwork/about/newsevents/noorparachahayatfoundhomeatloyola/ |
| Contact |
197178 |
/socialwork/about/contact/ |
| Centers & Institutes |
197222 |
/socialwork/about/centersinstitutes/ |
| Fostering Connections Training Institute |
197223 |
/socialwork/about/centersinstitutes/fosteringconnectionstraininginstitute/ |
| School of Social Work Online Learning |
204316 |
/socialwork/about/schoolofsocialworkonlinelearning/ |
| Professional Development |
204327 |
/socialwork/about/officeofonlinelearning/professionaldevelopment/ |
| Admission |
197451 |
/socialwork/admission/ |
| Apply |
197493 |
/socialwork/admission/apply/ |
| Tuition and Financial Aid |
197494 |
/socialwork/admission/tuitionandfinancialaid/ |
| Scholarships |
197495 |
/socialwork/admission/scholarships/ |
| Admitted Students Resources |
197463 |
/socialwork/admission/admittedstudentsresources/ |
| Health Insurance |
197469 |
/socialwork/admission/admittedstudentsresources/healthinsurance/ |
| Housing & Transportation |
197470 |
/socialwork/admission/admittedstudentsresources/housingtransportation/ |
| Loyola ID & Email |
197465 |
/socialwork/admission/admittedstudentsresources/loyolaidemail/ |
| Student Life at Loyola |
197468 |
/socialwork/admission/admittedstudentsresources/studentlifeatloyola/ |
| Transfer Credit |
197467 |
/socialwork/admission/transfercredit/ |
| Academics |
197232 |
/socialwork/academics/ |
| Undergraduate Degrees |
197233 |
/socialwork/academics/undergrad/ |
| Bachelor of Social Work (BSW) |
197243 |
/socialwork/academics/undergrad/bsw/ |
| right_column |
197251 |
/socialwork/academics/undergrad/bsw/rightcolumn/ |
| Social Work Minor |
197242 |
/socialwork/academics/undergrad/socialworkminor/ |
| Courses |
197252 |
/socialwork/academics/undergrad/courses/ |
| Graduate Degrees |
197638 |
/socialwork/academics/graduatedegrees/ |
| Dual Degree Programs |
197670 |
/socialwork/academics/graduatedegrees/dual-degree/ |
| Internships |
197247 |
/socialwork/academics/internships/ |
| MSW Internships |
198508 |
/socialwork/academics/internships/mswinternships/ |
| Internship Supervisors |
198509 |
/socialwork/academics/internships/internshipsupervisors/ |
| BSW Internship |
198510 |
/socialwork/academics/internships/bswinternship/ |
| Doctoral Program |
198492 |
/socialwork/academics/doctoralprogram/ |
| Curriculum |
203449 |
/socialwork/academics/doctoralprogram/curriculum/ |
| Course Descriptions |
203453 |
/socialwork/academics/doctoralprogram/curriculum/coursedescriptions/ |
| Dissertation |
203451 |
/socialwork/academics/doctoralprogram/dissertation/ |
| Program Goals |
203452 |
/socialwork/academics/doctoralprogram/programgoals/ |
| Admission |
203470 |
/socialwork/academics/doctoralprogram/admission/ |
| Advanced Psychotherapy Certificate Program |
197450 |
/socialwork/academics/certificate/advancedpsychotherapycertificateprogram/ |
| Academic Calendar |
197554 |
/socialwork/academics/academic-calendar/ |
| Academic Advising |
197521 |
/socialwork/academics/advising/ |
| BSW |
197522 |
/socialwork/academics/advising/bsw/ |
| Advising |
197524 |
/socialwork/academics/advising/bsw/advising/ |
| Course Availability |
197523 |
/socialwork/academics/advising/bsw/courseavailability/ |
| Forms |
197525 |
/socialwork/academics/advising/bsw/forms/ |
| Templates |
197526 |
/socialwork/academics/advising/bsw/templates/ |
| MSW |
197527 |
/socialwork/academics/advising/msw/ |
| MSW Program Templates |
197530 |
/socialwork/academics/advising/msw/advising-templates/ |
| Full Time MSW (Fall Admit) |
197531 |
/socialwork/academics/advising/msw/advising-templates/fulltimemswfalladmit/ |
| Full Time MSW (Spring Admit with Spring Internship) |
197532 |
/socialwork/academics/advising/msw/advising-templates/fulltimemswspringadmitwithspringinternship/ |
| Full Time MSW (Spring Admit with Summer Internship) |
197533 |
/socialwork/academics/advising/msw/advising-templates/fulltimemswspringadmitwithsummerinternship/ |
| Full Time MSW (Summer Admit) |
197534 |
/socialwork/academics/advising/msw/advising-templates/fulltimemswsummeradmit/ |
| Advanced Standing (students who began Fall of 2021 or earlier) |
197535 |
/socialwork/academics/advising/msw/advising-templates/advancedstandingstudentswhobeganfallof2021orearlier/ |
| MSW Evening Program |
197536 |
/socialwork/academics/advising/msw/advising-templates/msweveningprogram/ |
| 5-Year MSW templates |
197537 |
/socialwork/academics/advising/msw/advising-templates/5-yearmswtemplates/ |
| Full Time Advanced Standing MSW (Fall Admit) |
197538 |
/socialwork/academics/advising/msw/advising-templates/fulltimeadvancedstandingmswfalladmit/ |
| Fall Spring and Summer Admit |
197539 |
/socialwork/academics/advising/msw/advising-templates/fallspringandsummeradmit/ |
| Advanced Standing MSW (students who began Fall of 2025 or later) |
197540 |
/socialwork/academics/advising/msw/advising-templates/advancedstandingmswstudentswhobeganfallof2025orlater/ |
| Full-Time MSW |
197541 |
/socialwork/academics/advising/msw/advising-templates/full-timemsw/ |
| Online MSW Templates |
197542 |
/socialwork/academics/advising/msw/advising-templates/onlinemswtemplates/ |
| Online Bilingual MSW |
197543 |
/socialwork/academics/advising/msw/advising-templates/onlinebilingualmsw/ |
| Course Availability by Term |
197544 |
/socialwork/academics/advising/msw/course-availability/ |
| Student Resources |
203932 |
/socialwork/academics/studentresources/ |
| Graduation Information |
197549 |
/socialwork/academics/studentresources/graduation/ |
| Forms & Handbooks |
197548 |
/socialwork/academics/forms/ |
| Student Resources |
197189 |
/socialwork/studentresources/ |
| Career Development |
197501 |
/socialwork/studentexperience/careerdevelopment/ |
| right_column |
198488 |
/socialwork/studentexperience/careerdevelopment/rightcolumn/ |
| Student Organizations |
197502 |
/socialwork/studentexperience/studentorganizations/ |
| Study Abroad |
197503 |
/socialwork/studentexperience/studyabroad/ |
| Community Immersion Program |
197496 |
/socialwork/studentexperience/communityimmersionprogram/ |
| Praxis - Student Journal |
197505 |
/socialwork/studentexperience/praxis-studentjournal/ |
| Submission Guidelines |
204715 |
/socialwork/studentexperience/praxis-studentjournal/submissionguidelines/ |
| Previous Issues of Praxis |
204716 |
/socialwork/studentexperience/praxis-studentjournal/previousissuesofpraxis/ |
| Praxis Editorial Board |
204717 |
/socialwork/studentexperience/praxis-studentjournal/praxiseditorialboard/ |
| Research |
197194 |
/socialwork/research/ |
| Centers and Institutes |
197196 |
/socialwork/research/centersandinstitutes/ |
| Research and Innovation Lab |
204718 |
/socialwork/research/researchandinnovationlab/ |
| Social Work Undergraduate Research Lab |
205600 |
/socialwork/research/socialworkundergraduateresearchlab/ |
| Impact Review |
207256 |
/socialwork/research/impactreview/ |
| Modal - Dean's Message |
207257 |
/socialwork/research/impactreview/modal-deansmessage/ |
| Modal - Feature Story |
207258 |
/socialwork/research/impactreview/modal-featurestory/ |
| Modal - ORD Message |
207259 |
/socialwork/research/impactreview/modal-ordmessage/ |
| Continuing Education and Licensure |
202386 |
/socialwork/continuingeducationandlicensure/ |
| Licensure |
202387 |
/socialwork/alumni/licensure/ |
| IL Licensure LSW |
202389 |
/socialwork/alumni/licensure/illinois-licensure-lsw |
| Continuing Education |
202394 |
/socialwork/alumni/continuingeducation/ |
| Request Information |
197231 |
/socialwork/rfi/index.cfm |
| Visit Us |
197462 |
/socialwork/visit/ |
| documents |
202448 |
/socialwork/documents/ |
| Sister Jean |
183666 |
/sisterjean/ |
| site_logo |
183671 |
/sisterjean/sitelogo/ |
| Arrangements |
184024 |
/sisterjean/arrangements/ |
| Livestream |
184026 |
/sisterjean/livestream/ |
| Remembrances |
197211 |
/sisterjean/remembrances/ |
| Form |
195514 |
/sisterjean/form/ |
| Thank You |
195515 |
/sisterjean/form/thankyou/ |
| Frequently Asked Questions |
184030 |
/sisterjean/frequentlyaskedquestions/ |
| Sister Jean‘s Legacy |
205811 |
/sisterjean/sisterjeanslegacy/ |
| Kiyara Dahane Profile |
205802 |
/sisterjean/sisterjeanslegacy/kiyaradahaneprofile/ |
| Allie McDougall |
205809 |
/sisterjean/sisterjeanslegacy/alliemcdougall/ |
| Roisin Treacy |
205810 |
/sisterjean/sisterjeanslegacy/roisintreacy/ |
| Press Release |
204534 |
https://news.luc.edu/stories/news/news-about-sister-jean/ |
| About Sister Jean |
202269 |
/aboutsisterjean/ |
| Sister Jean - timeline |
123510 |
/features/stories/sisterjean-timeline/ |
| Livestream Dev |
199649 |
/sisterjean/livestreamdev/ |
| Sister Jean 106 |
203949 |
/sisterjean106-dev/ |
| Footer |
203951 |
/sisterjean106-dev/footer/ |
| social media |
203952 |
/sisterjean106-dev/socialmedia/ |
| Site Temporarily Unavailable |
17450 |
/siteunavailable/index.shtml |
| Footer |
17451 |
/siteunavailable/footer/ |
| Sitemap |
188332 |
/sitemap/ |
| Course Evaluations |
123707 |
/course-evaluations/ |
| site_logo |
123718 |
/course-evaluations/sitelogo/ |
| Contact Us |
123719 |
/course-evaluations/contactus/ |
| Faculty Resources |
123716 |
/course-evaluations/facultyresources/ |
| Administrator Resources |
123715 |
/course-evaluations/administratorresources/ |
| Documents |
124186 |
/course-evaluations/documents/ |
| Social Feeder |
126253 |
/socialfeeder/ |
| Facebook |
126254 |
/socialfeeder/facebook/index.cfm |
| redir.cfm |
126255 |
/socialfeeder/facebook/redir.cfm |
| Application.cfc |
126256 |
/socialfeeder/facebook/Application.cfc |
| feed.cfm |
126257 |
/socialfeeder/facebook/feed.cfm |
| socialfeeder.cfc |
126264 |
/socialfeeder/facebook/socialfeeder.cfc |
| album.cfm |
126272 |
/socialfeeder/facebook/album.cfm |
| page.cfm |
126274 |
/socialfeeder/facebook/page.cfm |
| photos.cfm |
126275 |
/socialfeeder/facebook/photos.cfm |
| reset.cfm |
126276 |
/socialfeeder/facebook/reset.cfm |
| logout.cfm |
126277 |
/socialfeeder/facebook/logout.cfm |
| Sociolegal Studies Minor |
101702 |
/sociolegal/ |
| Footer |
101704 |
/sociolegal/footer/ |
| site_logo |
101707 |
/sociolegal/sitelogo/ |
| About Us |
101764 |
/sociolegal/aboutus/ |
| Why minor in sociolegal studies? |
101840 |
/sociolegal/aboutus/whyminorinsociolegalstudies/ |
| Curriculum |
101841 |
/sociolegal/curriculum/ |
| Requirements |
101867 |
/sociolegal/curriculum/requirements/ |
| Learning Outcomes |
202608 |
https://catalog.luc.edu/undergraduate/arts-sciences/interdisciplinary-studies-minors/sociolegal-studies-minor/#learningoutcomestext |
| Sociology, Department of |
24994 |
/sociology/index.shtml |
| About Us |
24995 |
/sociology/about.shtml |
| Faculty |
24998 |
/sociology/faculty/ |
| profiles |
202415 |
/sociology/faculty/profiles/ |
| right_column |
202416 |
/sociology/faculty/profiles/rightcolumn/ |
| Overview |
24999 |
/sociology/Overview.shtml |
| Sociology Faculty |
86818 |
/sociology/aboutus/sociologyfaculty/ |
| Faculty Spotlights |
205296 |
/sociology/aboutus/sociologyfaculty/facultyspotlights/ |
| Alma Begičević Spotlight |
205298 |
/sociology/aboutus/sociologyfaculty/facultyspotlights/almabegievispotlight/ |
| Jason L. Cummings Spotlight |
205301 |
/sociology/aboutus/sociologyfaculty/facultyspotlights/jasonlcummingsspotlight/ |
| Teresa Gonzales Spotlight |
206198 |
/sociology/aboutus/sociologyfaculty/facultyspotlights/teresagonzalesspotlight/ |
| Program Officers |
25000 |
/sociology/aboutus/program_officers.shtml |
| Affiliated, Part-Time, Emeritus Faculty |
91636 |
/sociology/aboutus/affiliatedpart-timeemeritusfaculty/ |
| Research Centers |
25001 |
/sociology/aboutus/Research_Centers.shtml |
| Staff |
25002 |
/sociology/aboutus/staff.shtml |
| right_column |
86690 |
/sociology/aboutus/rightcolumn/ |
| Department Values & Identity Statement |
193795 |
/sociology/aboutus/departmentvaluesidentitystatement/ |
| Department Focal Areas |
201511 |
/sociology/aboutus/departmentfocalareas/ |
| Academics |
25004 |
/sociology/academics.shtml |
| Undergraduate Programs |
25015 |
/sociology/academics/undergraduateprograms/ |
| BA-Sociology |
25016 |
/sociology/academics/undergraduateprograms/ba-sociology/ |
| Sociology Research for Undergraduates |
205611 |
/sociology/academics/undergraduateprograms/sociologyresearchforundergraduates/ |
| Double Dipping Policy |
104175 |
/sociology/academics/undergraduateprograms/doubledippingpolicy/ |
| BA in Sociology-Anthropology |
104720 |
/sociology/academics/undergraduateprograms/bainsociology-anthropology/ |
| Research Methods Concentration |
107764 |
/sociology/academics/undergraduateprograms/researchmethodsconcentration/ |
| Social Justice Concentration |
107765 |
/sociology/academics/undergraduateprograms/socialjusticeconcentration/ |
| Health and Community Concentration |
200389 |
/sociology/academics/undergraduateprograms/healthandcommunityconcentration/ |
| Social Justice Concentration |
200997 |
/sociology/academics/undergraduateprograms/socialjusticeconcentration/ |
| Minor in Sociology |
104721 |
/sociology/academics/undergraduateprograms/minorinsociology/ |
| Interdisciplinary Minor in Race & Ethnicity |
185429 |
/sociology/academics/undergraduateprograms/interdisciplinaryminorinraceethnicity/ |
| Transfer Credits |
104725 |
/sociology/academics/undergraduateprograms/transfercredits/ |
| Teaching Sociology in High School |
104726 |
/sociology/academics/undergraduateprograms/teachingsociologyinhighschool/ |
| Learning Objectives for Undergraduate Degree in Sociology |
108512 |
/sociology/academics/undergraduateprograms/learningobjectivesforundergraduatedegreeinsociology/ |
| 5 Year BA/MA in Sociology |
200939 |
/sociology/academics/undergraduateprograms/5yearbamainsociology/ |
| Graduate Program |
25011 |
/sociology/graduate.shtml |
| Program Overview |
25021 |
/sociology/Grad_overview.shtml |
| Graduate Student Support |
25048 |
/sociology/gssupport.shtml |
| Doctoral (PhD) Program |
70248 |
/sociology/doctoralphdprogram/ |
| Master of Arts (MA) Program |
70245 |
/sociology/masterofartsmaprogram/ |
| Learning Objectives |
108064 |
/sociology/learningobjectives/ |
| Graduate Courses & Descriptions |
101748 |
/sociology/graduatecoursesdescriptions/ |
| Why Study at Loyola? |
25066 |
/sociology/Features.shtml |
| Our Research Specializations |
25008 |
/sociology/grad_research.shtml |
| Quotes from Our Graduates |
83326 |
/sociology/quotesfromourgraduates/ |
| Current Graduate Students |
109120 |
/sociology/currentgraduatestudents/ |
| right_column |
122432 |
/sociology/currentgraduatestudents/rightcolumn/ |
| Graduate Student Profiles - N/A |
25047 |
/sociology/Grad_profile.shtml |
| graduate student alumni |
25045 |
/sociology/grad_alumni.shtml |
| Graduate Degrees Offered |
25010 |
/sociology/grad_degrees.shtml |
| Graduate Courses |
25009 |
/sociology/graduate_course.shtml |
| 2014 Graduate Award Recipients |
56715 |
/sociology/2014graduateawardrecipients/ |
| Distinguished Graduate Instructor Award |
58401 |
/sociology/2014graduateawardrecipients/distinguishedgraduateinstructoraward/ |
| Robert McNamara Award |
58402 |
/sociology/2014graduateawardrecipients/robertmcnamaraaward/ |
| Richard L. Block Prize |
58403 |
/sociology/2014graduateawardrecipients/richardlblockprize/ |
| Wittner-Whalley Award |
58404 |
/sociology/2014graduateawardrecipients/wittner-whalleyaward/ |
| Outstanding Graduate Student Award |
58405 |
/sociology/2014graduateawardrecipients/outstandinggraduatestudentaward/ |
| Grad Instructors |
59626 |
/sociology/gradinstructors/ |
| Photo Gallery (Ethnography 2016) |
97735 |
/sociology/photogalleryethnography2016/ |
| right_column |
70241 |
/sociology/rightcolumn/ |
| Alumni |
205297 |
/sociology/graduate.shtml |
| Internships |
25012 |
/sociology/internship.shtml |
| Courses |
25006 |
/sociology/courses.shtml |
| Undergraduate Course Descriptions |
53813 |
/sociology/undergraduatecoursedescriptions/ |
| Current Graduate Courses |
53922 |
/sociology/currentgraduatecourses/ |
| All Sociology Courses |
53896 |
/sociology/allsociologycourses/ |
| Current Undergraduate Courses |
202486 |
/sociology/currentundergraduatecourses/ |
| Spring Course on Chicago |
205606 |
/sociology/springcourseonchicago/ |
| Sociology Courses Summer 2026 |
205907 |
/sociology/sociologycoursessummer2026/ |
| Sociology careers and employment |
25014 |
/sociology/careers.shtml |
| right_column |
86693 |
/sociology/academics/rightcolumn/ |
| Sociology Course Matrix |
205924 |
/sociology/academics/sociologycoursematrix/ |
| Admission |
25018 |
/sociology/admission_apply.shtml |
| Financial Aid |
25019 |
/sociology/Financial_Assistance.html |
| Graduate |
25020 |
/sociology/graduate_admission.html |
| Request Information |
70328 |
/sociology/requestinformation/ |
| right_column |
86703 |
/sociology/rightcolumn/ |
| Resources |
25052 |
/sociology/resources.shtml |
| right_column |
86704 |
/sociology/rightcolumn/ |
| What Can I Do With a Sociology Major? |
146991 |
/sociology/whatcanidowithasociologymajor/ |
| What Can I Do With a Sociology Major? |
146991 |
/sociology/whatcanidowithasociologymajor/ |
| Department Honors & Awards |
25053 |
/sociology/akd.shtml |
| Sociology Club |
25060 |
/sociology/sociology_club.shtml |
| Graduate Student Association (SGSA) |
25055 |
/sociology/gas.shtml |
| The SGSA Journal |
201595 |
/sociology/thesgsajournal/ |
| Graduate Handbook |
201507 |
/sociology/graduatehandbook/ |
| Navigating the Institutional Review Board (IRB) |
25058 |
/sociology/irb_tips.shtml |
| Sociology Department News |
25050 |
/sociology/news.shtml |
| Department Honors and Awards |
25054 |
/sociology/honors.shtml |
| 2022 Awards |
180070 |
/sociology/2022awards/ |
| 2019 Undergraduate Honors |
56674 |
/sociology/2019undergraduatehonors/ |
| 2019 Gallager, Durkeim, Scherer & Wittner Awards |
56688 |
/sociology/2019gallagerdurkeimschererwittnerawards/ |
| 2013 Durkeim Award |
56698 |
/sociology/2013durkeimaward/ |
| 2013 Ross P. Scherer Award |
56699 |
/sociology/2013rosspschereraward/ |
| AKD Seniors Receiving Cords and New Initiates |
58338 |
/sociology/akdseniorsreceivingcordsandnewinitiates/ |
| 2020 Awards |
58397 |
/sociology/2020awards/ |
| 2018 Undergraduate Honors |
93986 |
/sociology/2018undergraduatehonors/ |
| 2021 Awards |
162040 |
/sociology/2021awards/ |
| 2025 Awards |
203385 |
/sociology/2025awards/ |
| Student Academic Resources |
203970 |
/sociology/studentacademicresources/ |
| Career Exploration - External Links |
205311 |
/sociology/careerexploration-externallinks/ |
| Sociology Research for Undergraduates |
205768 |
/sociology/academics/undergraduateprograms/sociologyresearchforundergraduates/ |
| Alumni |
83656 |
/sociology/alumni/ |
| Alumni News |
63871 |
/sociology/alumni/alumninews/ |
| MA/PhD Job Placements |
83658 |
/sociology/alumni/maphdjobplacements/ |
| Alumni Profiles |
102197 |
/sociology/alumni/alumniprofiles/ |
| Quintin Williams |
102204 |
/sociology/alumni/alumniprofiles/quintinwilliams/ |
| Soulit Chacko |
102206 |
/sociology/alumni/alumniprofiles/soulitchacko/ |
| Christopher Lee Egan |
102533 |
/sociology/alumni/alumniprofiles/christopherleeegan/ |
| Melissa Gesbeck |
103071 |
/sociology/alumni/alumniprofiles/melissagesbeck/ |
| Cook County's social worker for the dead helps the unclaimed find final resting places |
105215 |
/sociology/alumni/cookcountyssocialworkerforthedeadhelpstheunclaimedfindfinalrestingplaces/ |
| The Eleanor Fails Alumni Speaker Series |
98778 |
/sociology/alumni/theeleanorfailsalumnispeakerseries/ |
| Alumni Spotlights |
205335 |
/sociology/alumni/alumnispotlights/ |
| Alumni Spotlights |
205336 |
/sociology/alumni/alumnispotlights/alumnispotlights/ |
| Siena Baracsi, B.A. |
206204 |
/sociology/alumni/alumnispotlights/alumnispotlights/sienabaracsiba/ |
| Keyla Navarrete, Ph.D. |
205345 |
/sociology/alumni/alumnispotlights/alumnispotlights/keylanavarretephd/ |
| Paul Draus, Ph.D. Alumni Spotlight |
205337 |
/sociology/alumni/alumnispotlights/alumnispotlights/pauldrausphdalumnispotlight/ |
| News and Events |
25049 |
/sociology/newsandevents.shtml |
| CELTS grant support for Sociology 215 - Law and Society |
180069 |
/sociology/celtsgrantsupportforsociology215-lawandsociety/ |
| Faculty Publications |
63975 |
/sociology/facultypublications/ |
| International Handbook of the Demography of Race and Ethnicity |
78013 |
/sociology/facultypublications/internationalhandbookofthedemographyofraceandethnicity/ |
| Reimagining (Bio)Medicalization, Pharmaceuticals and Genetics |
78016 |
/sociology/facultypublications/reimaginingbiomedicalizationpharmaceuticalsandgenetics/ |
| Routledge Handbook or Science, Technology and Society. |
78300 |
/sociology/facultypublications/routledgehandbookorsciencetechnologyandsociety/ |
| Religion & Community in the New Urban America. |
78301 |
/sociology/facultypublications/religioncommunityinthenewurbanamerica/ |
| Faculty Values Statement |
57797 |
/sociology/facultyvaluesstatement/ |
| Megan Baumann |
62480 |
/sociology/meganbaumann/ |
| Chicago River Kayaking Trip |
109636 |
/sociology/chicagoriverkayakingtrip/ |
| Moriah and Gina's work with the Englewood Womens' Initiatve |
122099 |
/sociology/moriahandginasworkwiththeenglewoodwomensinitiatve/ |
| Graduate, Professional, and Adult Student Team (GPAST) |
147821 |
/sociology/graduateprofessionalandadultstudentteamgpast/ |
| Presidential Medallion |
63872 |
/sociology/presidentialmedallion/ |
| Upcoming Events |
64622 |
/sociology/upcomingevents/ |
| Symposium |
75929 |
/sociology/symposium/ |
| Eric Boria |
82846 |
/sociology/ericboria/ |
| Stories |
87545 |
/sociology/stories/ |
| archive |
87546 |
/sociology/stories/archive/ |
| Sociology alumnus fights to end human trafficking |
99184 |
/sociology/sociologyalumnusfightstoendhumantrafficking/ |
| Peter Rosenblatt |
106714 |
/sociology/peterrosenblatt/ |
| Graduation Photo Gallery |
97730 |
/sociology/graduationphotogallery/ |
| Stories |
162045 |
/sociology/stories/ |
| Reuben Jonathan Miller |
162046 |
/sociology/stories/reubenjonathanmiller/ |
| Department Collaboration |
162047 |
/sociology/stories/departmentcollaboration/ |
| SOCL 216 - Kolbe House |
180059 |
/sociology/stories/socl216-kolbehouse/ |
| cta |
198856 |
/sociology/cta/ |
| social media |
198858 |
/sociology/socialmedia/ |
| Footer |
25151 |
/sociology/footer/ |
| site_logo |
25152 |
/sociology/sitelogo/ |
| STAR LAB |
205307 |
/sociology/starlab/ |
| New Arrivals/Asylum Seekers in Chicago |
205323 |
/sociology/starlab/newarrivalsasylumseekersinchicago/ |
| Our Publications |
206092 |
/sociology/starlab/ourpublications/ |
| Sponsored Program Accounting (SPA) |
25454 |
/spa/ |
| site_logo |
25479 |
/spa/sitelogo/ |
| Footer |
25478 |
/spa/footer/ |
| I Links |
198673 |
/spa/ilinks/ |
| modules-programming |
198670 |
/spa/modules-programming/ |
| About Us |
25456 |
/spa/about.shtml |
| Contact Us |
25457 |
/spa/contact_us.shtml |
| FAQs |
25458 |
/spa/faqs.shtml |
| Disclosure Statement (DS 2) |
104653 |
/spa/aboutus/disclosurestatementds2/ |
| Organization Chart |
109125 |
/spa/aboutus/organizationchart/ |
| Training Materials & Guides |
25459 |
/spa/information.shtml |
| Paying Students on a Grant |
105720 |
/spa/payingstudentsonagrant/ |
| Grant Closeout Departmental Checklist |
105927 |
/spa/grantcloseoutdepartmentalchecklist/ |
| Pending Closeout Snapshot Report |
106031 |
/spa/pendingcloseoutsnapshotreport/ |
| SPA Workshop |
107284 |
/spa/spaworkshop/ |
| Policies & Procedures |
25462 |
/spa/policies.shtml |
| Gift Policies & Procedures |
25463 |
/spa/policies_gift.html |
| Grant Policies & Procedures |
25464 |
/spa/policies_grant.html |
| Frequently Accessed University Policies & Procedures |
102925 |
/spa/frequentlyaccesseduniversitypoliciesprocedures/ |
| University Policies |
198680 |
https://www.luc.edu/policy/ |
| Approval Authorization Policy |
206901 |
/spa/approvalauthorizationpolicy/ |
| Cost Overdraft Policy |
206710 |
/spa/costoverdraftpolicy/ |
| Cost Transfers Policy |
206778 |
/spa/costtransferspolicy/ |
| Effort Certification Definitions & FAQs |
206827 |
/spa/effortcertificationdefinitionsfaqs/ |
| Effort Certification Policy |
206817 |
/spa/effortcertificationpolicy/ |
| Grant Expenditure Review Policy |
206826 |
/spa/grantexpenditurereviewpolicy/ |
| Grant v Gift Indicator Checklist |
206761 |
/spa/grantvgiftindicatorchecklist/ |
| Participant Support Guidance & FAQs |
206831 |
/spa/participantsupportguidancefaqs/ |
| Advanced Account Authorization Policy |
207344 |
/spa/advancedaccountauthorizationpolicy/ |
| Unallowable Cost Policy |
207349 |
/spa/unallowablecostpolicy/ |
| Summer Salary Guidance and FAQs |
207350 |
/spa/summersalaryguidanceandfaqs/ |
| Subaward Policy |
207351 |
/spa/subawardpolicy/ |
| Research Study Participant Payments Policy |
207358 |
/spa/researchstudyparticipantpaymentspolicy/ |
| Resources |
25473 |
/spa/resources.shtml |
| Forms |
198681 |
https://www.luc.edu/finance/forms.shtml |
| Chart of Accounts |
25469 |
/spa/resources_chart.html |
| Uniform Guidance & OMB Circulars |
25471 |
/spa/resources_omb.html |
| Rates-Sponsored Programs |
25472 |
/spa/rates.shtml |
| Rates-University |
103269 |
/spa/rates-university/ |
| University Legal Codes |
25474 |
/spa/resources_legalcodes.html |
| Useful Links-External |
25475 |
/spa/useful_links.shtml |
| SPA Forms |
97611 |
/spa/forms/index.shtml |
| SPA Training Request |
97612 |
/spa/forms/trainingrequest.shtml |
| Thank You |
97613 |
/spa/forms/trainingrequest-ty.shtml |
| US Flag Carriers |
104242 |
/spa/usflagcarriers/ |
| Finance Key Contacts |
104286 |
/spa/financekeycontacts/ |
| Uniform Guidance & OMB Circulars |
104287 |
/spa/uniformguidanceombcirculars/ |
| Federal Grants Resources |
104289 |
/spa/federalgrantsresources/ |
| Obtaining Access |
104180 |
/spa/obtainingaccess/ |
| Purchases via Lawson RQC (Requisition Center) |
104182 |
/spa/obtainingaccess/purchasesvialawsonrqcrequisitioncenter/ |
| Reporting Services Access |
205827 |
/spa/obtainingaccess/reportingservicesaccess/ |
| ProCard |
104184 |
/spa/obtainingaccess/procard/ |
| Approval Authorization/AU or Level Access |
104185 |
/spa/obtainingaccess/approvalauthorizationauorlevelaccess/ |
| Health Sciences Research Channel/Portal |
104186 |
/spa/obtainingaccess/healthsciencesresearchchannelportal/ |
| Lakeside PTAP |
104187 |
/spa/obtainingaccess/lakesideptap/ |
| ePAF |
105700 |
/spa/obtainingaccess/epaf/ |
| Pre Award Offices |
104785 |
/spa/preawardoffices/ |
| Strategic Plan |
203688 |
/strategicplan/ |
| site_logo |
204126 |
/strategicplan-dev/sitelogo/ |
| Stritch School of Medicine |
178092 |
/stritch/ |
| site_logo |
180340 |
/stritch/sitelogo/ |
| cta |
180342 |
/stritch/cta/ |
| modules-programming |
181443 |
/stritch/modules-programming/ |
| social media |
181444 |
/stritch/socialmedia/ |
| Info |
181446 |
/stritch/info/ |
| About |
178093 |
/stritch/about/ |
| Mission |
180346 |
/stritch/about/mission/ |
| right_column |
180345 |
/stritch/about/mission/rightcolumn/ |
| Dean's Office |
180347 |
/stritch/about/deansoffice/ |
| Trinity Health |
180349 |
/stritch/about/trinityhealth/ |
| Diversity, Equity, & Inclusion |
180350 |
/stritch/about/diversityequityinclusion/ |
| Mission |
180355 |
/stritch/about/diversityequityinclusion/mission/ |
| Faculty and Staff |
180358 |
/stritch/about/diversityequityinclusion/facultyandstaff/ |
| Stritch Immersion Program (SIP) |
187251 |
/stritch/about/diversityequityinclusion/stritch-immersion/ |
| Culturally Responsive Care and Leadership Certificate Program |
189649 |
/stritch/about/diversityequityinclusion/culturallyresponsivecareandleadershipcertificateprogram/ |
| Institutional Excellence, Policy, and Resources |
191757 |
/stritch/about/diversityequityinclusion/institutionalexcellencepolicyandresources/ |
| Outreach, Recruitment & Success |
194365 |
/stritch/about/diversityequityinclusion/outreachrecruitmentsuccess/ |
| Education, Training & Development |
194371 |
/stritch/about/diversityequityinclusion/educationtrainingdevelopment/ |
| Recent Events and Programs |
194468 |
/stritch/about/diversityequityinclusion/recenteventsandprograms/ |
| Ministry |
180351 |
https://hsd.luc.edu/ministry/ |
| Alumni |
180352 |
/stritch/about/alumni/ |
| Get Involved |
201873 |
/stritch/about/alumni/getinvolved/ |
| Alumni Honors and Awards |
201874 |
/stritch/about/alumni/alumnihonorsandawards/ |
| Alumni of the Year |
201950 |
/stritch/about/alumni/alumnihonorsandawards/alumnioftheyear/ |
| Stritch Medal |
201951 |
/stritch/about/alumni/alumnihonorsandawards/stritchmedal/ |
| Loyola University Chicago Damen Award |
201952 |
/stritch/about/alumni/alumnihonorsandawards/loyolauniversitychicagodamenaward/ |
| HOST Program Frequently Asked Questions |
201879 |
/stritch/about/alumni/hostprogramfrequentlyaskedquestions/ |
| Match Day |
206205 |
/stritch/about/matchday/ |
| site_logo |
206206 |
/stritch/about/matchday/sitelogo/ |
| History |
180353 |
/stritch/about/history/ |
| News & Events |
180354 |
/stritch/about/newsevents/ |
| archive |
182185 |
/stritch/about/newsevents/archive/ |
| John and Herta Cuneo Center |
181838 |
/stritch/about/johnandhertacuneocenter/ |
| LCME |
194082 |
/stritch/about/lcme/ |
| Admissions & Aid |
206293 |
/stritch/admissions/ |
| How to Apply |
206335 |
/stritch/admissions-dev/howtoapply/ |
| Doctor of Medicine Application Guide |
206718 |
/stritch/admissions-dev/howtoapply/doctorofmedicineapplicationguide/ |
| Requirements |
206733 |
/stritch/admissions-dev/howtoapply/doctorofmedicineapplicationguide/requirements/ |
| Technical Standards |
206734 |
/stritch/admissions-dev/howtoapply/doctorofmedicineapplicationguide/requirements/technicalstandards/ |
| Admissions Timeline |
206732 |
/stritch/admissions-dev/howtoapply/doctorofmedicineapplicationguide/admissionstimeline/ |
| Interview Process |
206735 |
/stritch/admissions-dev/howtoapply/doctorofmedicineapplicationguide/interviewprocess/ |
| MD FAQs |
206721 |
/stritch/admissions-dev/howtoapply/doctorofmedicineapplicationguide/mdfaqs/ |
| ASPIRE Pre-Medical Program |
206723 |
/stritch/studentlife/aspire/ |
| Transfer Students |
206736 |
/stritch/admissions-dev/howtoapply/doctorofmedicineapplicationguide/transferstudents/ |
| Re-Applying |
206759 |
/stritch/admissions-dev/howtoapply/doctorofmedicineapplicationguide/re-applying/ |
| Policies |
206760 |
/stritch/admissions-dev/howtoapply/doctorofmedicineapplicationguide/policies/ |
| Curriculum |
206842 |
/stritch/education/doctorofmedicine/ |
| MD Dual-Degree Programs Application Guide |
206719 |
/stritch/admissions-dev/howtoapply/mddual-degreeprogramsapplicationguide/ |
| Biomedical Sciences Graduate Programs Application Guide |
206720 |
/stritch/admissions-dev/howtoapply/biomedicalsciencesgraduateprogramsapplicationguide/ |
| Why Choose Loyola? |
206790 |
/stritch/admissions-dev/whychooseloyola/ |
| Class of 2029 Profile |
206950 |
/stritch/admissions-dev/whychooseloyola/classof2029profile/ |
| Distinctive Programs |
206860 |
/stritch/admissions-dev/whychooseloyola/distinctiveprograms/ |
| Community Service Opportunities |
206791 |
/stritch/admissions-dev/whychooseloyola/communityserviceopportunities/ |
| Clinical Opportunities |
206792 |
/stritch/admissions-dev/whychooseloyola/clinicalopportunities/ |
| Chaplain Mentor Program |
206808 |
/hsc/ministry/co-curricularprograms/chaplainmentorprogram/ |
| Student Testimonials |
206824 |
/stritch/admissions-dev/whychooseloyola/studenttestimonials/ |
| Student Experience |
206810 |
/stritch/admissions-dev/studentexperience/ |
| Campus Life and Culture |
206811 |
/stritch/admissions-dev/studentexperience/campuslifeandculture/ |
| Housing |
206815 |
/stritch/admissions-dev/studentexperience/housing/ |
| Experience Chicago |
206816 |
/stritch/admissions-dev/studentexperience/experiencechicago/ |
| Academic Center of Excellence & Accessibility (ACE) |
206822 |
/stritch/ace/ |
| First- and Second-year Advising |
206823 |
https://www.luc.edu/fsya/index.shtml |
| Student Organizations |
206818 |
/stritch/loyolamsu/studentorganizations/ |
| Wellness |
206820 |
/stritch/wellness/ |
| Campus Ministry |
206819 |
/hsc/ministry/ |
| Diversity, Equity, & Inclusion |
206821 |
/stritch/about/diversityequityinclusion/ |
| Admitted Students |
206828 |
/stritch/admissions-dev/admittedstudents/ |
| Timeline At-a-Glance |
206988 |
/stritch/admissions-dev/admittedstudents/timelineat-a-glance/ |
| Admitted Student FAQs |
206829 |
/stritch/admissions-dev/admittedstudents/admittedstudentfaqs/ |
| Financial Aid & Tuition |
206608 |
/stritch/admissions/financialaid/ |
| How to Apply for Aid |
206975 |
/stritch/admissions-dev/financialaidtuition/howtoapplyforaid/ |
| Application FAQs |
206976 |
/stritch/admissions/stritch/financial-aid-tuition-dev/howtoapplyforaid/applicationfaqs/ |
| Financial Aid Forms |
206977 |
/stritch/admissions-dev/financialaidtuition/howtoapplyforaid/financialaidforms/ |
| Types of Aid |
206995 |
/stritch/admissions-dev/financialaidtuition/typesofaid/ |
| Scholarships |
207026 |
/stritch/admissions/stritch/financial-aid-tuition-dev/typesofaid/scholarships/ |
| External Scholarships |
207024 |
/stritch/financial-aid-tuition-dev/typesofaid/scholarshipsandgrants/externalscholarships/ |
| Loans |
207027 |
/stritch/financial-aid-tuition-dev/typesofaid/loans/ |
| Loans FAQs |
207028 |
/stritch/financial-aid-tuition-dev/typesofaid/loans/loansfaqs/ |
| Loan Repayment Options |
207031 |
/stritch/financial-aid-tuition-dev/typesofaid/loans/loanrepaymentoptions/ |
| Loan Promissory Notes |
207030 |
/stritch/financial-aid-tuition-dev/typesofaid/loans/loanpromissorynotes/ |
| Exit Loan Counseling |
207029 |
/stritch/financial-aid-tuition-dev/typesofaid/loans/exitloancounseling/ |
| Tuition & Fees |
206985 |
/stritch/admissions/stritch/financial-aid-tuition-dev/tuitionfees/ |
| Financial Aid Basics |
206990 |
/stritch/admissions-dev/financialaidtuition/financialaidbasics/ |
| Financial Aid Award FAQs |
206991 |
/stritch/admissions-dev/financialaidtuition/financialaidbasics/financialaidawardfaqs/ |
| Determining Financial Need |
206992 |
/stritch/admissions-dev/financialaidtuition/financialaidbasics/determiningfinancialneed/ |
| Student Responsibilities |
206993 |
/stritch/admissions-dev/financialaidtuition/financialaidbasics/studentresponsibilities/ |
| Policies |
207002 |
/stritch/financial-aid-tuition-dev/financialaidbasics/policies/ |
| Satisfactory Academic Progress Policy |
207224 |
/stritch/admissions/financialaid/financialaidbasics/policies/satisfactoryacademicprogresspolicy/ |
| Appeals and Special Circumstances |
206997 |
/stritch/admissions-dev/financialaidtuition/financialaidbasics/appealsandspecialcircumstances/ |
| One Big Beautiful Bill Act (OBBBA) |
206994 |
/stritch/admissions/financialaid/financialaidbasics/onebigbeautifulbillactobbba/ |
| Debt Management |
207000 |
/stritch/admissions-dev/financialaidtuition/debtmanagement/ |
| Contact |
206978 |
/stritch/admissions-dev/financialaidtuition/contact/ |
| Visit Stritch |
206832 |
/stritch/admissions-dev/visitstritch/ |
| Education |
178095 |
/stritch/education/ |
| Department of Medical Education |
181366 |
/stritch/education/departmentofmedicaleducation/ |
| Doctor of Medicine |
181361 |
/stritch/education/doctorofmedicine/ |
| Graduate Programs |
181362 |
/stritch/education/graduateprograms/ |
| right_column |
182196 |
/stritch/education/graduateprograms/rightcolumn/ |
| Dual-Degree Programs |
181363 |
/stritch/education/dual-degreeprograms/ |
| MD/MA in Bioethics & Health Policy |
182032 |
/stritch/education/dual-degreeprograms/mdmainbioethicshealthpolicy/ |
| Academic Programs |
182134 |
/stritch/education/academicprograms/ |
| Areas of Study |
181364 |
/stritch/education/areasofstudy/ |
| Certificate Programs |
181365 |
/stritch/education/certificateprograms/ |
| Office of Educational Affairs |
195160 |
/stritch/education/officeofeducationalaffairs/ |
| Faculty |
178096 |
/stritch/faculty/ |
| Directory |
181450 |
/stritch/faculty/directory/ |
| Administration |
181451 |
/stritch/faculty/administration/ |
| Departments |
181452 |
/stritch/faculty/departments/ |
| Mentorship |
181453 |
/stritch/faculty/mentorship/ |
| Profiles |
181811 |
/stritch/faculty/profiles/ |
| Research |
178097 |
/stritch/research/ |
| Overview |
182030 |
/stritch/research/overview/ |
| Opportunities |
181438 |
/stritch/research/opportunities/ |
| Research Funding Committee |
75549 |
/stritch/research/researchfundingcommittee/ |
| Institutes and Centers |
201573 |
/stritch/research/institutesandcenters/ |
| Burn and Shock Trauma Research Institute |
207198 |
https://www.luc.edu/stritch/bstri/ |
| Cardinal Bernardin Cancer Center (CBCC) |
207199 |
https://www.luc.edu/stritch/cbcc/ |
| Cardiovascular Research Institute (CVRI) |
207200 |
https://www.luc.edu/stritch/cvri/ |
| Facilities & Cores |
75673 |
/stritch/research/facilitiescores/ |
| About Facilities & Cores |
199849 |
/stritch/research/facilitiescores/ |
| right_column |
93363 |
/stritch/research/facilitiescores/cvrismallanimalcorefacility/rightcolumn/ |
| Clinical Research Office |
83892 |
https://www.luc.edu/hsc/cro/ |
| Loyola Core Microscopy Facility |
75539 |
/stritch/research/facilitiescores/loyolacoremicroscopyfacility/ |
| Services |
98795 |
/stritch/research/facilitiescores/loyolacoremicroscopyfacility/services/ |
| Two-Photon |
98802 |
/stritch/research/facilitiescores/loyolacoremicroscopyfacility/services/two-photon/ |
| Pricing |
200740 |
/stritch/research/facilitiescores/loyolacoremicroscopyfacility/pricing/ |
| Instrumentation |
200741 |
/stritch/research/facilitiescores/loyolacoremicroscopyfacility/instrumentation/ |
| Protocols |
200753 |
/stritch/research/facilitiescores/loyolacoremicroscopyfacility/protocols/ |
| Publications |
200742 |
/stritch/research/facilitiescores/loyolacoremicroscopyfacility/publications/ |
| right_column |
106762 |
/stritch/research/facilitiescores/physiologymachineshop/rightcolumn/ |
| Contact Us |
200777 |
/stritch/research/facilitiescores/physiologymachineshop/contactus/ |
| Flow Cytometry Core Facility |
203180 |
/stritch/research/facilitiescores/flowcytometrycorefacility/ |
| Office of the Vice Dean of Research |
127195 |
/stritch/research/officeofthevicedeanofresearch/ |
| right_column |
163130 |
/stritch/research/officeofthevicedeanofresearch/rightcolumn/ |
| Student Life |
178098 |
/stritch/studentlife/ |
| Overview |
181761 |
/stritch/studentlife/overview/ |
| Pre-matriculation |
181439 |
/stritch/studentlife/pre-matriculation/ |
| Office of Student Affairs |
181440 |
/stritch/studentlife/officeofstudentaffairs/ |
| Office of Student Affairs |
195897 |
/stritch/studentlife/officeofstudentaffairs/officeofstudentaffairs/ |
| Medical Student Union |
186612 |
/stritch/loyolamsu/index.shtml |
| Student Awards & Honor Societies |
181442 |
/stritch/studentlife/studentawardshonorsocieties/ |
| Wellness |
181724 |
/stritch/studentlife/wellness/ |
| Aspects of Wellness |
189638 |
/stritch/studentlife/wellness/aspectsofwellness/ |
| Student Wellness Advisory Group |
189325 |
/stritch/studentlife/wellness/studentwellnessadvisorygroup/ |
| Clinical Health Requirements |
189326 |
/stritch/studentlife/wellness/clinicalhealthrequirements/ |
| Blood Borne Pathogens and Exposures |
189320 |
/stritch/studentlife/wellness/bloodbornepathogensandexposures/ |
| Newsletter |
189489 |
/stritch/studentlife/wellness/newsletter/ |
| Clearance Instructions |
197974 |
/stritch/studentlife/wellness/clearanceinstructions/ |
| Current Student Resources |
189200 |
/stritch/studentlife/currentstudentresources/ |
| Forms |
189201 |
/stritch/studentlife/forms/ |
| ASPIRE |
190237 |
/stritch/studentlife/aspire/ |
| Content |
204431 |
/stritch/content/ |
| Faculty Ambassadors |
76924 |
/stritch/content/facultyambassadors/ |
| Committee on Academic Rank and Tenure (CART) |
76030 |
/stritch/cart/ |
| Site Map |
181789 |
/stritch/sitemap/ |
| ChaiHeroStory |
182321 |
/stritch/chaiherostory/ |
| Junior Senior Scientists of the Year |
184530 |
/stritch/juniorseniorscientistsoftheyear/ |
| pdf |
184759 |
/stritch/pdf/ |
| 2023 Hou Award |
185185 |
/stritch/2023houaward/ |
| C. Montelongo-Hernandez |
185513 |
/stritch/cmontelongo-hernandez/ |
| Loyola Honors Emami, Roeske |
186452 |
/stritch/loyolahonorsemamiroeske/ |
| Remembering William Brandt, Jr. |
186772 |
/stritch/rememberingwilliambrandtjr/ |
| WINS Encourages Girls to Pursue Science |
187433 |
/stritch/winsencouragesgirlstopursuescience/ |
| Academic Calendars |
188323 |
/stritch/academiccalendars/ |
| First Year Academic Calendar 2026-2027 |
188324 |
/stritch/academiccalendars/firstyearacademiccalendar2026-2027/ |
| Second Year Academic Calendar 2026-2027 |
188325 |
/stritch/academiccalendars/secondyearacademiccalendar2026-2027/ |
| Third Year Academic Calendar 2026-2027 (Schedule A) |
188326 |
/stritch/academiccalendars/thirdyearacademiccalendar2026-2027schedulea/ |
| Third Year Academic Calendar 2026-2027 (Schedule B) |
188327 |
/stritch/academiccalendars/thirdyearacademiccalendar2026-2027scheduleb/ |
| Fourth Year Academic Calendar 2026-2027 |
188328 |
/stritch/academiccalendars/fourthyearacademiccalendar2026-2027/ |
| First Year Academic Calendar 2025-2026 |
188329 |
/stritch/academiccalendars/firstyearacademiccalendar2025-2026/ |
| First Year Academic Calendar 2025-2026 |
188329 |
/stritch/academiccalendars/firstyearacademiccalendar2025-2026/ |
| Second Year Academic Calendar 2025-2026 |
188333 |
/stritch/academiccalendars/secondyearacademiccalendar2025-2026/ |
| Third Year Academic Calendar 2025-2026 (Schedule A) |
188334 |
/stritch/academiccalendars/thirdyearacademiccalendar2025-2026schedulea/ |
| Third Year Academic Calendar 2025-2026 (Schedule B) |
188335 |
/stritch/academiccalendars/thirdyearacademiccalendar2025-2026scheduleb/ |
| Fourth Year Academic Calendar 2025-2026 |
188336 |
/stritch/academiccalendars/fourthyearacademiccalendar2025-2026/ |
| Wellness |
190012 |
/stritch/wellness/ |
| Story Content |
190866 |
/stritch/storycontent/ |
| stritch-physicians-in-training-honor-faculty-staff |
189207 |
/stritch/storycontent/stritch-physicians-in-training-honor-faculty-staff/ |
| M4 Receives AMA Foundation "DREAM" Scholarship |
189543 |
/stritch/storycontent/m4receivesamafoundationdreamscholarship/ |
| 2023 President’s Medallion |
189906 |
/stritch/storycontent/2023presidentsmedallion/ |
| Two students win St. Albert’s Day competition |
190010 |
/stritch/storycontent/twostudentswinstalbertsdaycompetition/ |
| Stritch recognizes research excellence with Jr. and Sr. Scientist awards |
190041 |
/stritch/storycontent/stritchrecognizesresearchexcellencewithjrandsrscientistawards/ |
| Mark Kuczewski receives international bioethics award |
190449 |
/stritch/storycontent/markkuczewskireceivesinternationalbioethicsaward/ |
| How and when should medical schools teach Emotional Intelligence? |
190867 |
/stritch/storycontent/howandwhenshouldmedicalschoolsteachemotionalintelligence/ |
| HSC students build skills, community...and a house |
191507 |
/stritch/storycontent/hscstudentsbuildskillscommunityandahouse/ |
| Graduate Students Win Society for Neuroscience Competitions |
194087 |
/stritch/storycontent/graduatestudentswinsocietyforneurosciencecompetitions/ |
| M4s’ experience: Entering medical school during a worldwide pandemic |
194123 |
/stritch/storycontent/m4sexperienceenteringmedicalschoolduringaworldwidepandemic/ |
| Laura Sherer, PhD, wins fellowship |
195852 |
/stritch/storycontent/laurashererphdwinsfellowship/ |
| WINS inspires the next generation with science sisters’ day |
195868 |
/stritch/storycontent/winsinspiresthenextgenerationwithsciencesistersday/ |
| Amanda Vanderplow, PhD, receives national funding award |
196196 |
/stritch/storycontent/amandavanderplowphdreceivesnationalfundingaward/ |
| Earning three degrees will help Chidozie Onyiuke navigate medicine and business |
197062 |
/stritch/storycontent/earningthreedegreeswillhelpchidozieonyiukenavigatemedicineandbusiness/ |
| The CCGH creates new scholar position |
197156 |
/stritch/storycontent/theccghcreatesnewscholarposition/ |
| Meet the Stritch Class of 2028 |
197473 |
/stritch/storycontent/meetthestritchclassof2028/ |
| How the CGH Honors Program Fuels A Student's Passion for Global Health |
197906 |
/stritch/storycontent/howthecghhonorsprogramfuelsastudentspassionforglobalhealth/ |
| Mark Cichon’s Calling: Healing and Teaching |
198171 |
/stritch/storycontent/markcichonscallinghealingandteaching/ |
| Latine Leadership in the Sciences |
198740 |
/stritch/storycontent/latineleadershipinthesciences/ |
| Stritch Alumna Shares Her Unique Journey to Residency |
199597 |
/stritch/storycontent/stritchalumnasharesheruniquejourneytoresidency/ |
| Understanding Indigenous Health: A Call to Action for Equity and Respect |
200501 |
/stritch/storycontent/understandingindigenoushealthacalltoactionforequityandrespect/ |
| A Voice for the Underserved: Alumnus Caylon Pettis’s Journey to Psychiatry |
201519 |
/stritch/storycontent/avoicefortheunderservedalumnuscaylonpettissjourneytopsychiatry/ |
| Alumna Shannon Lovett’s Journey from Medical Student to Emergency Medicine Chair |
202189 |
/stritch/storycontent/alumnashannonlovettsjourneyfrommedicalstudenttoemergencymedicinechair/ |
| Stritch students honor outstanding educators with annual awards |
202190 |
/stritch/storycontent/stritchstudentshonoroutstandingeducatorswithannualawards/ |
| Leading with Compassion and Vulnerability |
202657 |
/stritch/storycontent/leadingwithcompassionandvulnerability/ |
| Congratulations, Class of 2025! |
202699 |
/stritch/storycontent/congratulationsclassof2025/ |
| A Calling Beyond the Clinic |
202710 |
/stritch/storycontent/acallingbeyondtheclinic/ |
| Path to the Podium |
202711 |
/stritch/storycontent/pathtothepodium/ |
| Physician Formation |
202712 |
/stritch/storycontent/physicianformation/ |
| Nan Sethakorn Receives RHA Lung Cancer Research Award |
203426 |
/stritch/storycontent/nansethakornreceivesrhalungcancerresearchaward/ |
| Welcome Class of 2029 |
204430 |
/stritch/storycontent/welcomeclassof2029/ |
| Stritch Alumni Awards 2025 |
204453 |
/stritch/storycontent/stritchalumniawards2025/ |
| Faculty and Staff Awards 2025 |
204754 |
/stritch/storycontent/facultyandstaffawards2025/ |
| Dean's First-Generation Scholarship |
204921 |
/stritch/storycontent/deansfirst-generationscholarship/ |
| Called to provide compassionate, equitable care |
205599 |
/stritch/storycontent/calledtoprovidecompassionateequitablecare/ |
| 2025 Stritch Medalist |
205757 |
/stritch/storycontent/2025stritchmedalist/ |
| Junior and Senior Scientist Awards 2025 |
205799 |
/stritch/storycontent/juniorandseniorscientistawards2025/ |
| Outstanding Faculty and Staff Awards 2026 |
206424 |
/stritch/storycontent/outstandingfacultyandstaffawards2026/ |
| 2026 President's Medallion |
206478 |
/stritch/storycontent/2026presidentsmedallion/ |
| 2026 Stritch Commencement Student Speaker |
206940 |
/stritch/storycontent/2026stritchcommencementstudentspeaker/ |
| Congratulations Class of 2026 |
207013 |
/stritch/storycontent/congratulationsclassof2026/ |
| Committee on Admissions |
195909 |
/stritch/committeeonadmissions/ |
| right column |
195922 |
/stritch/committeeonadmissions/rightcolumn/ |
| pdf - bylaw |
199598 |
/stritch/pdf-bylaw/ |
| Visit |
206652 |
/stritch/visit/ |
| The Cardinal Bernardin Cancer Center |
204728 |
/stritch/cbcc/ |
| About |
204736 |
/cbcc-dev/about/ |
| Leadership |
204742 |
/cbcc-dev/about/leadership/ |
| Cardinal Bernardin |
204743 |
/cbcc-dev/about/cardinalbernardin/ |
| Cancer Center Catchment Area |
207156 |
/stritch/cbcc/about/cancercentercatchmentarea/ |
| Directory |
205309 |
/stritch-cbcc-dev/aboutus/directory/ |
| profiles |
205310 |
/stritch-cbcc-dev/aboutus/directory/profiles/ |
| News and Events |
204740 |
/stritch-cbcc-dev/newsandevents/ |
| Cancer Center News |
204746 |
/stritch-cbcc-dev/newsandevents/cancercenternews/ |
| Cancer Research Night and Poster Session |
204747 |
/stritch-cbcc-dev/newsandevents/cancerresearchnightandpostersession/ |
| Lecture Series |
204748 |
/stritch-cbcc-dev/newsandevents/lectureseries/ |
| Publications and Presentations |
204749 |
/stritch-cbcc-dev/newsandevents/publicationsandpresentations/ |
| Research |
204741 |
/stritch-cbcc-dev/research/ |
| Cancer Research Programs |
204750 |
/stritch-cbcc-dev/research/cancerresearchprograms/ |
| Disease Site Groups |
204751 |
/stritch-cbcc-dev/research/diseasesitegroups/ |
| Cancer Clinical Trials Office |
204752 |
/stritch-cbcc-dev/research/cancerclinicaltrialsoffice/ |
| Internal Funding Opportunities |
204753 |
/stritch-cbcc-dev/research/internalfundingopportunities/ |
| Education and Training |
204738 |
/stritch-cbcc-dev/educationandtraining/ |
| Community Outreach |
204737 |
/cbcc-dev/communityoutreach/ |
| Global Oncology Program |
204744 |
/stritch-cbcc-dev/communityoutreachandengagement/globaloncologyprogram/ |
| Colleges Against Cancer |
204745 |
/stritch-cbcc-dev/communityoutreachandengagement/collegesagainstcancer/ |
| Stritch - Academic Center for Excellence and Accessibility (ACE) |
188295 |
/stritch/ace/ |
| site_logo |
188296 |
/stritch/ace/sitelogo/ |
| Curricular Resources |
188304 |
/stritch/ace/curricularresources/ |
| M1 |
188305 |
/stritch/ace/curricularresources/m1/ |
| M2 |
188306 |
/stritch/ace/curricularresources/m2/ |
| M3/M4 |
188307 |
/stritch/ace/curricularresources/m3m4/ |
| Step Prep Resources |
188311 |
/stritch/ace/stepprepresources/ |
| Step 1 |
188312 |
/stritch/ace/stepprepresources/step1/ |
| S1S - Step 1 Stritch |
188314 |
/stritch/ace/stepprepresources/s1s-step1stritch/ |
| Step 2 |
188315 |
/stritch/ace/stepprepresources/step2/ |
| Tutoring |
188317 |
/stritch/ace/tutoring/ |
| Career Advising |
188318 |
/stritch/ace/careeradvising/ |
| Accessibility |
188319 |
/stritch/ace/accessibility/ |
| Stritch - Advising Program |
188985 |
/stritch/advisingprogram/ |
| site_logo |
188986 |
/stritch/advisingprogram/sitelogo/ |
| Footer |
188987 |
/stritch/advisingprogram/footer/ |
| cta |
188988 |
/stritch/advisingprogram/cta/ |
| social media |
188990 |
/stritch/advisingprogram/socialmedia/ |
| About Us |
189072 |
/stritch/advisingprogram/aboutus/ |
| Mission Statement |
189073 |
/stritch/advisingprogram/aboutus/missionstatement/ |
| Contact Us |
189074 |
/stritch/advisingprogram/aboutus/contactus/ |
| Staff |
194149 |
/stritch/advisingprogram/aboutus/staff/ |
| Academic Support |
189075 |
/stritch/advisingprogram/academicsupport/ |
| Academic Advisor's Role |
189077 |
/stritch/advisingprogram/academicsupport/academicadvisorsrole/ |
| Curriculum Map |
193765 |
/stritch/advisingprogram/academicsupport/curriculummap/ |
| Personal Support |
189081 |
/stritch/advisingprogram/personalsupport/ |
| Professional Support |
189094 |
/stritch/advisingprogram/professionalsupport/ |
| Advisor Resources |
189106 |
/stritch/advisingprogram/advisorresources/ |
| Overview |
194221 |
/stritch/advisingprogram/advisorresources/ |
| Career Advisor Resources |
189108 |
/stritch/advisingprogram/advisorresources/careeradvisorresources/ |
| Advisor Access to Grades |
189109 |
/stritch/advisingprogram/advisorresources/advisoraccesstogrades/ |
| Academic Advisor's Role |
189118 |
/stritch/advisingprogram/academicsupport/academicadvisorsrole/ |
| Calendar |
189119 |
/stritch/academiccalendars/ |
| Research |
189120 |
/hsc/researchservices/studentresearch/medicalstudentresearchopportunities/ |
| Research Honors |
189121 |
/hsc/researchservices/studentresearch/researchhonorsprogram/ |
| Crisis Response & Resources |
189123 |
/cura/ |
| Stritch - Alcohol Research Program |
75784 |
/stritch/arp/ |
| About Us |
75947 |
/stritch/arp/aboutus/ |
| Contact Us |
75948 |
/stritch/arp/aboutus/contactus/ |
| AIRIG |
198007 |
/stritch/arp/aboutus/airig/ |
| Faculty |
77929 |
/stritch/arp/faculty/ |
| Profiles |
78265 |
/stritch/arp/faculty/profiles/ |
| Trainees |
75943 |
/stritch/arp/trainees/ |
| Current Trainees |
77912 |
/stritch/arp/trainees/currenttrainees/ |
| Former Trainees |
77913 |
/stritch/arp/trainees/formertrainees/ |
| Testimonials |
75946 |
/stritch/arp/testimonials/ |
| documents links |
84131 |
/stritch/arp/documentslinks/ |
| site_logo |
202896 |
/stritch/arp/sitelogo/ |
| Footer |
202897 |
/stritch/arp/footer/ |
| I Links |
202899 |
/stritch/arp/ilinks/ |
| social media |
202900 |
/stritch/arp/socialmedia/ |
| modules-programming |
202901 |
/stritch/arp/modules-programming/ |
| Stritch - Anesthesiology and Perioperative Medicine |
93110 |
/stritch/anesthesiology/ |
| site_logo |
202930 |
/stritch/anesthesiology/sitelogo/ |
| Footer |
202931 |
/stritch/anesthesiology/footer/ |
| social media |
202933 |
/stritch/anesthesiology/socialmedia/ |
| cta |
202934 |
/stritch/anesthesiology/cta/ |
| About |
93123 |
/stritch/anesthesiology/about/ |
| Message from the Chair |
93248 |
/stritch/anesthesiology/about/messagefromthechair/ |
| Contact Us |
93250 |
/stritch/anesthesiology/about/contactus/ |
| Human Simulation |
93249 |
/stritch/anesthesiology/about/humansimulation/ |
| Center for Simulation Education |
187176 |
/stritch/anesthesiology/about/centerforsimulationeducation/ |
| Divisions/Specialties |
93239 |
/stritch/anesthesiology/divisionsspecialties/ |
| Cardiothoracic Critical Care Unit |
93241 |
/stritch/anesthesiology/divisionsspecialties/cardiothoraciccriticalcareunit/ |
| Hepatobiliary Surgery and Liver Transplantation |
93242 |
/stritch/anesthesiology/divisionsspecialties/hepatobiliarysurgeryandlivertransplantation/ |
| Neuroanesthesia |
93243 |
/stritch/anesthesiology/divisionsspecialties/neuroanesthesia/ |
| Obstetric Anesthesia |
93244 |
/stritch/anesthesiology/divisionsspecialties/obstetricanesthesia/ |
| Pain Treatment Center |
93245 |
/stritch/anesthesiology/divisionsspecialties/paintreatmentcenter/ |
| Pediatric Anesthesia Training |
93246 |
/stritch/anesthesiology/divisionsspecialties/pediatricanesthesiatraining/ |
| Cardiothoracic Anesthesia |
205592 |
/stritch/anesthesiology/divisionsspecialties/cardiothoracicanesthesia/ |
| Residency / Fellowships |
93117 |
/stritch/anesthesiology/residencyfellowships/ |
| Faculty |
93119 |
/stritch/anesthesiology/faculty/ |
| Profiles |
93121 |
/stritch/anesthesiology/faculty/profiles/ |
| right_column |
202937 |
/stritch/anesthesiology/faculty/profiles/rightcolumn/ |
| Research |
93118 |
/stritch/anesthesiology/research/ |
| Services |
93122 |
https://www.loyolamedicine.org/anesthesiology |
| Stritch - Bioethics |
190228 |
/stritch/bioethics/ |
| site_logo |
190229 |
/stritch/bioethics/sitelogo/ |
| Footer |
190230 |
/stritch/bioethics/footer/ |
| cta |
190231 |
/stritch/bioethics/cta/ |
| social media |
190233 |
/stritch/bioethics/socialmedia/ |
| About Us |
189932 |
/stritch/bioethics/aboutus/ |
| 25th Anniversary |
203442 |
/stritch/bioethics/aboutus/25thanniversary/ |
| Faculty Directory |
189921 |
/stritch/bioethics/aboutus/facultydirectory/ |
| Profiles |
190325 |
/stritch/bioethics/aboutus/facultydirectory/profiles/ |
| kuczewski-facultyaward-2017 |
190328 |
/stritch/bioethics/aboutus/facultydirectory/kuczewski-facultyaward-2017/ |
| Bioethics Professor Named to National Role |
190358 |
/stritch/bioethics/aboutus/facultydirectory/bioethicsprofessornamedtonationalrole/ |
| Faculty Research |
189929 |
/stritch/bioethics/aboutus/facultyresearch/ |
| Contact Us |
192466 |
/stritch/bioethics/aboutus/contactus/ |
| Faculty Presentations |
189922 |
/stritch/bioethics/aboutus/facultypresentations/ |
| What is Bioethics? |
189938 |
/stritch/bioethics/aboutus/whatisbioethics/ |
| Graduate Education |
189934 |
/stritch/bioethics/graduateeducation/ |
| Bioethics |
189936 |
/stritch/bioethics/graduateeducation/bioethics/ |
| Doctorate Degree |
189939 |
/stritch/bioethics/graduateeducation/bioethics/doctoratedegree/ |
| Master of Arts |
189937 |
/stritch/bioethics/graduateeducation/bioethics/masterofarts/ |
| Certificate Programs |
189940 |
/stritch/bioethics/graduateeducation/bioethics/certificateprograms/ |
| Student Testimonials |
189941 |
/stritch/bioethics/graduateeducation/bioethics/studenttestimonials/ |
| Program Tuition & Scholarships |
189942 |
/stritch/bioethics/graduateeducation/bioethics/programtuitionscholarships/ |
| Open House Webinars |
189945 |
/stritch/bioethics/graduateeducation/bioethics/openhousewebinars/ |
| How do I apply? |
189946 |
/stritch/bioethics/graduateeducation/bioethics/howdoiapply/ |
| Course Descriptions: Bioethics & Health Policy |
189947 |
/stritch/bioethics/graduateeducation/bioethics/coursedescriptionsbioethicshealthpolicy/ |
| Request Information - BEHP |
190721 |
/stritch/bioethics/graduateeducation/bioethics/requestinformation-behp/ |
| Thank you |
198414 |
/stritch/bioethics/graduateeducation/bioethics/thankyou/ |
| Mission Leadership |
189963 |
/stritch/bioethics/graduateeducation/missionleadership/ |
| Doctorate in Healthcare Mission Leadership |
189964 |
/stritch/bioethics/graduateeducation/missionleadership/doctorateinhealthcaremissionleadership/ |
| Open House Webinars |
198128 |
/stritch/bioethics/graduateeducation/missionleadership/openhousewebinars/ |
| Course Descriptions: Healthcare Mission Leadership |
189955 |
/stritch/bioethics/graduateeducation/missionleadership/coursedescriptionshealthcaremissionleadership/ |
| Request Information - HCML |
190720 |
/rfi-hmcl/ |
| Thank You |
198429 |
/rfi-hmcl/thankyou/ |
| Program Features |
191577 |
/stritch/bioethics/graduateeducation/programfeatures/ |
| Ethics Consult Skills |
189967 |
/stritch/bioethics/graduateeducation/ethicsconsultskills/ |
| Sample Demonstration of the ACES Tool |
191694 |
/stritch/bioethics/graduateeducation/ethicsconsultskills/sampledemonstrationoftheacestool/ |
| Welcome to the ACES Tool |
191695 |
/stritch/bioethics/graduateeducation/ethicsconsultskills/welcometotheacestool/ |
| Medical Education |
189968 |
/stritch/bioethics/medicaleducation/ |
| Ethics Requirements |
189970 |
/stritch/bioethics/medicaleducation/ethicsrequirements/ |
| Ethics Paper |
189971 |
/stritch/bioethics/medicaleducation/ethicspaper/ |
| Electives |
190477 |
/stritch/bioethics/medicaleducation/electives/ |
| Honors Program |
189969 |
/stritch/bioethics/medicaleducation/honorsprogram/ |
| Physician’s Vocation Program |
190478 |
/stritch/bioethics/medicaleducation/physiciansvocationprogram/ |
| Sanctuary Doctor |
192171 |
/stritch/bioethics/medicaleducation/sanctuarydoctor/ |
| MD/MA Joint Degree |
189974 |
/stritch/education/dual-degreeprograms/mdmainbioethicshealthpolicy/ |
| Sanctuary Doctor Spanish |
201761 |
/stritch/bioethics/medicaleducation/sanctuarydoctorspanish/ |
| News and Events |
190129 |
/stritch/bioethics/newsandevents/ |
| Upcoming Events |
190130 |
/stritch/bioethics/newsandevents/upcomingevents/ |
| Ethics Grand Rounds |
195782 |
/stritch/bioethics/newsandevents/ethicsgrandrounds/ |
| Loyola Bioethics Live |
190131 |
/stritch/bioethics/newsandevents/loyolabioethicslive/ |
| Reimagining Mission Speaker Series |
190132 |
/stritch/bioethics/newsandevents/reimaginingmissionspeakerseries/ |
| Reflective MedEd Blog |
190133 |
https://reflectivemeded.org/ |
| Alumni |
189943 |
/stritch/bioethics/alumni/ |
| Student Publications |
189944 |
/stritch/bioethics/alumni/studentpublications/ |
| Alumni News Archive |
190307 |
/stritch/bioethics/alumni/alumninewsarchive/ |
| Stritch - BSTRI |
191835 |
/stritch/bstri/ |
| site_logo |
191836 |
/stritch/bstri/sitelogo/ |
| Footer |
191837 |
/stritch/bstri/footer/ |
| cta |
191838 |
/stritch/bstri/cta/ |
| social media |
191840 |
/stritch/bstri/socialmedia/ |
| About Us |
191845 |
/stritch/bstri/aboutus/ |
| Mission |
191846 |
/stritch/bstri/aboutus/mission/ |
| History |
191847 |
/stritch/bstri/aboutus/history/ |
| Education |
191849 |
/stritch/bstri/education/ |
| Research Training Opportunities |
191850 |
/stritch/bstri/education/researchtrainingopportunities/ |
| Research Training in Trauma and Burn Research |
191855 |
/stritch/bstri/education/researchtrainingopportunities/researchtrainingintraumaandburnresearch/ |
| Training for Surgery Residents |
191851 |
/stritch/bstri/education/trainingforsurgeryresidents/ |
| Graduate Training |
191852 |
/stritch/bstri/education/graduatetraining/ |
| Current Students |
191856 |
/stritch/bstri/education/graduatetraining/currentstudents/ |
| Profiles |
191933 |
/stritch/bstri/education/graduatetraining/currentstudents/profiles/ |
| Former Students |
191857 |
/stritch/bstri/education/graduatetraining/formerstudents/ |
| Profiles |
191934 |
/stritch/bstri/education/graduatetraining/formerstudents/profiles/ |
| Post Doctoral Training |
191853 |
/stritch/bstri/education/postdoctoraltraining/ |
| Current Students |
191858 |
/stritch/bstri/education/postdoctoraltraining/currentstudents/ |
| Former Students |
191859 |
/stritch/bstri/education/postdoctoraltraining/formerstudents/ |
| Profiles |
191964 |
/stritch/bstri/education/postdoctoraltraining/formerstudents/profiles/ |
| Research |
191860 |
/stritch/bstri/research/ |
| Research Staff |
191862 |
/stritch/bstri/research/researchstaff/ |
| Profiles |
191974 |
/stritch/bstri/research/researchstaff/profiles/ |
| Alcohol Research |
191986 |
/stritch/bstri/research/alcoholresearch/ |
| Research Labs |
191864 |
/stritch/bstri/research/researchlabs/ |
| Trainees |
191865 |
/stritch/bstri/research/trainees/ |
| Faculty |
191867 |
/stritch/bstri/faculty/ |
| Profiles |
191977 |
/stritch/bstri/faculty/profiles/ |
| Contact Us |
191868 |
/stritch/bstri/contactus/ |
| Administrative Staff |
191869 |
/stritch/bstri/contactus/administrativestaff/ |
| Campus Location |
191870 |
/stritch/bstri/contactus/campuslocation/ |
| Stritch - Cancer Biology |
189323 |
/stritch/cancerbiology/ |
| site_logo |
189345 |
/stritch/cancerbiology/sitelogo/ |
| Footer |
189346 |
/stritch/cancerbiology/footer/ |
| cta |
189347 |
/stritch/cancerbiology/cta/ |
| social media |
189349 |
/stritch/cancerbiology/socialmedia/ |
| About |
189491 |
/stritch/cancerbiology/about/ |
| Welcome |
189493 |
/stritch/cancerbiology/about/welcome/ |
| Overview |
189498 |
/stritch/cancerbiology/about/overview/ |
| Contact Us |
189502 |
/stritch/cancerbiology/about/contactus/ |
| News |
189503 |
/stritch/cancerbiology/about/news/ |
| Research |
189509 |
/stritch/cancerbiology/research/ |
| Our Faculty |
189510 |
/stritch/cancerbiology/research/ourfaculty/ |
| Profiles |
189614 |
/stritch/cancerbiology/research/ourfaculty/profiles/ |
| Education and Training |
189511 |
/stritch/cancerbiology/educationandtraining/ |
| CMO Masters Program |
189515 |
/stritch/cancerbiology/educationandtraining/cmomastersprogram/ |
| Biochemistry, Molecular and Cancer Biology |
189517 |
/stritch/cancerbiology/educationandtraining/biochemistrymolecularandcancerbiology/ |
| LUC Summer Research Internship |
189518 |
/stritch/cancerbiology/educationandtraining/lucsummerresearchinternship/ |
| Our People |
189519 |
/stritch/cancerbiology/ourpeople/ |
| Our Faculty |
189520 |
/stritch/cancerbiology/research/ourfaculty/ |
| Research Professors and Research Associates |
189521 |
/stritch/cancerbiology/ourpeople/researchprofessorsandresearchassociates/ |
| Profiles |
189631 |
/stritch/cancerbiology/ourpeople/researchprofessorsandresearchassociates/profiles/ |
| right_column |
203114 |
/stritch/cancerbiology/ourpeople/researchprofessorsandresearchassociates/profiles/rightcolumn/ |
| Graduate Students |
189522 |
/stritch/cancerbiology/ourpeople/graduatestudents/ |
| Profiles |
189634 |
/stritch/cancerbiology/ourpeople/graduatestudents/profiles/ |
| right_column |
203116 |
/stritch/cancerbiology/ourpeople/graduatestudents/profiles/rightcolumn/ |
| Administrative Staff |
189523 |
/stritch/cancerbiology/ourpeople/administrativestaff/ |
| Profiles |
189633 |
/stritch/cancerbiology/ourpeople/administrativestaff/profiles/ |
| right_column |
203118 |
/stritch/cancerbiology/ourpeople/administrativestaff/profiles/rightcolumn/ |
| Recent Graduates |
204321 |
/stritch/cancerbiology/ourpeople/graduatestudents/recentgraduates/ |
| Core Facilities |
189524 |
/stritch/cancerbiology/corefacilities/ |
| Cancer Center |
189531 |
https://www.loyolamedicine.org/clinical-research/ |
| Jill Sandbox |
191269 |
/stritch/cancerbiology/jillsandbox/ |
| Stritch - Cardiovascular Research Institute (CVRI) |
191121 |
/stritch/cvri/ |
| site_logo |
191122 |
/stritch/cvri/sitelogo/ |
| Footer |
191123 |
/stritch/cvri/footer/ |
| cta |
191124 |
/stritch/cvri/cta/ |
| right_column |
191161 |
/stritch/cvri/rightcolumn/ |
| Leadership |
191135 |
/stritch/cvri/leadership/ |
| Profiles |
191283 |
/stritch/cvri/leadership/profiles/ |
| Services |
191139 |
/stritch/cvri/services/ |
| CVRI Research Fellowship |
191140 |
/stritch/cvri/cvriresearchfellowship/ |
| CVRI Mini Grants Program |
191141 |
/stritch/cvri/cvriminigrantsprogram/ |
| Events |
198186 |
/stritch/cvri/events/ |
| Stritch - Cell & Molecular Physiology |
189749 |
/stritch/cellandmolecularphysiology/ |
| site_logo |
189750 |
/stritch/cellandmolecularphysiology/sitelogo/ |
| Footer |
189751 |
/stritch/cellandmolecularphysiology/footer/ |
| cta |
189752 |
/stritch/cellandmolecularphysiology/cta/ |
| social media |
189754 |
/stritch/cellandmolecularphysiology/socialmedia/ |
| Graduate Programs |
190679 |
/stritch/cellandmolecularphysiology/graduateprograms/ |
| Introduction |
190680 |
/stritch/cellandmolecularphysiology/graduateprograms/introduction/ |
| PhD |
190681 |
/stritch/cellandmolecularphysiology/graduateprograms/phd/ |
| MD/PhD |
190682 |
/stritch/cellandmolecularphysiology/graduateprograms/mdphd/ |
| MS |
190683 |
/stritch/cellandmolecularphysiology/graduateprograms/ms/ |
| Financial Aid |
190684 |
/stritch/cellandmolecularphysiology/graduateprograms/financialaid/ |
| Charm |
190692 |
/stritch/cellandmolecularphysiology/charm/ |
| People |
190693 |
/stritch/cellandmolecularphysiology/people/ |
| Faculty |
190694 |
/stritch/cellandmolecularphysiology/people/faculty/ |
| Profiles |
190695 |
/stritch/cellandmolecularphysiology/people/faculty/profiles/ |
| Research/Affiliate Faculty |
190722 |
/stritch/cellandmolecularphysiology/people/researchaffiliatefaculty/ |
| Profiles |
190723 |
/stritch/cellandmolecularphysiology/people/researchaffiliatefaculty/profiles/ |
| Research Associates |
190725 |
/stritch/cellandmolecularphysiology/people/researchassociates/ |
| Profiles |
190726 |
/stritch/cellandmolecularphysiology/people/researchassociates/profiles/ |
| Emeritus Faculty |
190727 |
/stritch/cellandmolecularphysiology/people/emeritusfaculty/ |
| Students |
190728 |
/stritch/cellandmolecularphysiology/people/students/ |
| Profiles |
197602 |
/stritch/cellandmolecularphysiology/people/students/profiles/ |
| Staff |
190730 |
/stritch/cellandmolecularphysiology/people/staff/ |
| Careers |
190731 |
/stritch/cellandmolecularphysiology/people/careers/ |
| Seminars & Events |
190732 |
https://calendar.google.com/calendar/u/0/embed?src=859mfoj0ntgshhf6n7i8g81pio@group.calendar.google.com&ctz=America/Chicago&pli=1 |
| Cardio Surph |
194222 |
/stritch/cellandmolecularphysiology/cardiosurph/ |
| Research |
194226 |
/stritch/cellandmolecularphysiology/research/ |
| News |
203183 |
/stritch/cellandmolecularphysiology/news/ |
| Stritch - Center for Biomedical Informatics |
183997 |
/stritch/cbmi/ |
| site_logo |
184875 |
/stritch/cbmi/sitelogo/ |
| Footer |
184876 |
/stritch/cbmi/footer/ |
| I Links |
184877 |
/stritch/cbmi/ilinks/ |
| Stritch - Center for Community and Global Health (CCGH) |
188505 |
/stritch/ccgh/ |
| site_logo |
188590 |
/stritch/ccgh/sitelogo/ |
| social media |
188593 |
/stritch/ccgh/socialmedia/ |
| cta |
188594 |
/stritch/ccgh/cta/ |
| About Us |
188525 |
/stritch/ccgh/aboutus/ |
| Message from the Director |
188526 |
/stritch/ccgh/aboutus/messagefromthedirector/ |
| Staff |
188527 |
/stritch/ccgh/aboutus/staff/ |
| Profiles |
188599 |
/stritch/ccgh/aboutus/staff/profiles/ |
| right_column |
203108 |
/stritch/ccgh/aboutus/staff/profiles/rightcolumn/ |
| Mission Statement |
188528 |
/stritch/ccgh/aboutus/missionstatement/ |
| Contact Us |
188529 |
/stritch/ccgh/aboutus/contactus/ |
| Programs |
188530 |
/stritch/ccgh/programs/ |
| Honors Program |
188531 |
/stritch/ccgh/programs/honorsprogram/ |
| CCGH Posters |
188778 |
/stritch/ccgh/programs/honorsprogram/ccghposters/ |
| Scholars Program |
188532 |
/stritch/ccgh/programs/scholarsprogram/ |
| Field Experience and Scholarly Project Grants |
188533 |
/stritch/ccgh/programs/fieldexperienceandscholarlyprojectgrants/ |
| Loyola Street Medicine |
188534 |
/stritch/ccgh/programs/loyolastreetmedicine/ |
| Seminar Series |
188536 |
/stritch/ccgh/seminarseries/ |
| Elective Opportunities |
188537 |
/stritch/ccgh/electiveopportunities/ |
| Epidemiology Elective |
188538 |
/stritch/ccgh/electiveopportunities/epidemiologyelective/ |
| International Electives |
188539 |
/stritch/ccgh/electiveopportunities/internationalelectives/ |
| CCGH-403 International Health: Bolivia |
188545 |
/stritch/ccgh/electiveopportunities/internationalelectives/ccgh-403internationalhealthbolivia/ |
| CSGH-406 Santa Clotilde: Peru |
188586 |
/stritch/ccgh/electiveopportunities/internationalelectives/csgh-406santaclotildeperu/ |
| CCGH-407 Kumasi: Ghana |
188587 |
/stritch/ccgh/electiveopportunities/internationalelectives/ccgh-407kumasighana/ |
| Ignatian Service Immersion Elective |
188540 |
/stritch/ccgh/electiveopportunities/ignatianserviceimmersionelective/ |
| Medical Languages |
188541 |
/stritch/ccgh/electiveopportunities/medicallanguages/ |
| Community Engagement |
188543 |
/stritch/ccgh/communityengagement/ |
| Stritch - Central Curricular Authority (CCA) |
189853 |
/stritch/cca/ |
| site_logo |
189854 |
/stritch/cca/sitelogo/ |
| cta |
189856 |
/stritch/cca/cta/ |
| social media |
189858 |
/stritch/cca/socialmedia/ |
| About |
189866 |
/stritch/cca/about/ |
| Mission |
189867 |
/stritch/cca/about/mission/ |
| Membership |
189869 |
/stritch/cca/about/membership/ |
| Sub-committees |
189870 |
/stritch/cca/sub-committees/ |
| Curriculum Year Directors Charge |
189871 |
/stritch/cca/sub-committees/curriculumyeardirectorscharge/ |
| Competency Evaluation and Assessment Review |
189872 |
/stritch/cca/sub-committees/competencyevaluationandassessmentreview/ |
| Evaluation Subcommittee |
189881 |
/stritch/cca/sub-committees/evaluationsubcommittee/ |
| Health Equity in the Curriculum Committee (HECC) |
189882 |
/stritch/cca/sub-committees/healthequityinthecurriculumcommitteehecc/ |
| HECC Reporting |
189884 |
/stritch/cca/sub-committees/healthequityinthecurriculumcommitteehecc/heccreporting/ |
| Longitudinal Outcomes Subcommittee |
189883 |
/stritch/cca/sub-committees/longitudinaloutcomessubcommittee/ |
| SSOM Competencies |
189885 |
/stritch/cca/ssomcompetencies/ |
| Resources |
189889 |
/stritch/cca/resources/ |
| Operational Guidelines |
189890 |
/stritch/cca/resources/operationalguidelines/ |
| Curriculum Inventory |
189891 |
/stritch/cca/resources/curriculuminventory/ |
| Curriculum Map |
189892 |
/stritch/cca/resources/curriculummap/ |
| Course/Clerkship Review Panel Process |
189893 |
/stritch/cca/resources/courseclerkshipreviewpanelprocess/ |
| Meeting Minutes |
189894 |
/stritch/cca/resources/meetingminutes/ |
| Course/Clerkship Director Responsibilities |
189895 |
/stritch/cca/resources/courseclerkshipdirectorresponsibilities/ |
| Course/Clerkship Committee Operational Guidelines |
189896 |
/stritch/cca/resources/courseclerkshipcommitteeoperationalguidelines/ |
| Policies |
189897 |
/stritch/cca/resources/policies/ |
| Contact Us |
189898 |
/stritch/cca/contactus/ |
| Stritch - Continuing Medical Education (CME) |
184000 |
/stritch/cme/ |
| site_logo |
188879 |
/stritch/cme/sitelogo/ |
| Footer |
188880 |
/stritch/cme/footer/ |
| cta |
188881 |
/stritch/cme/cta/ |
| social media |
189128 |
/stritch/cme/socialmedia/ |
| Your CME Tracker |
189019 |
/stritch/cme/yourcmetracker/ |
| Current CME Opportunities |
189020 |
/stritch/cme/yourcmetracker/currentcmeopportunities/ |
| CME Tracker Guides |
189021 |
/stritch/cme/yourcmetracker/cmetrackerguides/ |
| Plan An Activity |
184004 |
/stritch/cme/plananactivity/ |
| Process |
189046 |
/stritch/cme/plananactivity/process/ |
| Course Planners |
189050 |
/stritch/cme/plananactivity/process/courseplanners/ |
| Speakers |
189051 |
/stritch/cme/plananactivity/process/speakers/ |
| Link to CME Activity Application |
189052 |
/stritch/cme/plananactivity/process/linktocmeactivityapplication/ |
| Resources |
184003 |
/stritch/cme/resources/ |
| ACCME |
189047 |
/stritch/cme/resources/accme/ |
| Illinois Physician License Requirements |
189048 |
/stritch/cme/resources/illinoisphysicianlicenserequirements/ |
| Nursing and Other Healthcare Professionals |
189049 |
/stritch/cme/resources/nursingandotherhealthcareprofessionals/ |
| Faculty Development |
184001 |
/stritch/cme/facultydevelopment/ |
| MOC |
189017 |
/stritch/cme/moc/ |
| Contact Us |
195869 |
/stritch/cme/contactus/ |
| FAQ |
184005 |
/stritch/cme/faq/ |
| Frequently Asked Questions |
184006 |
/stritch/cme/faq/frequentlyaskedquestions/ |
| Stritch - Department of Medical Education (DOME) |
192031 |
/stritch/meded/ |
| site_logo |
192032 |
/stritch/meded/sitelogo/ |
| cta |
192034 |
/stritch/meded/cta/ |
| I Links |
192035 |
/stritch/meded/ilinks/ |
| social media |
192036 |
/stritch/meded/socialmedia/ |
| About Us |
194204 |
/stritch/meded/aboutus/ |
| Directory |
192069 |
/stritch/meded/aboutus/directory/ |
| Profiles |
192070 |
/stritch/meded/aboutus/directory/profiles/ |
| Upcoming Events |
192071 |
/stritch/meded/aboutus/upcomingevents/ |
| Welcome Message |
192087 |
/stritch/meded/welcomemessage/ |
| Graduate Education |
201801 |
/stritch/meded/graduateeducation/ |
| Master in Health Professions Education |
201802 |
/stritch/meded/graduateeducation/masterinhealthprofessionseducation/ |
| Certificate Programs |
192072 |
/stritch/meded/certificateprograms/ |
| Certificate Programs Registration |
192073 |
/stritch/meded/certificateprograms/certificateprogramsregistration/ |
| Thank You |
193746 |
/stritch/meded/certificateprograms/certificateprogramsregistration/thankyou/ |
| Medical Education |
192074 |
/stritch/meded/medicaleducation/ |
| Medical Education Electives |
192075 |
/stritch/meded/medicaleducation/medicaleducationelectives/ |
| Academic Medicine Interest Group |
192077 |
/stritch/meded/medicaleducation/academicmedicineinterestgroup/ |
| Scholarship |
192078 |
/stritch/meded/scholarship/ |
| Publications and Presentations |
192079 |
/stritch/meded/scholarship/publicationsandpresentations/ |
| York Scholarship |
192081 |
/stritch/meded/scholarship/yorkscholarship/ |
| Past Awardees |
192086 |
/stritch/meded/scholarship/yorkscholarship/pastawardees/ |
| CITE Grant |
192083 |
/stritch/meded/scholarship/citegrant/ |
| Past Awardees |
192084 |
/stritch/meded/scholarship/citegrant/pastawardees/ |
| Office of Educational Affairs |
193735 |
/stritch/meded/officeofeducationalaffairs/ |
| Stritch - Emergency Medicine |
94304 |
/stritch/emergency-medicine/ |
| site_logo |
202552 |
/stritch/emergency-medicine/sitelogo/ |
| Footer |
202553 |
/stritch/emergency-medicine/footer/ |
| social media |
202556 |
/stritch/emergency-medicine/socialmedia/ |
| I Links |
202554 |
/stritch/emergency-medicine/ilinks/ |
| Divisions / Specialties |
94314 |
/stritch/emergency-medicine/divisionsspecialties/ |
| Sports Medicine |
94566 |
/stritch/emergency-medicine/divisionsspecialties/sportsmedicine/ |
| Jolie Holschen, MD, FACEP |
94571 |
/stritch/emergency-medicine/divisionsspecialties/sportsmedicine/jolieholschenmdfacep/ |
| Emergency Medical Services |
95303 |
/stritch/emergency-medicine/divisionsspecialties/emergencymedicalservices/ |
| Education |
94315 |
/stritch/emergency-medicine/education/ |
| Ultrasound Elective |
94574 |
/stritch/emergency-medicine/education/ultrasoundelective/ |
| Medical Toxicology Elective |
94575 |
/stritch/emergency-medicine/education/medicaltoxicologyelective/ |
| Pediatric Emergency Medicine Elective |
94576 |
/stritch/emergency-medicine/education/pediatricemergencymedicineelective/ |
| Research |
94316 |
/stritch/emergency-medicine/research/ |
| Faculty |
94317 |
/stritch/emergency-medicine/faculty/ |
| Profiles |
94318 |
/stritch/emergency-medicine/faculty/profiles/ |
| Services |
94323 |
https://www.loyolamedicine.org/emergency-medicine-trauma |
| Stritch - Family Medicine |
92706 |
/stritch/fammed/ |
| site_logo |
202609 |
/stritch/fammed/sitelogo/ |
| Footer |
202610 |
/stritch/fammed/footer/ |
| social media |
202611 |
/stritch/fammed/socialmedia/ |
| cta |
202612 |
/stritch/fammed/cta/ |
| I Links |
202613 |
/stritch/fammed/ilinks/ |
| About |
92722 |
/stritch/fammed/about/ |
| Medical Students |
92723 |
/stritch/fammed/about/medicalstudents/ |
| Electives |
92725 |
/stritch/fammed/about/medicalstudents/electives/ |
| Clerkship Program |
202628 |
/stritch/fammed/about/medicalstudents/clerkshipprogram/ |
| Contact Us |
93124 |
/stritch/fammed/about/contactus/ |
| Faculty |
92718 |
/stritch/fammed/faculty/ |
| profiles |
92720 |
/stritch/fammed/faculty/profiles/ |
| Research |
92717 |
/stritch/fammed/research/ |
| Services |
92721 |
https://www.loyolamedicine.org/primary-care/family-medicine |
| Stritch - Genomics |
191710 |
/stritch/genomics/ |
| site_logo |
191711 |
/stritch/genomics/sitelogo/ |
| Footer |
191712 |
/stritch/genomics/footer/ |
| cta |
191713 |
/stritch/genomics/cta/ |
| social media |
191715 |
/stritch/genomics/socialmedia/ |
| modules-programming |
191716 |
/stritch/genomics/modules-programming/ |
| Services and Prices |
191692 |
/stritch/genomics/servicesandprices/ |
| Submit Samples |
191693 |
/stritch/genomics/submitsamples/ |
| About |
191723 |
/stritch/genomics/about/ |
| Projects and Publications |
191725 |
/stritch/genomics/about/projectsandpublications/ |
| Staff |
191726 |
/stritch/genomics/about/staff/ |
| Resources |
191727 |
/stritch/genomics/resources/ |
| Information Videos |
191728 |
/stritch/genomics/resources/informationvideos/ |
| Genomics Glossary |
191729 |
/stritch/genomics/resources/genomicsglossary/ |
| FAQS |
191730 |
/stritch/genomics/resources/faqs/ |
| Stritch - Graduate School |
189664 |
/stritch/graduateschool/ |
| IPBS PhD tracks |
181367 |
/stritch/graduateschool/ipbsphdtracks/ |
| PhD in Biochemistry, Molecular and Cancer Biology |
184907 |
/stritch/graduateschool/ipbsphdtracks/phdinbiochemistrymolecularandcancerbiology/ |
| PhD in Neuroscience |
190469 |
/stritch/graduateschool/ipbsphdtracks/phdinneuroscience/ |
| PhD in Molecular Pharmacology & Therapeutics |
190480 |
/stritch/graduateschool/ipbsphdtracks/phdinmolecularpharmacologytherapeutics/ |
| PhD in Integrative Cell Biology |
190481 |
/stritch/graduateschool/ipbsphdtracks/phdinintegrativecellbiology/ |
| PhD in Cell & Molecular Physiology |
190489 |
/stritch/graduateschool/ipbsphdtracks/phdincellmolecularphysiology/ |
| PhD in Microbiology and Immunology |
195163 |
/stritch/microbio/ourprograms/phdprogram/ |
| site_logo |
189704 |
/stritch/graduateschool/sitelogo/ |
| Footer |
189705 |
/stritch/graduateschool/footer/ |
| social media |
189747 |
/stritch/graduateschool/socialmedia/ |
| cta |
189748 |
/stritch/graduateschool/cta/ |
| About Us |
189668 |
/stritch/graduateschool/aboutus/ |
| Administration |
189670 |
/stritch/graduateschool/aboutus/administration/ |
| Profiles |
189742 |
/stritch/graduateschool/aboutus/administration/profiles/ |
| Contact Us |
189671 |
/stritch/graduateschool/aboutus/contactus/ |
| Admissions |
189682 |
/stritch/graduateschool/admissions/ |
| Requirements |
189683 |
/stritch/education/graduateprograms/ |
| Financial Aid |
189684 |
/stritch/education/graduateprograms/ |
| MS in Pharmacology and MBA Dual Degree Program |
81940 |
/pharmacology/programs/ms-mba/ |
| asides |
82000 |
/pharmacology/programs/ms-mba/asides/ |
| Curriculum |
189685 |
/stritch/graduateschool/curriculum/ |
| Overview |
189686 |
/stritch/graduateschool/curriculum/overview/ |
| IPBS Core Curriculum |
189687 |
/stritch/graduateschool/ipbsphdtracks/ |
| Biomedical Science Electives |
189688 |
/stritch/graduateschool/curriculum/biomedicalscienceelectives/ |
| Student Resources |
189690 |
/stritch/graduateschool/studentresources/ |
| Academic Calendar |
189681 |
/stritch/graduateschool/studentresources/academiccalendar/ |
| Important Deadlines |
189691 |
/stritch/graduateschool/studentresources/importantdeadlines/ |
| Thesis and Dissertation FAQ |
189740 |
/stritch/graduateschool/studentresources/thesisanddissertationfaq/ |
| Degree Conferral Checklist for Graduate Students |
194608 |
/stritch/graduateschool/studentresources/degreeconferralchecklistforgraduatestudents/ |
| Transportation |
203895 |
/stritch/graduateschool/studentresources/transportation/ |
| right_column |
191235 |
/stritch/graduateschool/rightcolumn/ |
| Masters in Cellular and Molecular Oncology |
181370 |
/stritch/graduateschool/mastersincellularandmolecularoncology/ |
| Masters in Cell and Molecular Physiology |
181369 |
/stritch/graduateschool/mastersincellandmolecularphysiology/ |
| Masters in Infectious Disease and Immunology |
181372 |
/stritch/graduateschool/mastersininfectiousdiseaseandimmunology/ |
| Masters in Integrative Cell Biology |
181373 |
/stritch/graduateschool/mastersinintegrativecellbiology/ |
| Masters in Medical Physiology |
181374 |
/stritch/graduateschool/mastersinmedicalphysiology/ |
| Super Resolution Microscope |
192184 |
/stritch/graduateschool/superresolutionmicroscope/ |
| Masters in Biochemistry and Molecular Biology |
181368 |
/stritch/graduateschool/mastersinbiochemistryandmolecularbiology/ |
| Masters in Molecular Pharmacology and Therapeutics |
181376 |
/stritch/graduateschool/mastersinmolecularpharmacologyandtherapeutics/ |
| Masters in Neuroscience |
181375 |
/stritch/graduateschool/mastersinneuroscience/ |
| Certificate in Pharmacovigilance |
185430 |
https://www.luc.edu/stritch/molecularpharmacologyandneuroscience/ourprograms/pharmacovigilancecertificate/ |
| MS/MBA in Molecular Pharmacology and Therapeutics |
189868 |
https://www.luc.edu/quinlan/academics/graduatedegrees/dualdegrees/mbamspinpharmacology/ |
| Masters in Microbiology and Immunology |
190207 |
/stritch/graduateschool/mastersinmicrobiologyandimmunology/ |
| Graduate Student Council |
191275 |
/stritch/graduateschool/graduatestudentcouncil/ |
| 2024 Biochemistry, Molecular, and Cancer Biology Retreat |
197959 |
/stritch/graduateschool/biochemistry-molecular-cancer-biology-retreat/ |
| St. Albert's Day 2024 |
199704 |
/stritch/graduateschool/stalbertsday2024/ |
| Loyola University Chicago Research Uncovers New Antiviral Targets |
200884 |
/stritch/graduateschool/loyola-university-chicago-research-uncovers-new-antiviral-targets/ |
| Chanpreet Kaur wins Predoctoral Fellowship from American Heart Association |
201331 |
/stritch/graduateschool/chanpreetkaurwinspredoctoralfellowshipfromamericanheartassociation/ |
| Researchers Uncover New Role for Transcription Factor in Castration-Resistant Prostate Cancer |
202956 |
/stritch/graduateschool/researchersuncovernewrolefortranscriptionfactorincastration-resistantprostatecancer/ |
| Women in Science (WINS) |
203161 |
/stritch/graduateschool/womeninsciencewins/ |
| Neuroscience & Biochemistry Graduate Programs Earn Top National Rankings |
203968 |
/stritch/graduateschool/neurosciencebiochemistrygraduateprogramsearntopnationalrankings/ |
| St. Albert's Day 2025 |
205308 |
/stritch/graduateschool/stalbertsday2025/ |
| Stritch - Infectious Disease & Immunology Research Institute (INDIRI) |
192186 |
/stritch/indiri/ |
| site_logo |
192187 |
/stritch/indiri/sitelogo/ |
| Footer |
192188 |
/stritch/indiri/footer/ |
| cta |
192189 |
/stritch/indiri/cta/ |
| social media |
192191 |
/stritch/indiri/socialmedia/ |
| About Us |
192198 |
/stritch/indiri/aboutus/ |
| News |
192199 |
/stritch/indiri/aboutus/news/ |
| Contact Us |
192200 |
/stritch/indiri/aboutus/contactus/ |
| Graduate Program |
192235 |
/stritch/indiri/graduateprogram/ |
| Curriculum |
192236 |
/stritch/indiri/graduateprogram/curriculum/ |
| Research |
192237 |
/stritch/indiri/graduateprogram/research/ |
| Frequently Asked Questions |
192238 |
/stritch/indiri/graduateprogram/frequentlyaskedquestions/ |
| Tuition |
192239 |
/stritch/indiri/graduateprogram/tuition/ |
| People |
192270 |
/stritch/indiri/people/ |
| Faculty |
192271 |
/stritch/indiri/people/faculty/ |
| Profiles |
207134 |
/stritch/indiri/people/faculty/profiles/ |
| right_column |
207137 |
/stritch/indiri/people/faculty/profiles/rightcolumn/ |
| Current Students |
192240 |
/stritch/indiri/graduateprogram/currentstudents/ |
| profiles |
192242 |
/stritch/indiri/people/currentstudents/profiles/ |
| right_column |
207140 |
/stritch/indiri/people/currentstudents/profiles/rightcolumn/ |
| Stritch - LUEREC |
191292 |
/stritch/luerec/ |
| site_logo |
191293 |
/stritch/luerec/sitelogo/ |
| Footer |
191294 |
/stritch/luerec/footer/ |
| cta |
191295 |
/stritch/luerec/cta/ |
| social media |
191297 |
/stritch/luerec/socialmedia/ |
| Administrative |
191304 |
/stritch/luerec/administrative/ |
| L.A.U.D. |
191307 |
/stritch/luerec/administrative/laud/ |
| Application Information |
201000 |
/stritch/luerec/administrative/laud/applicationinformation/ |
| Trainee Publications |
201001 |
/stritch/luerec/administrative/laud/traineepublications/ |
| Trainee Presentations |
201002 |
/stritch/luerec/administrative/laud/traineepresentations/ |
| LUEREC Monthly Meetings |
191305 |
/stritch/luerec/administrative/luerecmonthlymeetings/ |
| Publications & Abstracts |
191310 |
/stritch/luerec/publicationsabstracts/ |
| Publications |
191311 |
/stritch/luerec/publicationsabstracts/publications/ |
| Abstracts |
191312 |
/stritch/luerec/publicationsabstracts/abstracts/ |
| Presentations |
191319 |
/stritch/luerec/presentations/ |
| Funding |
191321 |
/stritch/luerec/funding/ |
| Resources |
191324 |
/stritch/luerec/resources/ |
| Honors |
191326 |
/stritch/luerec/resources/honors/ |
| Collaborations & Partner Sites |
191327 |
/stritch/luerec/resources/collaborationspartnersites/ |
| Stritch - MD/PhD Program |
188015 |
/stritch/mdphd/ |
| site_logo |
188016 |
/stritch/mdphd/sitelogo/ |
| Footer |
188017 |
/stritch/mdphd/footer/ |
| cta |
188018 |
/stritch/mdphd/cta/ |
| social media |
188020 |
/stritch/mdphd/socialmedia/ |
| Program Description |
188035 |
/stritch/mdphd/programdescription/ |
| Overview |
188036 |
/stritch/mdphd/programdescription/overview/ |
| Publications from Physician-Scientists-in-Training |
188075 |
/stritch/mdphd/programdescription/publicationsfromphysician-scientists-in-training/ |
| Alumni Success |
188167 |
/stritch/mdphd/programdescription/alumnisuccess/ |
| Prospective Students |
188037 |
/stritch/mdphd/prospectivestudents/ |
| Requirements |
188038 |
/stritch/mdphd/prospectivestudents/requirements/ |
| Admissions Process |
188039 |
/stritch/mdphd/prospectivestudents/admissionsprocess/ |
| Financial Aid |
188040 |
/stritch/mdphd/prospectivestudents/financialaid/ |
| Current Students |
188041 |
/stritch/mdphd/currentstudents/ |
| Timeline |
188042 |
/stritch/mdphd/currentstudents/timeline/ |
| The Graduate School |
188108 |
https://ssom.luc.edu/graduate_school/aboutus/introduction/ |
| Meet the Next Generation of Physician-Scientists |
188065 |
/stritch/mdphd/currentstudents/meetthenextgenerationofphysician-scientists/ |
| Student Resources |
188066 |
/stritch/studentlife/officeofstudentaffairs/ |
| Research Spotlight |
207585 |
/stritch/mdphd/currentstudents/researchspotlight/ |
| Contact Us |
188067 |
/stritch/mdphd/contactus/ |
| Medical Student Union (MSU) |
183860 |
/stritch/loyolamsu/index.shtml |
| site_logo |
202379 |
/stritch/loyolamsu/sitelogo/ |
| Footer |
184869 |
/stritch/loyolamsu/footer/ |
| I Links |
184872 |
/stritch/loyolamsu/ilinks/ |
| social media |
184873 |
/stritch/loyolamsu/socialmedia/ |
| Medical Student Union |
184870 |
/stritch/loyolamsu/medicalstudentunion/ |
| SSOM Medical Student Union |
184868 |
/stritch/loyolamsu/ssommedicalstudentunion/ |
| Class Boards |
183863 |
/stritch/loyolamsu/classboards/ |
| Student Organizations |
183935 |
/stritch/loyolamsu/studentorganizations/ |
| Wilderness Medicine Interest Group (WMIG) |
183907 |
/stritch/loyolamsu/studentorganizations/wmig/ |
| Academic Medicine Interest Group (AMIG) |
183937 |
/stritch/loyolamsu/studentorganizations/amig/index.shtml |
| Addiction Medicine Interest Group (AddMed) |
197632 |
/stritch/loyolamsu/studentorganizations/addmed/ |
| Aerospace Medicine Interest Group (AeroMedIG) |
197972 |
/stritch/loyolamsu/studentorganizations/aeromedig/index.shtml |
| Albanian American Medical Student Society (AAMSS) |
183977 |
/stritch/loyolamsu/studentorganizations/aamss/ |
| American Medical Association (AMA) |
183864 |
/stritch/loyolamsu/studentorganizations/ama/ |
| American Medical Women's Association (AMWA) |
183914 |
/stritch/loyolamsu/studentorganizations/amwa/ |
| American Physician Scientists Association (APSA) |
197098 |
/stritch/loyolamsu/studentorganizations/apsa/index.shtml |
| Anesthesiology Interest Group (AIG) |
183888 |
/stritch/loyolamsu/studentorganizations/aig/ |
| Asian Pacific American Medical Student Association (APAMSA) |
183866 |
/stritch/loyolamsu/studentorganizations/apamsa/ |
| Association of Women Surgeons (AWS) |
190420 |
/stritch/loyolamsu/studentorganizations/aws/ |
| ATC Clinic Health Coaching Program |
183920 |
/stritch/loyolamsu/studentorganizations/atcclinichealthcoachingprogram/ |
| Back on My Feet |
183940 |
/stritch/loyolamsu/studentorganizations/backonmyfeet/ |
| Beyond Hunger Blood Pressure (BHBP) |
187330 |
/stritch/loyolamsu/studentorganizations/bhbp/ |
| Bone Marrow Transplant Awareness Group (BMTAG) |
183936 |
/stritch/loyolamsu/studentorganizations/bonemarrowtransplantawarenessgroupbmtag/ |
| Cardiothoracic Surgery Interest Group (CTSIG) |
183950 |
/stritch/loyolamsu/studentorganizations/ctsig/ |
| Cardiovascular Interest Group (CVIG) |
183890 |
/stritch/loyolamsu/studentorganizations/cvig/ |
| Christian Medical and Dental Association (CMDA) |
183869 |
/stritch/loyolamsu/studentorganizations/cmda/ |
| CommunityHealth - Primary Care Clinic (CHC) |
183870 |
/stritch/loyolamsu/studentorganizations/chc/ |
| Culture in Medicine (CiM) |
183941 |
/stritch/loyolamsu/studentorganizations/cim/ |
| Cuneo Art Initiative |
187331 |
/stritch/loyolamsu/studentorganizations/cuneoartinitiative/ |
| DAC Med (Disability Advocacy Coalition in Medicine) |
183986 |
/stritch/loyolamsu/studentorganizations/dacmed/ |
| Data Science & Medicine (DSM) |
183961 |
/stritch/loyolamsu/studentorganizations/dsm/ |
| Dermatology Interest Group (DIG) |
183891 |
/stritch/loyolamsu/studentorganizations/dig/ |
| Emergency Medicine Interest Group (EMIG) |
183892 |
/stritch/loyolamsu/studentorganizations/emig/ |
| ENRICH Urban Farming and Gardening |
183933 |
/stritch/loyolamsu/studentorganizations/enrichurbanfarmingandgardening/ |
| Family Medicine Interest Group (FMIG) |
183893 |
/stritch/loyolamsu/studentorganizations/fmig/ |
| FGLI (First-Generation, Low-Income) Support Committee |
183974 |
/stritch/loyolamsu/studentorganizations/fgli/ |
| Fresh Start |
183947 |
/stritch/loyolamsu/studentorganizations/freshstart/ |
| Gastroenterology Interest Group |
183989 |
/stritch/loyolamsu/studentorganizations/gastroenterologyinterestgroup/ |
| Geriatrics Interest Group |
197970 |
/stritch/loyolamsu/studentorganizations/gig/ |
| Global Surgery Student Alliance (GSSA) |
197971 |
/stritch/loyolamsu/studentorganizations/gssa/ |
| Group for Environmental Medicine and Sustainability (GEMS) |
183967 |
/stritch/loyolamsu/studentorganizations/gems/ |
| Healing Notes |
183922 |
/stritch/loyolamsu/studentorganizations/healingnotes/ |
| Health Career Collaborative (HCC) |
183968 |
/stritch/loyolamsu/studentorganizations/hcc/ |
| Health in Movement (HiM) |
197961 |
/stritch/loyolamsu/studentorganizations/him/index.shtml |
| Health Professionals Recruitment and Exposure Program (HPREP) |
183959 |
/stritch/loyolamsu/studentorganizations/hprep/ |
| Hematology/Oncology Interest Group (HemOncIG) |
183898 |
/stritch/loyolamsu/studentorganizations/hemoncig/ |
| Immigrant Health Committee (IHC) |
183975 |
/stritch/loyolamsu/studentorganizations/ihc/ |
| Internal Medicine Interest Group (IMIG) |
183909 |
/stritch/loyolamsu/studentorganizations/imig/ |
| Interventional Radiology Interest Group (IRIG) |
201594 |
/stritch/loyolamsu/studentorganizations/wmig/ |
| Iranian American Medical Association (IAMA) |
183965 |
/stritch/loyolamsu/studentorganizations/iama/ |
| Jewish Student Association (JSA) |
183873 |
/stritch/loyolamsu/studentorganizations/jsa/ |
| Latino Medical Student Association (LMSA) |
183876 |
/stritch/loyolamsu/studentorganizations/lmsa/ |
| LUC Mentors |
187332 |
/stritch/loyolamsu/studentorganizations/lucmentors/ |
| Maywood Fine Arts Student Association (MFASA) |
183927 |
/stritch/loyolamsu/studentorganizations/mfastudentassociation/ |
| Medical Arabic |
183984 |
/stritch/loyolamsu/studentorganizations/medicalarabic/ |
| Medical Association Guided by Ignatian Spirituality (MAGIS) |
187333 |
/stritch/loyolamsu/studentorganizations/medicalassociationguidedbyignatianspiritualitymagis/ |
| Medical Chinese |
183982 |
/stritch/loyolamsu/studentorganizations/medicalchinese/ |
| Medical Hindi & Urdu |
197976 |
/stritch/loyolamsu/studentorganizations/mhu/ |
| Medical Polish/Polish American Medical Student Society (PAMSS) |
183930 |
/stritch/loyolamsu/studentorganizations/mppamss/ |
| Medical Spanish |
183931 |
/stritch/loyolamsu/studentorganizations/medicalspanish/ |
| Medicus Podcast |
183969 |
/stritch/loyolamsu/studentorganizations/medicuspodcast/ |
| Mental Illness & Neurological Disease (MIND) |
183896 |
/stritch/loyolamsu/studentorganizations/mind/ |
| Military Medicine and HPSP Interest Group (MMIG) |
197629 |
/stritch/loyolamsu/studentorganizations/mmig/index.shtml |
| Muslim Medical Student Association (MMSA) |
183877 |
/stritch/loyolamsu/studentorganizations/mmsa/ |
| Natural Ties |
183978 |
/stritch/loyolamsu/studentorganizations/naturalties/ |
| Neighborhood Health Initiative (NHI) |
183956 |
/stritch/loyolamsu/studentorganizations/nhi/ |
| Neonatology Interest Group |
183897 |
/stritch/loyolamsu/studentorganizations/neonatologyinterestgroup/ |
| Neurological Surgery Interest Group (NSIG) |
183943 |
/stritch/loyolamsu/studentorganizations/nsig/ |
| New Life Volunteering Society (NLVS) |
183878 |
/stritch/loyolamsu/studentorganizations/nlvs/ |
| Nutrition in Medicine (NiM) |
183921 |
/stritch/loyolamsu/studentorganizations/nim/ |
| One Medicine Interest Group (OMIG) |
197041 |
/stritch/loyolamsu/studentorganizations/omig/index.shtml |
| Ophthalmology Interest Group (OIG) |
183916 |
/stritch/loyolamsu/studentorganizations/oig/ |
| Orthopaedic Surgery Interest Group (OSIG) |
183899 |
/stritch/loyolamsu/studentorganizations/osig/ |
| Otolaryngology (ENT) Interest Group |
183924 |
/stritch/loyolamsu/studentorganizations/otolaryngologyentinterestgroup/ |
| Pediatrics Interest Group (PIG) |
183900 |
/stritch/loyolamsu/studentorganizations/pig/ |
| Perinatal Partners |
203958 |
/stritch/loyolamsu/studentorganizations/ama/ |
| Physical Medicine and Rehabilitation (PM&R) Interest Group |
183957 |
/stritch/loyolamsu/studentorganizations/physicalmedicineandrehabilitationpmrinterestgroup/ |
| Physicians for Human Rights (PHR) |
183952 |
/stritch/loyolamsu/studentorganizations/phr/ |
| Plastic Surgery Interest Group (PSIG) |
183970 |
/stritch/loyolamsu/studentorganizations/psig/ |
| Project Cure Club (PCC) |
187334 |
/stritch/loyolamsu/studentorganizations/pcc/ |
| Proviso United with Loyola Students for Educational Enrichment (PULSE) |
183882 |
/stritch/loyolamsu/studentorganizations/pulse/ |
| Quinn Center Student Outreach (QCSO) |
183938 |
/stritch/loyolamsu/studentorganizations/qcso/ |
| Radiation Oncology Interest Group (RadOncIG) |
183929 |
/stritch/loyolamsu/studentorganizations/radoncig/ |
| Radiology Interest Group (RIG) |
183901 |
/stritch/loyolamsu/studentorganizations/rig/ |
| Ruth Jackson Orthopaedic Society (RJOS) |
197628 |
/stritch/loyolamsu/studentorganizations/rjos/index.shtml |
| She's The First (STF) |
183963 |
/stritch/loyolamsu/studentorganizations/stf/ |
| Society of Obstetrics and Gynecology (SOG) |
183902 |
/stritch/loyolamsu/studentorganizations/sog/ |
| South Asian Medical Student Association (SAMSA) |
183915 |
/stritch/loyolamsu/studentorganizations/samsa/ |
| Special Olympics Loyola |
183988 |
/stritch/loyolamsu/studentorganizations/specialolympicsloyola/ |
| Sports Medicine Interest Group (SMIG) |
183910 |
/stritch/loyolamsu/studentorganizations/smig/ |
| Stritch Basketball Association |
203909 |
/stritch/loyolamsu/studentorganizations/stritchbasketballassociation/ |
| Stritch Coaching Initiative |
201377 |
/stritch/loyolamsu/studentorganizations/wmig/ |
| Stritch Golfer's Association (SGA) |
187335 |
/stritch/loyolamsu/studentorganizations/sga/ |
| Stritch Homelessness Outreach Coalition (SHOC) |
183985 |
/stritch/loyolamsu/studentorganizations/shoc/ |
| Stritch Peer Mentorship Committee (SPMC) |
197627 |
/stritch/loyolamsu/studentorganizations/spmc/index.shtml |
| Stritch Pickleball Association |
187336 |
/stritch/loyolamsu/studentorganizations/spa/ |
| Stritch Pride |
183917 |
/stritch/loyolamsu/studentorganizations/stritchpride/ |
| Stritch Speech and Debate Team (SSDT) |
197960 |
/stritch/loyolamsu/studentorganizations/ssdt/index.shtml |
| Stritch Stitches |
201372 |
/stritch/loyolamsu/studentorganizations/wmig/ |
| Stritch Tri Sports |
197905 |
/stritch/loyolamsu/studentorganizations/sts/ |
| Student Interest Group for Neurology (SIGN) |
183903 |
/stritch/loyolamsu/studentorganizations/sign/ |
| Student National Medical Association (SNMA) |
183885 |
/stritch/loyolamsu/studentorganizations/snma/ |
| Student Wellness Advisory Group (SWAG) |
183919 |
/stritch/loyolamsu/studentorganizations/swag/ |
| Students Advising Students (SAS) |
183886 |
/stritch/loyolamsu/studentorganizations/sas/ |
| Students Against Gun Violence (SAGV) |
201586 |
/stritch/loyolamsu/studentorganizations/addmed/ |
| Students Curious in Outrageous Pathology Experiences (SCOPE) |
183944 |
/stritch/loyolamsu/studentorganizations/scope/ |
| Students for a National Health Program (SNaHP) |
200124 |
/stritch/loyolamsu/studentorganizations/snahp/ |
| Surgery Interest Group (SIG) |
183904 |
/stritch/loyolamsu/studentorganizations/sig/ |
| Syrian American Medical Society (SAMS) |
203964 |
/stritch/loyolamsu/studentorganizations/wmig/ |
| Ultrasound Interest Group (USIG) |
183925 |
/stritch/loyolamsu/studentorganizations/usig/ |
| Urology Interest Group (UIG) |
183906 |
/stritch/loyolamsu/studentorganizations/uig/ |
| Vascular Surgery Interest Group (VSIG) |
183918 |
/stritch/loyolamsu/studentorganizations/vsig/ |
| Walks of Life |
187337 |
/stritch/loyolamsu/studentorganizations/walksoflife/ |
| Resources |
183994 |
/stritch/loyolamsu/resources/index.shtml |
| Cafeteria/Coffee hours on campus |
183995 |
/stritch/loyolamsu/resources/cafeteriacoffeehoursoncampus/ |
| Calendars |
183861 |
/stritch/loyolamsu/resources/calendars/ |
| Stritch - Medicine |
88374 |
/stritch/medicine/ |
| site_logo |
202557 |
/stritch/medicine/sitelogo/ |
| Footer |
202558 |
/stritch/medicine/footer/ |
| social media |
202560 |
/stritch/medicine/socialmedia/ |
| About |
202563 |
/stritch/medicine/about/ |
| Divisions and Specialties |
88380 |
/stritch/medicine/divisionsandspecialties/ |
| Cardiology |
88410 |
/stritch/medicine/divisionsandspecialties/cardiology/ |
| right_column |
202576 |
/stritch/medicine/divisionsandspecialties/cardiology/profiles/rightcolumn/ |
| Dermatology |
88411 |
/stritch/medicine/divisionsandspecialties/dermatology/ |
| profiles |
202566 |
/stritch/medicine/divisionsandspecialties/dermatology/profiles/ |
| right_column |
202577 |
/stritch/medicine/divisionsandspecialties/dermatology/profiles/rightcolumn/ |
| Endocrinology & Metabolism |
88412 |
/stritch/medicine/divisionsandspecialties/endocrinologymetabolism/ |
| profiles |
202568 |
/stritch/medicine/divisionsandspecialties/endocrinologymetabolism/profiles/ |
| right_column |
202578 |
/stritch/medicine/divisionsandspecialties/endocrinologymetabolism/profiles/rightcolumn/ |
| Gastroenterology & Nutrition |
88413 |
/stritch/medicine/divisionsandspecialties/gastroenterologynutrition/ |
| profiles |
202572 |
/stritch/medicine/divisionsandspecialties/gastroenterologynutrition/profiles/ |
| right_column |
202579 |
/stritch/medicine/divisionsandspecialties/gastroenterologynutrition/profiles/rightcolumn/ |
| Hematology & Oncology |
88415 |
/stritch/medicine/divisionsandspecialties/hematologyoncology/ |
| profiles |
202573 |
/stritch/medicine/divisionsandspecialties/hematologyoncology/profiles/ |
| right_column |
202580 |
/stritch/medicine/divisionsandspecialties/hematologyoncology/profiles/rightcolumn/ |
| Hepatology |
88417 |
/stritch/medicine/divisionsandspecialties/hepatology/ |
| profiles |
202581 |
/stritch/medicine/divisionsandspecialties/hepatology/profiles/ |
| Hospital Medicine |
88418 |
/stritch/medicine/divisionsandspecialties/hospitalmedicine/ |
| profiles |
202583 |
/stritch/medicine/divisionsandspecialties/hospitalmedicine/profiles/ |
| Infectious Diseases |
88419 |
/stritch/medicine/divisionsandspecialties/infectiousdiseases/ |
| profiles |
202592 |
/stritch/medicine/divisionsandspecialties/infectiousdiseases/profiles/ |
| Nephrology & Hypertension |
88420 |
/stritch/medicine/divisionsandspecialties/nephrologyhypertension/ |
| profiles |
202590 |
/stritch/medicine/divisionsandspecialties/nephrologyhypertension/profiles/ |
| Pulmonary & Critical Care Medicine |
88421 |
/stritch/medicine/divisionsandspecialties/pulmonarycriticalcaremedicine/ |
| profiles |
202587 |
/stritch/medicine/divisionsandspecialties/pulmonarycriticalcaremedicine/profiles/ |
| Rheumatology/Allergy & Immunology |
88422 |
/stritch/medicine/divisionsandspecialties/rheumatologyallergyimmunology/ |
| profiles |
202585 |
/stritch/medicine/divisionsandspecialties/rheumatologyallergyimmunology/profiles/ |
| Stritch - Microbiology and Immunology |
190907 |
/stritch/microbio/ |
| site_logo |
190908 |
/stritch/microbio/sitelogo/ |
| Footer |
190909 |
/stritch/microbio/footer/ |
| cta |
190910 |
/stritch/microbio/cta/ |
| I Links |
190911 |
/stritch/microbio/ilinks/ |
| social media |
190912 |
/stritch/microbio/socialmedia/ |
| About Us |
190914 |
/stritch/microbio/aboutus/ |
| Message from the Chair |
190925 |
/stritch/microbio/aboutus/messagefromthechair/ |
| News |
190924 |
/stritch/microbio/aboutus/news/ |
| Resources |
190923 |
/stritch/microbio/aboutus/resources/ |
| Donate |
190926 |
/stritch/microbio/aboutus/donate/ |
| Admissions |
190919 |
/stritch/microbio/admissions/ |
| Tuition and Aid |
190930 |
/stritch/microbio/admissions/tuitionandaid/ |
| Our Programs |
190920 |
/stritch/microbio/ourprograms/ |
| PhD Program |
190927 |
/stritch/microbio/ourprograms/phdprogram/ |
| right_column |
190932 |
/stritch/microbio/ourprograms/phdprogram/rightcolumn/ |
| MS in Microbiology and Immunology |
198724 |
/stritch/graduateschool/mastersinmicrobiologyandimmunology/ |
| MD/PhD Program |
190928 |
/stritch/microbio/ourprograms/mdphdprogram/ |
| right_column |
190933 |
/stritch/microbio/ourprograms/mdphdprogram/rightcolumn/ |
| Research Tracks |
190921 |
/stritch/microbio/researchtracks/ |
| People |
190922 |
/stritch/microbio/people/ |
| Faculty |
190938 |
/stritch/microbio/people/faculty/ |
| profiles |
191291 |
/stritch/microbio/people/faculty/profiles/ |
| right_column |
190955 |
/stritch/microbio/people/faculty/profiles/rightcolumn/ |
| Research Assistant Professors / Research Associates |
191050 |
/stritch/microbio/people/researchassistantprofessorsresearchassociates/ |
| Staff |
191062 |
/stritch/microbio/people/staff/ |
| Graduate Students |
191051 |
/stritch/microbio/people/graduatestudents/ |
| Profiles |
191572 |
/stritch/microbio/people/graduatestudents/profiles/ |
| right_column |
198626 |
/stritch/microbio/people/graduatestudents/profiles/rightcolumn/ |
| Alumni |
191064 |
/stritch/microbio/people/alumni/ |
| Careers |
191065 |
/stritch/microbio/people/careers/ |
| Why Study at Loyola? |
191068 |
/stritch/microbio/whystudyatloyola/ |
| The Environment |
191069 |
/stritch/microbio/theenvironment/ |
| FAQs |
191070 |
/stritch/microbio/faqs/ |
| Midwest Microbial Pathogenesis Conference |
202475 |
/stritch/microbio/midwestmicrobialpathogenesisconference/ |
| Attendee Registration |
202542 |
/stritch/microbio/midwestmicrobialpathogenesisconference/attendeeregistration/ |
| Sponsorship Opportunities |
202547 |
/stritch/microbio/midwestmicrobialpathogenesisconference/sponsorshipopportunities/ |
| Stritch - Molecular Pharmacology & Neuroscience |
190737 |
/stritch/molecularpharmacologyandneuroscience/ |
| site_logo |
190738 |
/stritch/molecularpharmacologyandneuroscience/sitelogo/ |
| Footer |
190739 |
/stritch/molecularpharmacologyandneuroscience/footer/ |
| cta |
190740 |
/stritch/molecularpharmacologyandneuroscience/cta/ |
| social media |
190742 |
/stritch/molecularpharmacologyandneuroscience/socialmedia/ |
| modules-programming |
190743 |
/stritch/molecularpharmacologyandneuroscience/modules-programming/ |
| About Us |
190748 |
/stritch/molecularpharmacologyandneuroscience/aboutus/ |
| Welcome and Introduction from the Chair |
190749 |
/stritch/molecularpharmacologyandneuroscience/aboutus/welcomeandintroductionfromthechair/ |
| What is Pharmacology? |
190754 |
/stritch/molecularpharmacologyandneuroscience/aboutus/welcomeandintroductionfromthechair/whatispharmacology/ |
| Our Research Programs |
190759 |
/stritch/molecularpharmacologyandneuroscience/aboutus/welcomeandintroductionfromthechair/ourresearchprograms/ |
| Cardiovascular |
190842 |
/stritch/molecularpharmacologyandneuroscience/aboutus/welcomeandintroductionfromthechair/ourresearchprograms/cardiovascular/ |
| Neuropharmacology |
190843 |
/stritch/molecularpharmacologyandneuroscience/aboutus/welcomeandintroductionfromthechair/ourresearchprograms/neuropharmacology/ |
| RNA Therapeutics |
190844 |
/stritch/molecularpharmacologyandneuroscience/aboutus/welcomeandintroductionfromthechair/ourresearchprograms/rnatherapeutics/ |
| RNA Therapeutics |
190760 |
/stritch/molecularpharmacologyandneuroscience/aboutus/welcomeandintroductionfromthechair/rnatherapeutics/ |
| Service and Outreach |
190761 |
/stritch/molecularpharmacologyandneuroscience/aboutus/welcomeandintroductionfromthechair/serviceandoutreach/ |
| Graduate and Postgraduate Training |
190762 |
/stritch/molecularpharmacologyandneuroscience/aboutus/welcomeandintroductionfromthechair/graduateandpostgraduatetraining/ |
| News |
190750 |
/stritch/molecularpharmacologyandneuroscience/aboutus/news/ |
| Our History |
190751 |
/stritch/molecularpharmacologyandneuroscience/aboutus/ourhistory/ |
| Our Programs |
190785 |
/stritch/molecularpharmacologyandneuroscience/ourprograms/ |
| Overview of the graduate programs |
190752 |
/stritch/molecularpharmacologyandneuroscience/ourprograms/overviewofthegraduateprograms/ |
| MD/PhD |
190788 |
/stritch/mdphd/ |
| PhD |
190786 |
/stritch/molecularpharmacologyandneuroscience/ourprograms/phd/ |
| MS |
190789 |
/stritch/graduateschool/mastersinmolecularpharmacologyandtherapeutics/ |
| MS Pharmacology and MBA Dual Degree Program |
190790 |
/pharmacology/programs/ms-mba/ |
| Pharmacovigilance Certificate |
190791 |
/stritch/molecularpharmacologyandneuroscience/ourprograms/pharmacovigilancecertificate/ |
| SPARK MPN (Summer Program for Advancing Research Knowledge) |
190793 |
/stritch/molecularpharmacologyandneuroscience/ourprograms/sparkmpnsummerprogramforadvancingresearchknowledge/ |
| MS in Molecular Pharmacology & Therapeutics |
194244 |
/stritch/molecularpharmacologyandneuroscience/ourprograms/msinmolecularpharmacologytherapeutics/ |
| Research Tracks |
190794 |
/stritch/molecularpharmacologyandneuroscience/researchtracks/ |
| Overview of research tracks |
190795 |
/stritch/molecularpharmacologyandneuroscience/researchtracks/overviewofresearchtracks/ |
| People |
190810 |
/stritch/molecularpharmacologyandneuroscience/people/ |
| Faculty |
201574 |
https://www.luc.edu/stritch/molecularpharmacologyandneuroscience/people/faculty/?filter=pharmPrimary |
| Faculty |
190811 |
/stritch/molecularpharmacologyandneuroscience/people/faculty/ |
| Profiles |
190812 |
/stritch/molecularpharmacologyandneuroscience/people/faculty/profiles/ |
| Staff |
190820 |
/stritch/molecularpharmacologyandneuroscience/people/staff/ |
| Profiles |
190821 |
/stritch/molecularpharmacologyandneuroscience/people/staff/profiles/ |
| Postdocs and Staff Scientists |
190822 |
/stritch/molecularpharmacologyandneuroscience/people/postdocsandstaffscientists/ |
| Profiles |
190826 |
/stritch/molecularpharmacologyandneuroscience/people/postdocsandstaffscientists/profiles/ |
| Graduate Students |
190829 |
/stritch/molecularpharmacologyandneuroscience/people/graduatestudents/ |
| Profiles |
190830 |
/stritch/molecularpharmacologyandneuroscience/people/graduatestudents/profiles/ |
| Pharmacovigilance Students |
190831 |
/stritch/molecularpharmacologyandneuroscience/people/pharmacovigilancestudents/ |
| Profiles |
190832 |
/stritch/molecularpharmacologyandneuroscience/people/pharmacovigilancestudents/profiles/ |
| Pharmacology Graduate Programs |
205010 |
/stritch/molecularpharmacologyandneuroscience/pharmacologygraduateprograms/ |
| Pharmacology Graduate Programs |
205011 |
/stritch/molecularpharmacologyandneuroscience/pharmacologygraduateprograms/pharmacologygraduateprograms/ |
| Stritch - Neurological Surgery |
89524 |
/stritch/neurosurgery/ |
| site_logo |
202488 |
/stritch/neurosurgery/sitelogo/ |
| Footer |
202489 |
/stritch/neurosurgery/footer/ |
| social media |
202492 |
/stritch/neurosurgery/socialmedia/ |
| cta |
202490 |
/stritch/neurosurgery/cta/ |
| I Links |
202491 |
/stritch/neurosurgery/ilinks/ |
| Divisions / Specialties |
94680 |
/stritch/neurosurgery/divisionsspecialties/ |
| Skull Base Tumors |
94681 |
/stritch/neurosurgery/divisionsspecialties/skullbasetumors/ |
| Skull Base Course |
114953 |
/stritch/neurosurgery/divisionsspecialties/skullbasetumors/skullbasecourse/ |
| Endovascular |
94683 |
/stritch/neurosurgery/divisionsspecialties/endovascular/ |
| Neuro-Oncology |
94684 |
/stritch/neurosurgery/divisionsspecialties/neuro-oncology/ |
| Complex Spine Surgery |
98386 |
/stritch/neurosurgery/divisionsspecialties/complexspinesurgery/ |
| Functional Neurosurgery |
98387 |
/stritch/neurosurgery/divisionsspecialties/functionalneurosurgery/ |
| General Neurosurgery |
98870 |
/stritch/neurosurgery/divisionsspecialties/generalneurosurgery/ |
| Education |
89541 |
/stritch/neurosurgery/education/ |
| Subinternship |
123568 |
/stritch/neurosurgery/education/subinternship/ |
| Research |
89542 |
/stritch/neurosurgery/research/ |
| Faculty |
89538 |
/stritch/neurosurgery/faculty/ |
| Profiles |
89539 |
/stritch/neurosurgery/faculty/profiles/ |
| right_column |
202551 |
/stritch/neurosurgery/faculty/profiles/rightcolumn/ |
| Services |
89543 |
https://www.loyolamedicine.org/neurology-neurosurgery/neurosurgery |
| About |
89544 |
/stritch/neurosurgery/about/ |
| Contact Us |
98496 |
/stritch/neurosurgery/about/contactus/ |
| Message from the Chair |
98415 |
/stritch/neurosurgery/about/messagefromthechair/ |
| Stritch - Neurology |
89425 |
/stritch/neurology/ |
| Residency / Fellowships |
89438 |
/stritch/neurology/residencyfellowships/ |
| Research |
89439 |
/stritch/neurology/research/ |
| Faculty |
89435 |
/stritch/neurology/faculty/ |
| Profiles |
89437 |
/stritch/neurology/faculty/profiles/ |
| right_column |
202550 |
/stritch/neurology/faculty/profiles/rightcolumn/ |
| Services |
89441 |
https://www.loyolamedicine.org/neurology-neurosurgery |
| About |
89442 |
/stritch/neurology/about/ |
| Message from the Chair |
89450 |
/stritch/neurology/about/messagefromthechair/ |
| Contact Us |
89444 |
/stritch/neurology/about/contactus/ |
| site_logo |
202536 |
/stritch/neurology/sitelogo/ |
| social media |
202541 |
/stritch/neurology/socialmedia/ |
| Stritch - Obstetrics and Gynecology |
89044 |
/stritch/obgyn/ |
| site_logo |
202599 |
/stritch/obgyn/sitelogo/ |
| Footer |
202600 |
/stritch/obgyn/footer/ |
| social media |
202601 |
/stritch/obgyn/socialmedia/ |
| About |
89059 |
/stritch/obgyn/about/ |
| Contact Us |
89063 |
/stritch/obgyn/about/contactus/ |
| Faculty |
89066 |
/stritch/obgyn/faculty/ |
| profiles |
202596 |
/stritch/obgyn/faculty/profiles/ |
| Residency & Fellowships |
89056 |
/stritch/obgyn/faculty/residencyfellowships/ |
| Divisions & Specialties |
89050 |
/stritch/obgyn/divisionsspecialties/ |
| General Obstetrics and Gynecology |
89051 |
/stritch/obgyn/divisionsspecialties/generalobstetricsandgynecology/ |
| Female Pelvic and Reconstructive Surgery |
89052 |
/stritch/obgyn/divisionsspecialties/femalepelvicandreconstructivesurgery/ |
| Gynecologic Oncology |
89053 |
/stritch/obgyn/divisionsspecialties/gynecologiconcology/ |
| Maternal-Fetal Medicine |
89054 |
/stritch/obgyn/divisionsspecialties/maternal-fetalmedicine/ |
| Reproductive Endocrinology |
89055 |
/stritch/obgyn/divisionsspecialties/reproductiveendocrinology/ |
| Research |
89057 |
/stritch/obgyn/research/ |
| Services |
89058 |
/stritch/obgyn/services/ |
| Obstetrics |
89064 |
https://www.loyolamedicine.org/services/womens-health/obstetrics |
| Gynecology |
89065 |
https://www.loyolamedicine.org/services/womens-health/gynecology |
| Stritch - Ophthalmology |
89799 |
/stritch/ophthalmology/index.shtml |
| site_logo |
201804 |
/stritch/ophthalmology/sitelogo/ |
| Footer |
201805 |
/stritch/ophthalmology/footer/ |
| cta |
201808 |
/stritch/ophthalmology/cta/ |
| modules-programming |
201809 |
/stritch/ophthalmology/modules-programming/ |
| News |
201832 |
/stritch/ophthalmology/news/ |
| About |
89825 |
/stritch/ophthalmology/about/ |
| Chair's Message |
90186 |
/stritch/ophthalmology/about/chairsmessage/ |
| Contact Us |
90187 |
/stritch/ophthalmology/about/contactus/ |
| Events |
90189 |
/stritch/ophthalmology/about/events/ |
| Ophthalmic Pathology Virtual Microscopy |
90221 |
/stritch/ophthalmology/about/events/ophthalmicpathologyvirtualmicroscopy/ |
| Photo Archives |
91375 |
/stritch/ophthalmology/about/events/photoarchives/ |
| AAO Alumni Reception |
91381 |
/stritch/ophthalmology/about/events/photoarchives/aaoalumnireception/ |
| ARVO Resident Faculty Dinner |
91382 |
/stritch/ophthalmology/about/events/photoarchives/arvoresidentfacultydinner/ |
| Chair's Reception for Graduating Residents |
91383 |
/stritch/ophthalmology/about/events/photoarchives/chairsreceptionforgraduatingresidents/ |
| Incoming Resident Welcome Party |
91384 |
/stritch/ophthalmology/about/events/photoarchives/incomingresidentwelcomeparty/ |
| Resident Graduation Dinner |
91385 |
/stritch/ophthalmology/about/events/photoarchives/residentgraduationdinner/ |
| Winter Holiday Party |
91386 |
/stritch/ophthalmology/about/events/photoarchives/winterholidayparty/ |
| History of Philanthropy |
90636 |
/stritch/ophthalmology/about/historyofphilanthropy/ |
| Arthur Light, MD, Memorial Lectureship in Ophthalmology |
97912 |
/stritch/ophthalmology/education/cmeprograms/loyolafallcataract-glaucomasummit/arthurlightmdmemoriallectureshipinophthalmology/ |
| John M. Krasa, MD Endowment |
90639 |
/stritch/ophthalmology/about/historyofphilanthropy/johnmkrasamdendowment/ |
| Dr. John P. Mulcahy & Therese E. Mulcahy |
90640 |
/stritch/ophthalmology/about/historyofphilanthropy/drjohnpmulcahythereseemulcahy/ |
| Richard A. Perritt, MD Charitable Foundation |
90642 |
/stritch/ophthalmology/about/historyofphilanthropy/richardaperrittmdcharitablefoundation/ |
| Dr. Lucian and Irene Dyba Matusak Professorship in Ophthalmology |
97911 |
/stritch/ophthalmology/about/historyofphilanthropy/drlucianandirenedybamatusakprofessorshipinophthalmology/ |
| Alumni |
90272 |
/stritch/ophthalmology/about/alumni/ |
| Alumni Directory |
97960 |
/stritch/ophthalmology/about/alumni/alumnidirectory/ |
| Alumni Class News |
90647 |
/stritch/ophthalmology/about/alumni/alumniclassnews/ |
| Graduation Photos |
158237 |
/stritch/ophthalmology/about/alumni/graduationphotos/ |
| Support Our Work |
90274 |
/stritch/ophthalmology/about/supportourwork/ |
| Areas to Support |
90635 |
/stritch/ophthalmology/about/supportourwork/areastosupport/ |
| Planned Giving |
90643 |
/stritch/ophthalmology/about/supportourwork/plannedgiving/ |
| Diversity, Equity, and Inclusion |
161861 |
/stritch/ophthalmology/about/diversityequityandinclusion/ |
| Celebrating LGBTQ+ Pride Month |
178527 |
/stritch/ophthalmology/about/diversityequityandinclusion/celebratinglgbtqpridemonth/ |
| News Archive |
90106 |
/stritch/ophthalmology/about/newsarchive/ |
| right_column |
201855 |
/stritch/ophthalmology/about/newsarchive/rightcolumn/ |
| archive |
201843 |
/stritch/ophthalmology/about/newsarchive/archive/ |
| Newsletters |
179156 |
/stritch/ophthalmology/about/newsarchive/newsletters/ |
| America's Best Eye Doctors 2021 |
158360 |
/stritch/ophthalmology/about/newsarchive/americasbesteyedoctors2021/ |
| Recipient of the Helen and Wesley E. Bass, Jr. Award - Anita Ghosh |
158388 |
/stritch/ophthalmology/about/newsarchive/recipientofthehelenandwesleyebassjraward-anitaghosh/ |
| Recipient of 2022 Eversight Grant |
167571 |
/stritch/ophthalmology/about/newsarchive/recipientof2022eversightgrant/ |
| EyeSim VR |
158401 |
/stritch/ophthalmology/about/newsarchive/eyesimvr/ |
| OcuSim 2021 |
158359 |
/stritch/ophthalmology/about/newsarchive/ocusim2021/ |
| Top Doctors 2022 |
168264 |
/stritch/ophthalmology/about/newsarchive/topdoctors2022/ |
| Top Doctors 2023 |
184860 |
/stritch/ophthalmology/about/newsarchive/topdoctors2023/ |
| Top Doctors 2025 |
204526 |
/stritch/ophthalmology/about/newsarchive/topdoctors2025/ |
| Residency Program Training |
204665 |
/stritch/ophthalmology/about/newsarchive/residencyprogramtraining/ |
| Top Doctors 2026 |
207500 |
/stritch/ophthalmology/about/newsarchive/topdoctors2026/ |
| Service |
156869 |
/stritch/ophthalmology/service/ |
| History of World Service |
90188 |
/stritch/ophthalmology/service/historyofworldservice/ |
| Humanitarian Awards (AAO) |
90357 |
/stritch/ophthalmology/service/historyofworldservice/humanitarianawardsaao/ |
| FOCUS |
90385 |
/stritch/ophthalmology/service/historyofworldservice/focus/ |
| Thomas Stamm, MD World Service Endowment |
90633 |
/stritch/ophthalmology/service/historyofworldservice/thomasstammmdworldserviceendowment/ |
| World Service Locations |
90287 |
/stritch/ophthalmology/service/worldservicelocations/ |
| Afghanistan |
90291 |
/stritch/ophthalmology/service/worldservicelocations/afghanistan/ |
| Bolivia |
90293 |
/stritch/ophthalmology/service/worldservicelocations/bolivia/ |
| Bosnia |
90294 |
/stritch/ophthalmology/service/worldservicelocations/bosnia/ |
| China |
90295 |
/stritch/ophthalmology/service/worldservicelocations/china/ |
| Ecuador |
90296 |
/stritch/ophthalmology/service/worldservicelocations/ecuador/ |
| Ghana |
90297 |
/stritch/ophthalmology/service/worldservicelocations/ghana/ |
| Guatemala |
90298 |
/stritch/ophthalmology/service/worldservicelocations/guatemala/ |
| India |
90299 |
/stritch/ophthalmology/service/worldservicelocations/india/ |
| Jordan |
90301 |
/stritch/ophthalmology/service/worldservicelocations/jordan/ |
| Mongolia |
90302 |
/stritch/ophthalmology/service/worldservicelocations/mongolia/ |
| Nigeria |
90303 |
/stritch/ophthalmology/service/worldservicelocations/nigeria/ |
| Pakistan |
90304 |
/stritch/ophthalmology/service/worldservicelocations/pakistan/ |
| Peru |
90305 |
/stritch/ophthalmology/service/worldservicelocations/peru/ |
| Philippines |
90306 |
/stritch/ophthalmology/service/worldservicelocations/philippines/ |
| Sudan |
90307 |
/stritch/ophthalmology/service/worldservicelocations/sudan/ |
| Syria |
90308 |
/stritch/ophthalmology/service/worldservicelocations/syria/ |
| Community Service |
90632 |
/stritch/ophthalmology/service/communityservice/ |
| Clinical Services |
89824 |
https://www.loyolamedicine.org/ophthalmology |
| Education |
89822 |
/stritch/ophthalmology/education/ |
| CME Programs |
90219 |
/stritch/ophthalmology/education/cmeprograms/ |
| Loyola Fall Cataract-Glaucoma Summit |
90717 |
/stritch/ophthalmology/education/cmeprograms/loyolafallcataract-glaucomasummit/ |
| Arthur Light, MD, Memorial Lectureship in Ophthalmology |
90673 |
/stritch/ophthalmology/education/cmeprograms/loyolafallcataract-glaucomasummit/arthurlightmdmemoriallectureshipinophthalmology/ |
| Distinguished Visiting Professorship |
90641 |
/stritch/ophthalmology/education/cmeprograms/loyolafallcataract-glaucomasummit/distinguishedvisitingprofessorship/ |
| John J. Skowron, MD, Distinguished Professorship Presentations |
90718 |
/stritch/ophthalmology/education/cmeprograms/loyolafallcataract-glaucomasummit/distinguishedvisitingprofessorship/johnjskowronmddistinguishedprofessorshippresentations/ |
| Loyola Resident - Alumni / Faculty - Alumni Day |
90726 |
/stritch/ophthalmology/education/cmeprograms/loyolaresident-alumnifaculty-alumniday/ |
| James E. McDonald, MD Annual Alumni Day Lecture |
90729 |
/stritch/ophthalmology/education/cmeprograms/loyolaresident-alumnifaculty-alumniday/jamesemcdonaldmdannualalumnidaylecture/ |
| Mark J. Daily Lectureship in Retinal Disease |
90733 |
/stritch/ophthalmology/education/cmeprograms/loyolaresident-alumnifaculty-alumniday/markjdailylectureshipinretinaldisease/ |
| Loyola Distinguished Alumni Speaker |
90286 |
/stritch/ophthalmology/education/cmeprograms/loyolaresident-alumnifaculty-alumniday/loyoladistinguishedalumnispeaker/ |
| Loyola World Mission Symposium |
90734 |
/stritch/ophthalmology/education/cmeprograms/loyolaworldmissionsymposium/ |
| Chicago Subspecialty Guest Lecture Series |
90715 |
/stritch/ophthalmology/education/cmeprograms/chicagosubspecialtyguestlectureseries/ |
| Diversity Equity Inclusion Speakership |
167552 |
/stritch/ophthalmology/education/cmeprograms/diversityequityinclusionspeakership/ |
| Current Concepts in Eye Care |
90716 |
/stritch/ophthalmology/education/cmeprograms/currentconceptsineyecare/ |
| Richard A. Perritt Research Symposia |
159066 |
/stritch/ophthalmology/education/cmeprograms/richardaperrittresearchsymposia/ |
| Biomechanics of Ocular Disease Symposium |
159067 |
/stritch/ophthalmology/education/cmeprograms/richardaperrittresearchsymposia/biomechanicsofoculardiseasesymposium/ |
| Stevens-Johnson Syndrome: Acute Systemic & Ophthalmic Management |
90744 |
/stritch/ophthalmology/education/cmeprograms/richardaperrittresearchsymposia/stevens-johnsonsyndromeacutesystemicophthalmicmanagement/ |
| SJS Patient Support Group Symposium |
178465 |
/stritch/ophthalmology/education/cmeprograms/richardaperrittresearchsymposia/sjspatientsupportgroupsymposium/ |
| Allied Health Conferences |
90714 |
/stritch/ophthalmology/education/cmeprograms/alliedhealthconferences/ |
| GME Program |
157325 |
https://www.loyolamedicine.org/gme/residencies/ophthalmology/ |
| UME Programs |
157241 |
/stritch/ophthalmology/education/umeprograms/ |
| Medical Students |
90220 |
/stritch/ophthalmology/education/umeprograms/medicalstudents/ |
| Ophthalmology Interest Group |
90740 |
/stritch/ophthalmology/education/umeprograms/ophthalmologyinterestgroup/ |
| Research |
89823 |
/stritch/ophthalmology/research/ |
| Subspecialty Research |
154650 |
/stritch/ophthalmology/research/subspecialtyresearch/ |
| Cornea and Ocular Surface Disease |
154651 |
/stritch/ophthalmology/research/subspecialtyresearch/corneaandocularsurfacedisease/ |
| Cornea Research Faculty |
154821 |
/stritch/ophthalmology/research/subspecialtyresearch/corneaandocularsurfacedisease/cornearesearchfaculty/ |
| Areas of Research Focus |
155129 |
/stritch/ophthalmology/research/subspecialtyresearch/corneaandocularsurfacedisease/areasofresearchfocus/ |
| Cornea Publications |
154619 |
/stritch/ophthalmology/research/subspecialtyresearch/corneaandocularsurfacedisease/corneapublications/ |
| Education Technology Research |
157551 |
/stritch/ophthalmology/research/subspecialtyresearch/educationtechnologyresearch/ |
| Education Research Faculty |
157552 |
/stritch/ophthalmology/research/subspecialtyresearch/educationtechnologyresearch/educationresearchfaculty/ |
| Areas of Research Focus |
157553 |
/stritch/ophthalmology/research/subspecialtyresearch/educationtechnologyresearch/areasofresearchfocus/ |
| Education Publications |
157554 |
/stritch/ophthalmology/research/subspecialtyresearch/educationtechnologyresearch/educationpublications/ |
| Glaucoma & Neurodegeneration |
154824 |
/stritch/ophthalmology/research/subspecialtyresearch/glaucomaneurodegeneration/ |
| Glaucoma Research Faculty |
156928 |
/stritch/ophthalmology/research/subspecialtyresearch/glaucomaneurodegeneration/glaucomaresearchfaculty/ |
| Area of Research Focus |
156931 |
/stritch/ophthalmology/research/subspecialtyresearch/glaucomaneurodegeneration/areaofresearchfocus/ |
| Glaucoma Publications |
156932 |
/stritch/ophthalmology/research/subspecialtyresearch/glaucomaneurodegeneration/glaucomapublications/ |
| Oculoplastic & Reconstructive Surgery |
156871 |
/stritch/ophthalmology/research/subspecialtyresearch/oculoplasticreconstructivesurgery/ |
| Oculoplastic Research Faculty |
158984 |
/stritch/ophthalmology/research/subspecialtyresearch/oculoplasticreconstructivesurgery/oculoplasticresearchfaculty/ |
| Areas of Research Focus |
124180 |
/stritch/ophthalmology/research/subspecialtyresearch/oculoplasticreconstructivesurgery/areasofresearchfocus/ |
| Oculoplastics Publications |
158883 |
/stritch/ophthalmology/research/subspecialtyresearch/oculoplasticreconstructivesurgery/oculoplasticspublications/ |
| Optometry |
159641 |
/stritch/ophthalmology/research/subspecialtyresearch/optometry/ |
| Optometry Research Faculty |
159643 |
/stritch/ophthalmology/research/subspecialtyresearch/optometry/optometryresearchfaculty/ |
| Areas of Research Focus |
159642 |
/stritch/ophthalmology/research/subspecialtyresearch/optometry/areasofresearchfocus/ |
| Optometry Publications |
159644 |
/stritch/ophthalmology/research/subspecialtyresearch/optometry/optometrypublications/ |
| Pediatric & Adult Strabismus |
158447 |
/stritch/ophthalmology/research/subspecialtyresearch/pediatricadultstrabismus/ |
| Pediatric Research Faculty |
158362 |
/stritch/ophthalmology/research/subspecialtyresearch/pediatricadultstrabismus/pediatricresearchfaculty/ |
| Areas of Research Focus |
158448 |
/stritch/ophthalmology/research/subspecialtyresearch/pediatricadultstrabismus/areasofresearchfocus/ |
| Pediatric Publications |
124181 |
/stritch/ophthalmology/research/subspecialtyresearch/pediatricadultstrabismus/pediatricpublications/ |
| Retina Diseases and Uveitis |
157313 |
/stritch/ophthalmology/research/subspecialtyresearch/retinadiseasesanduveitis/ |
| Retina Research Faculty |
157314 |
/stritch/ophthalmology/research/subspecialtyresearch/retinadiseasesanduveitis/retinaresearchfaculty/ |
| Areas of Research Focus |
157315 |
/stritch/ophthalmology/research/subspecialtyresearch/retinadiseasesanduveitis/areasofresearchfocus/ |
| Retina Publications |
157316 |
/stritch/ophthalmology/research/subspecialtyresearch/retinadiseasesanduveitis/retinapublications/ |
| Neuro-Ophthalmology |
161311 |
/stritch/ophthalmology/research/subspecialtyresearch/neuro-ophthalmology/ |
| Neuro-Ophthalmology Research Faculty |
163018 |
/stritch/ophthalmology/research/subspecialtyresearch/neuro-ophthalmology/neuro-ophthalmologyresearchfaculty/ |
| Areas of Research Focus |
158400 |
/stritch/ophthalmology/research/subspecialtyresearch/neuro-ophthalmology/areasofresearchfocus/ |
| Neuro-Ophthalmology Publications |
162205 |
/stritch/ophthalmology/research/subspecialtyresearch/neuro-ophthalmology/neuro-ophthalmologypublications/ |
| Publications & Presentations |
92277 |
/stritch/ophthalmology/research/publicationspresentations/ |
| Faculty |
156230 |
/stritch/ophthalmology/faculty/ |
| right_column |
201845 |
/stritch/ophthalmology/faculty/rightcolumn/ |
| profiles |
201844 |
/stritch/ophthalmology/faculty/profiles/ |
| Specialties |
89821 |
/stritch/ophthalmology/specialties/ |
| Cataract Service |
89826 |
/stritch/ophthalmology/specialties/cataractservice/ |
| Comprehensive Ophthalmology |
89827 |
/stritch/ophthalmology/specialties/comprehensiveophthalmology/ |
| Cornea & External Disease |
89829 |
/stritch/ophthalmology/specialties/corneaexternaldisease/ |
| Glaucoma Service |
89831 |
/stritch/ophthalmology/specialties/glaucomaservice/ |
| Laser Vision Correction (LASIK) & Refractive Surgery |
89833 |
/stritch/ophthalmology/specialties/laservisioncorrectionlasikrefractivesurgery/ |
| Neuro-Ophthalmology Service |
89835 |
/stritch/ophthalmology/specialties/neuro-ophthalmologyservice/ |
| Oculoplastics & Orbital Surgery |
89836 |
/stritch/ophthalmology/specialties/oculoplasticsorbitalsurgery/ |
| Optometry |
99595 |
/stritch/ophthalmology/specialties/optometry/ |
| Contact Lens Service |
89828 |
/stritch/ophthalmology/specialties/optometry/contactlensservice/ |
| Low Vision / Vision Rehabilitation Service |
89834 |
/stritch/ophthalmology/specialties/optometry/lowvisionvisionrehabilitationservice/ |
| Pediatric Ophthalmology and Adult Strabismus Service |
89840 |
/stritch/ophthalmology/specialties/pediatricophthalmologyandadultstrabismusservice/ |
| Retina / Diabetic Eye Care Service |
89841 |
/stritch/ophthalmology/specialties/retinadiabeticeyecareservice/ |
| Uveitis / Ocular Immunology Service |
89843 |
/stritch/ophthalmology/specialties/uveitisocularimmunologyservice/ |
| Stritch - Orthopaedic Surgery and Rehabilitation |
204975 |
/stritch/ortho/ |
| site_logo |
204997 |
/stritch/ortho/sitelogo/ |
| Footer |
204998 |
/stritch/ortho/footer/ |
| social media |
205000 |
/stritch/ortho/socialmedia/ |
| cta |
205001 |
/stritch/ortho/cta/ |
| About |
204982 |
/stritch/ortho/about/ |
| Contact Us |
204985 |
/stritch/ortho/about/contactus/ |
| Maps and Directions |
204984 |
/stritch/ortho/about/mapsanddirections/ |
| Stritch - Otolaryngology (ENT) |
89258 |
/stritch/ent/ |
| site_logo |
202871 |
/stritch/ent/sitelogo/ |
| Footer |
202872 |
/stritch/ent/footer/ |
| social media |
202874 |
/stritch/ent/socialmedia/ |
| cta |
202875 |
/stritch/ent/cta/ |
| About |
89271 |
/stritch/ent/about/ |
| Message from the Chair |
92037 |
/stritch/ent/about/messagefromthechair/ |
| Contact Us |
89317 |
/stritch/ent/about/contactus/ |
| Support the Department |
89318 |
/stritch/ent/about/supportthedepartment/ |
| Patient Testimonials |
89327 |
/stritch/ent/about/supportthedepartment/patienttestimonials/ |
| Mission Trip |
93571 |
/stritch/ent/about/missiontrip/ |
| right_column |
202883 |
/stritch/ent/about/missiontrip/rightcolumn/ |
| Divisions/Specialties |
89264 |
/stritch/ent/divisionsspecialties/ |
| Otology-Neurotology (Ear) |
89272 |
/stritch/ent/divisionsspecialties/otology-neurotologyear/ |
| Rhinology (Nose) |
89273 |
/stritch/ent/divisionsspecialties/rhinologynose/ |
| Laryngology (Throat) |
89274 |
/stritch/ent/divisionsspecialties/laryngologythroat/ |
| Head/Neck/Thyroid |
89275 |
/stritch/ent/divisionsspecialties/headneckthyroid/ |
| Allergy |
89276 |
/stritch/ent/divisionsspecialties/allergy/ |
| Cranial Base Tumors |
89277 |
/stritch/ent/divisionsspecialties/cranialbasetumors/ |
| Facial Plastics |
89278 |
/stritch/ent/divisionsspecialties/facialplastics/ |
| General Otolaryngology |
89279 |
/stritch/ent/divisionsspecialties/generalotolaryngology/ |
| Pediatric Otolaryngology (Children) |
89280 |
/stritch/ent/divisionsspecialties/pediatricotolaryngologychildren/ |
| Sleep Disorders |
89281 |
/stritch/ent/divisionsspecialties/sleepdisorders/ |
| Residency/Fellowships |
89265 |
/stritch/ent/residencyfellowships/ |
| Research |
89266 |
/stritch/ent/research/ |
| Publications |
89307 |
/stritch/ent/research/publications/ |
| Older Publications |
92928 |
/stritch/ent/research/olderpublications/ |
| Faculty |
89267 |
/stritch/ent/faculty/ |
| profiles |
89268 |
/stritch/ent/faculty/profiles/ |
| right_column |
202888 |
/stritch/ent/faculty/profiles/rightcolumn/ |
| Services |
89270 |
https://www.loyolamedicine.org/otolaryngology-ent |
| News |
94426 |
/stritch/ent/news/ |
| archive |
94435 |
/stritch/ent/news/archive/ |
| Stritch - Pathology |
92774 |
/stritch/pathology/ |
| site_logo |
202824 |
/stritch/pathology/sitelogo/ |
| Footer |
202825 |
/stritch/pathology/footer/ |
| social media |
202827 |
/stritch/pathology/socialmedia/ |
| cta |
202828 |
/stritch/pathology/cta/ |
| About |
92790 |
/stritch/pathology/about/ |
| Message from the Chair |
202821 |
/stritch/pathology/about/messagefromthechair/ |
| Contact Us |
92798 |
/stritch/pathology/about/contactus/ |
| Laboratories |
92915 |
/stritch/pathology/about/laboratories/ |
| Chicago Area Information |
92793 |
/stritch/pathology/about/chicagoareainformation/ |
| Department News |
92794 |
/stritch/pathology/about/departmentnews/ |
| Publications |
92797 |
/stritch/pathology/about/publications/ |
| SCOPE |
97546 |
/stritch/pathology/about/scope/ |
| Residency / Fellowships |
92780 |
/stritch/pathology/residencyfellowships/ |
| Research |
92782 |
/stritch/pathology/research/ |
| Interesting and Ongoing Projects |
92804 |
/stritch/pathology/research/interestingandongoingprojects/ |
| Research Funding |
92805 |
/stritch/pathology/research/researchfunding/ |
| Faculty |
92783 |
/stritch/pathology/faculty/ |
| profiles |
92784 |
/stritch/pathology/faculty/profiles/ |
| right_column |
202829 |
/stritch/pathology/faculty/profiles/rightcolumn/ |
| Services |
202822 |
/stritch/pathology/services/ |
| Stritch - Pediatrics |
92600 |
/stritch/pediatrics/ |
| site_logo |
202889 |
/stritch/pediatrics/sitelogo/ |
| Footer |
202890 |
/stritch/pediatrics/footer/ |
| social media |
202893 |
/stritch/pediatrics/socialmedia/ |
| cta |
202894 |
/stritch/pediatrics/cta/ |
| About |
92619 |
/stritch/pediatrics/about/ |
| Message from the Chair |
92694 |
/stritch/pediatrics/about/messagefromthechair/ |
| Medical Students |
92620 |
/stritch/pediatrics/about/medicalstudents/ |
| Grand Rounds |
92621 |
/stritch/pediatrics/about/grandrounds/ |
| Ronald McDonald Children’s Hospital |
92622 |
https://rmhccni.org/loyola-university-medical-center/ |
| Divisions / Specialties |
92614 |
/stritch/pediatrics/divisionsspecialties/ |
| Adolescent Medicine |
92628 |
/stritch/pediatrics/divisionsspecialties/adolescentmedicine/ |
| Allergy & Immunology |
92629 |
/stritch/pediatrics/divisionsspecialties/allergyimmunology/ |
| Cardiology |
92630 |
/stritch/pediatrics/divisionsspecialties/cardiology/ |
| Child Development |
92631 |
/stritch/pediatrics/divisionsspecialties/childdevelopment/ |
| Critical Care |
92632 |
/stritch/pediatrics/divisionsspecialties/criticalcare/ |
| Dermatology |
92633 |
/stritch/pediatrics/divisionsspecialties/dermatology/ |
| Endocrinology |
92634 |
/stritch/pediatrics/divisionsspecialties/endocrinology/ |
| Gastroenterology |
92635 |
/stritch/pediatrics/divisionsspecialties/gastroenterology/ |
| General Pediatrics |
92636 |
/stritch/pediatrics/divisionsspecialties/generalpediatrics/ |
| Hematology/Oncology |
92637 |
/stritch/pediatrics/divisionsspecialties/hematologyoncology/ |
| Infectious Disease |
92638 |
/stritch/pediatrics/divisionsspecialties/infectiousdisease/ |
| Neonatology |
92639 |
/stritch/pediatrics/divisionsspecialties/neonatology/ |
| Nephrology |
92640 |
/stritch/pediatrics/divisionsspecialties/nephrology/ |
| Plastic & Reconstructive Surgery/Craniofacial Surgery |
92641 |
/stritch/pediatrics/divisionsspecialties/plasticreconstructivesurgerycraniofacialsurgery/ |
| Pediatric Surgical Services |
92642 |
/stritch/pediatrics/divisionsspecialties/pediatricsurgicalservices/ |
| Other Pediatric Subspecialists |
92643 |
/stritch/pediatrics/divisionsspecialties/otherpediatricsubspecialists/ |
| Primary Care General Pediatricians |
92644 |
/stritch/pediatrics/divisionsspecialties/primarycaregeneralpediatricians/ |
| Residency / Fellowships |
92615 |
/stritch/pediatrics/residencyfellowships/ |
| Research |
92616 |
/stritch/pediatrics/research/ |
| Faculty |
92609 |
/stritch/pediatrics/faculty/ |
| profiles |
92610 |
/stritch/pediatrics/faculty/profiles/ |
| right_column |
202922 |
/stritch/pediatrics/faculty/profiles/rightcolumn/ |
| Services |
92618 |
https://www.loyolamedicine.org/services/pediatrics |
| Stritch - Psychiatry and Behavioral Neurosciences |
92345 |
/stritch/psych/ |
| site_logo |
202864 |
/stritch/psych/sitelogo/ |
| Footer |
202865 |
/stritch/psych/footer/ |
| social media |
202868 |
/stritch/psych/socialmedia/ |
| I Links |
202867 |
/stritch/psych/ilinks/ |
| About |
92360 |
/stritch/psych/about/ |
| Message from the Chair |
92515 |
/stritch/psych/about/messagefromthechair/ |
| Contact Us |
92516 |
/stritch/psych/about/contactus/ |
| Maps & Locations |
92556 |
https://www.loyolamedicine.org/locations |
| News |
92518 |
/stritch/psych/about/news/ |
| Residency / Fellowships |
92352 |
/stritch/psych/residencyfellowships/ |
| Research |
92354 |
/stritch/psych/research/ |
| Faculty |
92355 |
/stritch/psych/faculty/ |
| Profiles |
92356 |
/stritch/psych/faculty/profiles/ |
| right_column |
202880 |
/stritch/psych/faculty/profiles/rightcolumn/ |
| Services |
92359 |
https://www.loyolamedicine.org/psychiatry |
| VA Faculty |
92543 |
/stritch/psych/vafaculty/ |
| Stritch - Radiation Oncology |
88895 |
/stritch/radiation-oncology/ |
| site_logo |
202939 |
/stritch/radiation-oncology/sitelogo/ |
| Footer |
202940 |
/stritch/radiation-oncology/footer/ |
| social media |
202944 |
/stritch/radiation-oncology/socialmedia/ |
| I Links |
202942 |
/stritch/radiation-oncology/ilinks/ |
| About |
88908 |
/stritch/radiation-oncology/about/ |
| Contact Us |
88942 |
/stritch/radiation-oncology/about/contactus/ |
| Message from the Chair |
203002 |
/stritch/radiation-oncology/about/messagefromthechair/ |
| Residency / Fellowships |
88902 |
/stritch/radiation-oncology/residencyfellowships/ |
| Research |
88903 |
/stritch/radiation-oncology/research/ |
| Clinical Trials |
88974 |
/stritch/radiation-oncology/research/clinicaltrials/ |
| Faculty |
88904 |
/stritch/radiation-oncology/faculty/ |
| Profiles |
88905 |
/stritch/radiation-oncology/faculty/profiles/ |
| right_column |
202953 |
/stritch/radiation-oncology/faculty/profiles/rightcolumn/ |
| Services |
88907 |
https://www.loyolamedicine.org/cancer/radiation-therapy-radiation-oncology |
| Stritch - Radiology |
92937 |
/stritch/radiology/ |
| site_logo |
203202 |
/stritch/radiology/sitelogo/ |
| Footer |
203203 |
/stritch/radiology/footer/ |
| social media |
203205 |
/stritch/radiology/socialmedia/ |
| cta |
203206 |
/stritch/radiology/cta/ |
| About |
92954 |
/stritch/radiology/about/ |
| Contact Us |
93186 |
/stritch/radiology/about/contactus/ |
| Medical Student |
93187 |
/stritch/radiology/about/medicalstudent/ |
| Elective Clerkship |
93188 |
/stritch/radiology/about/electiveclerkship/ |
| Programs |
93189 |
/stritch/radiology/about/programs/ |
| Quality and Safety |
93190 |
/stritch/radiology/about/programs/qualityandsafety/ |
| Informatics |
93191 |
/stritch/radiology/about/programs/informatics/ |
| Community Events |
93192 |
/stritch/radiology/about/programs/communityevents/ |
| Divisions / Specialties |
92943 |
/stritch/radiology/divisionsspecialties/ |
| Body Imaging |
92944 |
/stritch/radiology/divisionsspecialties/bodyimaging/ |
| Breast Imaging |
92945 |
/stritch/radiology/divisionsspecialties/breastimaging/ |
| Musculoskeletal |
92946 |
/stritch/radiology/divisionsspecialties/musculoskeletal/ |
| Neuroradiology |
92947 |
/stritch/radiology/divisionsspecialties/neuroradiology/ |
| Nuclear Medicine and Molecular Imaging |
92948 |
/stritch/radiology/divisionsspecialties/nuclearmedicineandmolecularimaging/ |
| Pediatric Radiology |
92949 |
/stritch/radiology/divisionsspecialties/pediatricradiology/ |
| Vascular and Interventional |
92950 |
/stritch/radiology/divisionsspecialties/vascularandinterventional/ |
| Residency / Fellowships |
92951 |
/stritch/radiology/residencyfellowships/ |
| Faculty |
92989 |
/stritch/radiology/faculty/ |
| profiles |
92990 |
/stritch/radiology/faculty/profiles/ |
| right_column |
203207 |
/stritch/radiology/faculty/profiles/rightcolumn/ |
| Research |
92952 |
/stritch/radiology/research/ |
| Services |
92953 |
https://www.loyolamedicine.org/radiology-services |
| Stritch - Registration & Records |
187378 |
/stritch/regrec/ |
| site_logo |
187379 |
/stritch/regrec/sitelogo/ |
| Footer |
187380 |
/stritch/regrec/footer/ |
| cta |
187381 |
/stritch/regrec/cta/ |
| social media |
187383 |
/stritch/regrec/socialmedia/ |
| Students |
187387 |
/stritch/regrec/students/ |
| Current Physicians-in-Training |
187388 |
/stritch/regrec/students/currentphysicians-in-training/ |
| Address or Name Change |
187390 |
/stritch/regrec/students/currentphysicians-in-training/addressornamechange/ |
| Clerkship Track System |
187391 |
/stritch/regrec/students/currentphysicians-in-training/clerkshiptracksystem/ |
| Graduation Requirements |
187392 |
/stritch/regrec/students/currentphysicians-in-training/graduationrequirements/ |
| Visiting Students |
187389 |
/stritch/regrec/students/visitingstudents/ |
| US Allopathic and Osteopathic Students |
187409 |
/stritch/regrec/students/visitingstudents/usallopathicandosteopathicstudents/ |
| International Students |
187410 |
/stritch/regrec/students/visitingstudents/internationalstudents/ |
| FAQs |
187411 |
/stritch/regrec/students/visitingstudents/faqs/ |
| Curriculum Overiew—LUMEN |
199600 |
/stritch/regrec/students/curriculumoveriewlumen/ |
| Elective Catalog |
187412 |
/stritch/regrec/electivecatalog/ |
| Introduction |
187413 |
/stritch/regrec/electivecatalog/introduction/ |
| Policies |
187414 |
/stritch/regrec/electivecatalog/policies/ |
| Course Catalog |
187415 |
/stritch/regrec/electivecatalog/coursecatalog/ |
| Anesthesiology |
187434 |
/stritch/regrec/electivecatalog/coursecatalog/anesthesiology/ |
| ANES 301 |
187743 |
/stritch/regrec/electivecatalog/coursecatalog/anesthesiology/anes301/ |
| ANES 401 |
187755 |
/stritch/regrec/electivecatalog/coursecatalog/anesthesiology/anes401/ |
| ANES 405 |
187756 |
/stritch/regrec/electivecatalog/coursecatalog/anesthesiology/anes405/ |
| ANES 410 |
187757 |
/stritch/regrec/electivecatalog/coursecatalog/anesthesiology/anes410/ |
| Bioethics & Professionalism |
187759 |
/stritch/regrec/electivecatalog/coursecatalog/bioethicsprofessionalism/ |
| BP 405 |
187760 |
/stritch/regrec/electivecatalog/coursecatalog/bioethicsprofessionalism/bp405/ |
| HON 401 |
187761 |
/stritch/regrec/electivecatalog/coursecatalog/bioethicsprofessionalism/hon401/ |
| Center for Community & Global Health |
187763 |
/stritch/regrec/electivecatalog/coursecatalog/centerforcommunityglobalhealth/ |
| CCGH 110 |
187764 |
/stritch/regrec/electivecatalog/coursecatalog/centerforcommunityglobalhealth/ccgh110/ |
| CCGH 120 |
187765 |
/stritch/regrec/electivecatalog/coursecatalog/centerforcommunityglobalhealth/ccgh120/ |
| CCGH 125 |
187766 |
/stritch/regrec/electivecatalog/coursecatalog/centerforcommunityglobalhealth/ccgh125/ |
| CCGH 200 |
187767 |
/stritch/regrec/electivecatalog/coursecatalog/centerforcommunityglobalhealth/ccgh200/ |
| CCGH 250 |
187769 |
/stritch/regrec/electivecatalog/coursecatalog/centerforcommunityglobalhealth/ccgh250/ |
| CCGH 275 |
187770 |
/stritch/regrec/electivecatalog/coursecatalog/centerforcommunityglobalhealth/ccgh275/ |
| CCGH 300 |
191771 |
/stritch/regrec/electivecatalog/coursecatalog/centerforcommunityglobalhealth/ccgh300/ |
| CCGH 301 |
187771 |
/stritch/regrec/electivecatalog/coursecatalog/centerforcommunityglobalhealth/ccgh301/ |
| CCGH 403 |
187772 |
/stritch/regrec/electivecatalog/coursecatalog/centerforcommunityglobalhealth/ccgh403/ |
| CCGH 405 |
187773 |
/stritch/regrec/electivecatalog/coursecatalog/centerforcommunityglobalhealth/ccgh405/ |
| CCGH 406 |
187774 |
/stritch/regrec/electivecatalog/coursecatalog/centerforcommunityglobalhealth/ccgh406/ |
| CCGH 407 |
187775 |
/stritch/regrec/electivecatalog/coursecatalog/centerforcommunityglobalhealth/ccgh407/ |
| CCGH 409 |
187776 |
/stritch/regrec/electivecatalog/coursecatalog/centerforcommunityglobalhealth/ccgh409/ |
| CCGH 410 |
187777 |
/stritch/regrec/electivecatalog/coursecatalog/centerforcommunityglobalhealth/ccgh410/ |
| CCGH 412 |
206264 |
/stritch/regrec/electivecatalog/coursecatalog/centerforcommunityglobalhealth/ccgh412/ |
| CCGH 450 |
187779 |
/stritch/regrec/electivecatalog/coursecatalog/centerforcommunityglobalhealth/ccgh450/ |
| CCGH 475 |
187780 |
/stritch/regrec/electivecatalog/coursecatalog/centerforcommunityglobalhealth/ccgh475/ |
| CCGH 490 |
195866 |
/stritch/regrec/electivecatalog/coursecatalog/centerforcommunityglobalhealth/ccgh490/ |
| CCGH 498 |
188816 |
/stritch/regrec/electivecatalog/coursecatalog/centerforcommunityglobalhealth/ccgh498/ |
| CCGH 499 |
187781 |
/stritch/regrec/electivecatalog/coursecatalog/centerforcommunityglobalhealth/ccgh499/ |
| Emergency Medicine |
187785 |
/stritch/regrec/electivecatalog/coursecatalog/emergencymedicine/ |
| EM 425 |
187786 |
/stritch/regrec/electivecatalog/coursecatalog/emergencymedicine/em425/ |
| EM 431 |
187787 |
/stritch/regrec/electivecatalog/coursecatalog/emergencymedicine/em431/ |
| EM 427 |
198548 |
/stritch/regrec/electivecatalog/coursecatalog/emergencymedicine/em427/ |
| Family Medicine |
187789 |
/stritch/regrec/electivecatalog/coursecatalog/familymedicine/ |
| FAMMED 401B |
187790 |
/stritch/regrec/electivecatalog/coursecatalog/familymedicine/fammed401b/ |
| FAMMED 401C |
187791 |
/stritch/regrec/electivecatalog/coursecatalog/familymedicine/fammed401c/ |
| FAMMED 406E |
187796 |
/stritch/regrec/electivecatalog/coursecatalog/familymedicine/fammed406e/ |
| FAMMED 408 |
187798 |
/stritch/regrec/electivecatalog/coursecatalog/familymedicine/fammed408/ |
| FAMMED 413B |
187801 |
/stritch/regrec/electivecatalog/coursecatalog/familymedicine/fammed413b/ |
| FAMMED 413D |
187802 |
/stritch/regrec/electivecatalog/coursecatalog/familymedicine/fammed413d/ |
| FAMMED 416 |
187805 |
/stritch/regrec/electivecatalog/coursecatalog/familymedicine/fammed416/ |
| FAMMED 430 |
187804 |
/stritch/regrec/electivecatalog/coursecatalog/familymedicine/fammed430/ |
| FAMMED 456 |
187803 |
/stritch/regrec/electivecatalog/coursecatalog/familymedicine/fammed456/ |
| Individually Designed Electives |
187941 |
/stritch/regrec/electivecatalog/coursecatalog/individuallydesignedelectives/ |
| Medical Education |
187808 |
/stritch/regrec/electivecatalog/coursecatalog/medicaleducation/ |
| MDED 175 |
187810 |
/stritch/regrec/electivecatalog/coursecatalog/medicaleducation/mded175/ |
| MDED 270 |
187822 |
/stritch/regrec/electivecatalog/coursecatalog/medicaleducation/mded270/ |
| MDED 275 |
187816 |
/stritch/regrec/electivecatalog/coursecatalog/medicaleducation/mded275/ |
| MDED 280 |
187820 |
/stritch/regrec/electivecatalog/coursecatalog/medicaleducation/mded280/ |
| MDED 350 |
187814 |
/stritch/regrec/electivecatalog/coursecatalog/medicaleducation/mded350/ |
| MDED 350.TA |
187819 |
/stritch/regrec/electivecatalog/coursecatalog/medicaleducation/mded350ta/ |
| MDED 380 |
187818 |
/stritch/regrec/electivecatalog/coursecatalog/medicaleducation/mded380/ |
| MDED 400 |
187812 |
/stritch/regrec/electivecatalog/coursecatalog/medicaleducation/mded400/ |
| MDED 420 |
187811 |
/stritch/regrec/electivecatalog/coursecatalog/medicaleducation/mded420/ |
| MDED 430 |
187809 |
/stritch/regrec/electivecatalog/coursecatalog/medicaleducation/mded430/ |
| MDED 440 |
187821 |
/stritch/regrec/electivecatalog/coursecatalog/medicaleducation/mded440/ |
| MDED 450 |
187817 |
/stritch/regrec/electivecatalog/coursecatalog/medicaleducation/mded450/ |
| MDED 460 |
187823 |
/stritch/regrec/electivecatalog/coursecatalog/medicaleducation/mded460/ |
| MDED 230 |
196313 |
/stritch/regrec/electivecatalog/coursecatalog/medicaleducation/mded230/ |
| MDED-180 |
197939 |
/stritch/regrec/electivecatalog/coursecatalog/medicaleducation/mded-180/ |
| MDED-190 |
203341 |
/stritch/regrec/electivecatalog/coursecatalog/medicaleducation/mded-190/ |
| MDED 290 |
203911 |
/stritch/regrec/electivecatalog/coursecatalog/medicaleducation/mded290/ |
| Medicine |
187824 |
/stritch/regrec/electivecatalog/coursecatalog/medicine/ |
| MED 401A |
187825 |
/stritch/regrec/electivecatalog/coursecatalog/medicine/med401a/ |
| MED 401D |
187826 |
/stritch/regrec/electivecatalog/coursecatalog/medicine/med401d/ |
| MED 408A |
187827 |
/stritch/regrec/electivecatalog/coursecatalog/medicine/med408a/ |
| MED 409 |
187828 |
/stritch/regrec/electivecatalog/coursecatalog/medicine/med409/ |
| MED 413 |
187829 |
/stritch/regrec/electivecatalog/coursecatalog/medicine/med413/ |
| MED 416 |
187830 |
/stritch/regrec/electivecatalog/coursecatalog/medicine/med416/ |
| MED 417 |
187831 |
/stritch/regrec/electivecatalog/coursecatalog/medicine/med417/ |
| MED 425 |
187832 |
/stritch/regrec/electivecatalog/coursecatalog/medicine/med425/ |
| MED 428 |
187833 |
/stritch/regrec/electivecatalog/coursecatalog/medicine/med428/ |
| MED 430 |
187834 |
/stritch/regrec/electivecatalog/coursecatalog/medicine/med430/ |
| MED 434 |
187835 |
/stritch/regrec/electivecatalog/coursecatalog/medicine/med434/ |
| MED 435 |
187836 |
/stritch/regrec/electivecatalog/coursecatalog/medicine/med435/ |
| MED 438 |
187837 |
/stritch/regrec/electivecatalog/coursecatalog/medicine/med438/ |
| MED 443 |
187838 |
/stritch/regrec/electivecatalog/coursecatalog/medicine/med443/ |
| MED 444A |
187839 |
/stritch/regrec/electivecatalog/coursecatalog/medicine/med444a/ |
| MED 444B |
187840 |
/stritch/regrec/electivecatalog/coursecatalog/medicine/med444b/ |
| MED 452 |
187841 |
/stritch/regrec/electivecatalog/coursecatalog/medicine/med452/ |
| MED 471 |
187846 |
/stritch/regrec/electivecatalog/coursecatalog/medicine/med471/ |
| MED 473 |
187848 |
/stritch/regrec/electivecatalog/coursecatalog/medicine/med473/ |
| Neurology |
187851 |
/stritch/regrec/electivecatalog/coursecatalog/neurology/ |
| NEURO 405 |
187852 |
/stritch/regrec/electivecatalog/coursecatalog/neurology/neuro405/ |
| NEURO 408 |
187853 |
/stritch/regrec/electivecatalog/coursecatalog/neurology/neuro408/ |
| NEURO 412 |
187854 |
/stritch/regrec/electivecatalog/coursecatalog/neurology/neuro412/ |
| Neurological Surgery |
187856 |
/stritch/regrec/electivecatalog/coursecatalog/neurologicalsurgery/ |
| NSURG 310 |
187857 |
/stritch/regrec/electivecatalog/coursecatalog/neurologicalsurgery/nsurg310/ |
| NSURG 410 |
187858 |
/stritch/regrec/electivecatalog/coursecatalog/neurologicalsurgery/nsurg410/ |
| Obstetrics & Gynecology |
187859 |
/stritch/regrec/electivecatalog/coursecatalog/obstetricsgynecology/ |
| OB/GYN 406 |
187860 |
/stritch/regrec/electivecatalog/coursecatalog/obstetricsgynecology/obgyn406/ |
| OB/GYN 408 |
187861 |
/stritch/regrec/electivecatalog/coursecatalog/obstetricsgynecology/obgyn408/ |
| OB/GYN 410B |
187863 |
/stritch/regrec/electivecatalog/coursecatalog/obstetricsgynecology/obgyn410b/ |
| OB/GYN 412 |
187864 |
/stritch/regrec/electivecatalog/coursecatalog/obstetricsgynecology/obgyn412/ |
| Office of Research Services |
187865 |
/stritch/regrec/electivecatalog/coursecatalog/officeofresearchservices/ |
| RES 401 |
187866 |
/stritch/regrec/electivecatalog/coursecatalog/officeofresearchservices/res401/ |
| Ophthalmology |
187867 |
/stritch/regrec/electivecatalog/coursecatalog/ophthalmology/ |
| OPHTHO 401 |
187868 |
/stritch/regrec/electivecatalog/coursecatalog/ophthalmology/ophtho401/ |
| OPSPEC 403 |
187869 |
/stritch/regrec/electivecatalog/coursecatalog/ophthalmology/opspec403/ |
| Oral & Maxillofacial Surgery |
187870 |
/stritch/regrec/electivecatalog/coursecatalog/oralmaxillofacialsurgery/ |
| OMS 401 |
187871 |
/stritch/regrec/electivecatalog/coursecatalog/oralmaxillofacialsurgery/oms401/ |
| OMS 402 |
187872 |
/stritch/regrec/electivecatalog/coursecatalog/oralmaxillofacialsurgery/oms402/ |
| Orthopaedic Surgery & Rehabilitation |
187873 |
/stritch/regrec/electivecatalog/coursecatalog/orthopaedicsurgeryrehabilitation/ |
| ORTHO 301 |
187874 |
/stritch/regrec/electivecatalog/coursecatalog/orthopaedicsurgeryrehabilitation/ortho301/ |
| ORTHO 404 |
187875 |
/stritch/regrec/electivecatalog/coursecatalog/orthopaedicsurgeryrehabilitation/ortho404/ |
| ORTHO 408 |
187876 |
/stritch/regrec/electivecatalog/coursecatalog/orthopaedicsurgeryrehabilitation/ortho408/ |
| ORTHO 410A |
187877 |
/stritch/regrec/electivecatalog/coursecatalog/orthopaedicsurgeryrehabilitation/ortho410a/ |
| Otolaryngology |
187879 |
/stritch/regrec/electivecatalog/coursecatalog/otolaryngology/ |
| ENT 301 |
187880 |
/stritch/regrec/electivecatalog/coursecatalog/otolaryngology/ent301/ |
| ENT 401 |
187881 |
/stritch/regrec/electivecatalog/coursecatalog/otolaryngology/ent401/ |
| ENTSP 404 |
187882 |
/stritch/regrec/electivecatalog/coursecatalog/otolaryngology/entsp404/ |
| PART-TIME ELECTIVES |
207375 |
/stritch/regrec/electivecatalog/schedulingreferences/part-timeelectives/ |
| Pathology |
187883 |
/stritch/regrec/electivecatalog/coursecatalog/pathology/ |
| PATH 403 |
187885 |
/stritch/regrec/electivecatalog/coursecatalog/pathology/path403/ |
| PATH 404 |
187886 |
/stritch/regrec/electivecatalog/coursecatalog/pathology/path404/ |
| PATH 405 |
187887 |
/stritch/regrec/electivecatalog/coursecatalog/pathology/path405/ |
| PATH 410 |
187888 |
/stritch/regrec/electivecatalog/coursecatalog/pathology/path410/ |
| Pediatrics |
187891 |
/stritch/regrec/electivecatalog/coursecatalog/pediatrics/ |
| PEDS 404 |
187892 |
/stritch/regrec/electivecatalog/coursecatalog/pediatrics/peds404/ |
| PEDS 409 |
187893 |
/stritch/regrec/electivecatalog/coursecatalog/pediatrics/peds409/ |
| PEDS 410 |
187894 |
/stritch/regrec/electivecatalog/coursecatalog/pediatrics/peds410/ |
| PEDS 411 |
187895 |
/stritch/regrec/electivecatalog/coursecatalog/pediatrics/peds411/ |
| PEDS 415 |
187896 |
/stritch/regrec/electivecatalog/coursecatalog/pediatrics/peds415/ |
| PEDS 416 |
187897 |
/stritch/regrec/electivecatalog/coursecatalog/pediatrics/peds416/ |
| PEDS 418 |
187900 |
/stritch/regrec/electivecatalog/coursecatalog/pediatrics/peds418/ |
| PEDS 450 |
187901 |
/stritch/regrec/electivecatalog/coursecatalog/pediatrics/peds450/ |
| Psychiatry & Behavioral Neurosciences |
187902 |
/stritch/regrec/electivecatalog/coursecatalog/psychiatrybehavioralneurosciences/ |
| PSY 407 |
187907 |
/stritch/regrec/electivecatalog/coursecatalog/psychiatrybehavioralneurosciences/psy407/ |
| PSY 408 |
187905 |
/stritch/regrec/electivecatalog/coursecatalog/psychiatrybehavioralneurosciences/psy408/ |
| PSY 409 |
187903 |
/stritch/regrec/electivecatalog/coursecatalog/psychiatrybehavioralneurosciences/psy409/ |
| PSY 415 |
187906 |
/stritch/regrec/electivecatalog/coursecatalog/psychiatrybehavioralneurosciences/psy415/ |
| Radiation Oncology |
187908 |
/stritch/regrec/electivecatalog/coursecatalog/radiationoncology/ |
| RT 401 |
187909 |
/stritch/regrec/electivecatalog/coursecatalog/radiationoncology/rt401/ |
| Radiology |
187910 |
/stritch/regrec/electivecatalog/coursecatalog/radiology/ |
| RAD 401 |
187911 |
/stritch/regrec/electivecatalog/coursecatalog/radiology/rad401/ |
| RAD 402 |
187912 |
/stritch/regrec/electivecatalog/coursecatalog/radiology/rad402/ |
| RAD 409 |
187913 |
/stritch/regrec/electivecatalog/coursecatalog/radiology/rad409/ |
| RAD 412 |
187915 |
/stritch/regrec/electivecatalog/coursecatalog/radiology/rad412/ |
| RAD 445 |
187914 |
/stritch/regrec/electivecatalog/coursecatalog/radiology/rad445/ |
| RAD 495 |
187916 |
/stritch/regrec/electivecatalog/coursecatalog/radiology/rad495/ |
| RAD 498 |
187917 |
/stritch/regrec/electivecatalog/coursecatalog/radiology/rad498/ |
| Surgery |
187918 |
/stritch/regrec/electivecatalog/coursecatalog/surgery/ |
| SURG 403 |
187919 |
/stritch/regrec/electivecatalog/coursecatalog/surgery/surg403/ |
| SURG 404 |
187920 |
/stritch/regrec/electivecatalog/coursecatalog/surgery/surg404/ |
| SURG 405 |
187921 |
/stritch/regrec/electivecatalog/coursecatalog/surgery/surg405/ |
| SURG 406 |
187922 |
/stritch/regrec/electivecatalog/coursecatalog/surgery/surg406/ |
| SURG 411 |
187923 |
/stritch/regrec/electivecatalog/coursecatalog/surgery/surg411/ |
| SURG 413 |
187924 |
/stritch/regrec/electivecatalog/coursecatalog/surgery/surg413/ |
| SURG 419 |
187925 |
/stritch/regrec/electivecatalog/coursecatalog/surgery/surg419/ |
| SURG 422 |
187926 |
/stritch/regrec/electivecatalog/coursecatalog/surgery/surg422/ |
| SURG 423 |
187927 |
/stritch/regrec/electivecatalog/coursecatalog/surgery/surg423/ |
| SURG 428 |
187928 |
/stritch/regrec/electivecatalog/coursecatalog/surgery/surg428/ |
| SURG 432 |
187930 |
/stritch/regrec/electivecatalog/coursecatalog/surgery/surg432/ |
| SURG 433 |
202377 |
/stritch/regrec/electivecatalog/coursecatalog/surgery/surg433/ |
| Thoracic & Cardiovascular Surgery |
187931 |
/stritch/regrec/electivecatalog/coursecatalog/thoraciccardiovascularsurgery/ |
| TCSURG 414 |
187932 |
/stritch/regrec/electivecatalog/coursecatalog/thoraciccardiovascularsurgery/tcsurg414/ |
| Urology |
187933 |
/stritch/regrec/electivecatalog/coursecatalog/urology/ |
| UROL 301 |
187937 |
/stritch/regrec/electivecatalog/coursecatalog/urology/urol301/ |
| UROL 401 |
187934 |
/stritch/regrec/electivecatalog/coursecatalog/urology/urol401/ |
| UROL 402 |
187935 |
/stritch/regrec/electivecatalog/coursecatalog/urology/urol402/ |
| UROL 403 |
187936 |
/stritch/regrec/electivecatalog/coursecatalog/urology/urol403/ |
| Specialty Elective Guide |
207377 |
/stritch/regrec/electivecatalog/specialtyelectiveguide/ |
| M4 Elective Timetable 2026-2027 |
207384 |
https://www.luc.edu/media/stritchschoolofmedicine/registrationandrecords/documents/M4%20Elective%20Timetable%202026-2027.pdf |
| M3 Elective Timetable 2026-2027 |
207385 |
https://www.luc.edu/media/stritchschoolofmedicine/registrationandrecords/documents/M3%20Elective%20Timetable%202026-2027.pdf |
| Specialty Elective Guide |
187416 |
/stritch/regrec/electivecatalog/specialtyelectiveguide/ |
| Anesthesiology |
187435 |
/stritch/regrec/electivecatalog/specialtyelectiveguide/anesthesiology/ |
| Dermatology |
187436 |
/stritch/regrec/electivecatalog/specialtyelectiveguide/dermatology/ |
| Emergency Medicine |
187437 |
/stritch/regrec/electivecatalog/specialtyelectiveguide/emergencymedicine/ |
| Family Medicine |
187438 |
/stritch/regrec/electivecatalog/specialtyelectiveguide/familymedicine/ |
| Internal Medicine |
187442 |
/stritch/regrec/electivecatalog/specialtyelectiveguide/internalmedicine/ |
| Med/Peds |
187440 |
/stritch/regrec/electivecatalog/specialtyelectiveguide/medpeds/ |
| Neurology |
187441 |
/stritch/regrec/electivecatalog/specialtyelectiveguide/neurology/ |
| Neurosurgery |
187444 |
/stritch/regrec/electivecatalog/specialtyelectiveguide/neurosurgery/ |
| Obstetrics and Gynecology |
187445 |
/stritch/regrec/electivecatalog/specialtyelectiveguide/obstetricsandgynecology/ |
| Ophthalmology |
187446 |
/stritch/regrec/electivecatalog/specialtyelectiveguide/ophthalmology/ |
| Orthopaedics |
187447 |
/stritch/regrec/electivecatalog/specialtyelectiveguide/orthopaedics/ |
| Otolaryngology |
187448 |
/stritch/regrec/electivecatalog/specialtyelectiveguide/otolaryngology/ |
| Pathology |
187449 |
/stritch/regrec/electivecatalog/specialtyelectiveguide/pathology/ |
| Pediatrics |
187450 |
/stritch/regrec/electivecatalog/specialtyelectiveguide/pediatrics/ |
| Preventive Medicine |
187451 |
/stritch/regrec/electivecatalog/specialtyelectiveguide/preventivemedicine/ |
| Physical Medicine and Rehabilitation |
187452 |
/stritch/regrec/electivecatalog/specialtyelectiveguide/physicalmedicineandrehabilitation/ |
| Psychiatry |
187453 |
/stritch/regrec/electivecatalog/specialtyelectiveguide/psychiatry/ |
| Radiology-Diagnostic |
187454 |
/stritch/regrec/electivecatalog/specialtyelectiveguide/radiology-diagnostic/ |
| Radiation Oncology |
187455 |
/stritch/regrec/electivecatalog/specialtyelectiveguide/radiationoncology/ |
| Surgery |
187456 |
/stritch/regrec/electivecatalog/specialtyelectiveguide/surgery/ |
| Urology |
187457 |
/stritch/regrec/electivecatalog/specialtyelectiveguide/urology/ |
| Vascular Surgery |
190787 |
/stritch/regrec/electivecatalog/specialtyelectiveguide/vascularsurgery/ |
| Pediatric Neurology |
190870 |
/stritch/regrec/electivecatalog/specialtyelectiveguide/pediatricneurology/ |
| Military |
190871 |
/stritch/regrec/electivecatalog/specialtyelectiveguide/military/ |
| Internal Medicine - Preliminary or Transitional Year |
191108 |
/stritch/regrec/electivecatalog/specialtyelectiveguide/internalmedicine-preliminaryortransitionalyear/ |
| Plastic Surgery |
191107 |
/stritch/regrec/electivecatalog/specialtyelectiveguide/plasticsurgery/ |
| Thoracic Surgery |
191106 |
/stritch/regrec/electivecatalog/specialtyelectiveguide/thoracicsurgery/ |
| Scheduling References |
187417 |
/stritch/regrec/electivecatalog/schedulingreferences/ |
| Away Rotation & M4 Scheduling FAQs |
191591 |
/stritch/regrec/electivecatalog/schedulingreferences/awayrotationm4schedulingfaqs/ |
| Part-time Electives |
191597 |
/stritch/regrec/electivecatalog/schedulingreferences/part-timeelectives/ |
| Storage |
187976 |
/stritch/regrec/electivecatalog/storage/ |
| CCGH-419 |
187979 |
/stritch/regrec/electivecatalog/storage/ccgh-419/ |
| FAMMED 406C |
187794 |
/stritch/regrec/electivecatalog/storage/fammed406c/ |
| MED 426 |
187845 |
/stritch/regrec/electivecatalog/storage/med426/ |
| MED 457 |
187842 |
/stritch/regrec/electivecatalog/storage/med457/ |
| MED 458 |
187995 |
/stritch/regrec/electivecatalog/storage/med458/ |
| PEDS 406 |
187899 |
/stritch/regrec/electivecatalog/storage/peds406/ |
| SURG 430 |
187929 |
/stritch/regrec/electivecatalog/storage/surg430/ |
| Academic Center for Excellence |
187978 |
/stritch/regrec/electivecatalog/storage/academiccenterforexcellence/ |
| ACE 300 |
187988 |
/stritch/regrec/electivecatalog/storage/academiccenterforexcellence/ace300/ |
| ACE 350 |
187989 |
/stritch/regrec/electivecatalog/storage/academiccenterforexcellence/ace350/ |
| Honors Program |
187977 |
/stritch/regrec/electivecatalog/storage/honorsprogram/ |
| Institute for Transformative Interprofessional Education |
187788 |
/stritch/regrec/electivecatalog/storage/institutefortransformativeinterprofessionaleducation/ |
| ITIE 100 |
187806 |
/stritch/regrec/electivecatalog/storage/institutefortransformativeinterprofessionaleducation/itie100/ |
| Public Health Sciences |
187980 |
/stritch/regrec/electivecatalog/storage/publichealthsciences/ |
| CCGH 411 |
187778 |
/stritch/regrec/electivecatalog/storage/ccgh411/ |
| MED 487 |
187843 |
/stritch/regrec/electivecatalog/storage/med487/ |
| Faculty and Staff |
187419 |
/stritch/regrec/facultyandstaff/ |
| Forms |
187426 |
/stritch/regrec/forms/ |
| Alumni Services |
187427 |
/stritch/regrec/alumniservices/ |
| Overview |
187428 |
/stritch/regrec/alumniservices/overview/ |
| Degree Verification |
187429 |
/stritch/regrec/alumniservices/degreeverification/ |
| Diploma Replacement |
187430 |
/stritch/regrec/alumniservices/diplomareplacement/ |
| Transcript Request |
187431 |
/stritch/regrec/alumniservices/transcriptrequest/ |
| Academic Calendars |
190845 |
/stritch/regrec/academiccalendars/ |
| Academic Calendars Secure |
193774 |
/stritch/regrec/academiccalendarssecure/ |
| First Year Academic Calendar 2026-2027 |
193775 |
/stritch/regrec/academiccalendarssecure/firstyearacademiccalendar2026-2027/ |
| Second Year Academic Calendar 2026-2027 |
193776 |
/stritch/regrec/academiccalendarssecure/secondyearacademiccalendar2026-2027/ |
| Third Year Academic Calendar 2026-2027 (Schedule A) |
193777 |
/stritch/regrec/academiccalendarssecure/thirdyearacademiccalendar2026-2027schedulea/ |
| Third Year Academic Calendar 2026-2027 (Schedule B) |
193778 |
/stritch/regrec/academiccalendarssecure/thirdyearacademiccalendar2026-2027scheduleb/ |
| Fourth Year Academic Calendar 2026-2027 |
193779 |
/stritch/regrec/academiccalendarssecure/fourthyearacademiccalendar2026-2027/ |
| First Year Academic Calendar 2025-2026 |
193780 |
/stritch/regrec/academiccalendarssecure/firstyearacademiccalendar2025-2026/ |
| Second Year Academic Calendar 2025-2026 |
193781 |
/stritch/regrec/academiccalendarssecure/secondyearacademiccalendar2025-2026/ |
| Third Year Academic Calendar 2025-2026 (Schedule A) |
193782 |
/stritch/regrec/academiccalendarssecure/thirdyearacademiccalendar2025-2026schedulea/ |
| Third Year Academic Calendar 2025-2026 (Schedule B) |
193783 |
/stritch/regrec/academiccalendarssecure/thirdyearacademiccalendar2025-2026scheduleb/ |
| Fourth Year Academic Calendar 2025-2026 |
193784 |
/stritch/regrec/academiccalendarssecure/fourthyearacademiccalendar2025-2026/ |
| Stritch - Surgery |
77649 |
/stritch/surgery/ |
| site_logo |
203258 |
/stritch/surgery/sitelogo/ |
| Footer |
203259 |
/stritch/surgery/footer/ |
| social media |
203261 |
/stritch/surgery/socialmedia/ |
| cta |
203262 |
/stritch/surgery/cta/ |
| About |
77763 |
/stritch/surgery/about/ |
| Mission |
77715 |
/stritch/surgery/about/mission/ |
| Diversity, Equity, & Inclusion |
161435 |
/stritch/surgery/about/diversityequityinclusion/ |
| Diversity in Surgery Visiting Sub-Internship Program |
161932 |
/stritch/surgery/about/diversityequityinclusion/diversityinsurgeryvisitingsub-internshipprogram/ |
| Women in Surgery Group |
161933 |
/stritch/surgery/about/diversityequityinclusion/womeninsurgerygroup/ |
| Annual Women in Surgery Visiting Lectureship |
161934 |
/stritch/surgery/about/diversityequityinclusion/annualwomeninsurgeryvisitinglectureship/ |
| DEI Resources |
161935 |
/stritch/surgery/about/diversityequityinclusion/deiresources/ |
| Loyola Medicine Health Equity Visiting Clerkship and Scholarship |
168270 |
https://www.loyolamedicine.org/gme/health-equity-visiting-clerkship |
| Endowment Fund |
77709 |
/stritch/surgery/about/endowmentfund/ |
| Virtual Library |
77744 |
/stritch/surgery/about/virtuallibrary/ |
| Divisions / Specialties |
77706 |
/stritch/surgery/divisionsspecialties/ |
| General Surgery |
77711 |
/stritch/surgery/divisionsspecialties/generalsurgery/ |
| Endocrine Surgery |
77708 |
/stritch/surgery/divisionsspecialties/generalsurgery/endocrinesurgery/ |
| Pediatric Surgery |
77719 |
/stritch/surgery/divisionsspecialties/generalsurgery/pediatricsurgery/ |
| Plastic and Reconstructive Surgery |
77720 |
/stritch/surgery/divisionsspecialties/plasticandreconstructivesurgery/ |
| Colon and Rectal Surgery |
77701 |
/stritch/surgery/divisionsspecialties/colonandrectalsurgery/ |
| right_column |
77764 |
/stritch/surgery/divisionsspecialties/colonandrectalsurgery/rightcolumn/ |
| Intra-abdominal Transplantation |
77714 |
/stritch/surgery/divisionsspecialties/intra-abdominaltransplantation/ |
| GI / Minimally Invasive Surgery |
77713 |
/stritch/surgery/divisionsspecialties/giminimallyinvasivesurgery/ |
| Surgical Oncology |
77739 |
/stritch/surgery/divisionsspecialties/surgicaloncology/ |
| Vascular Surgery and Endovascular Therapy |
77742 |
/stritch/surgery/divisionsspecialties/vascularsurgeryandendovasculartherapy/ |
| Trauma, Surgical Critical Care, and Burns |
77741 |
/stritch/surgery/divisionsspecialties/traumasurgicalcriticalcareandburns/ |
| Oral and Maxillofacial Surgery |
77717 |
/stritch/surgery/divisionsspecialties/oralandmaxillofacialsurgery/ |
| Dental Medicine |
154682 |
https://loyolamedicine.org/gme/dental-medicine-general-residency |
| Surgical Research |
77740 |
/stritch/surgery/divisionsspecialties/surgicalresearch/ |
| Residency / Fellowships |
77722 |
/stritch/surgery/residencyfellowships/ |
| Diversity Clerkship in Trauma and Burn Care and Research |
89883 |
/stritch/surgery/residencyfellowships/diversityclerkshipintraumaandburncareandresearch/ |
| right_column |
89884 |
/stritch/surgery/residencyfellowships/diversityclerkshipintraumaandburncareandresearch/rightcolumn/ |
| NIH Training Grant |
89886 |
/stritch/surgery/residencyfellowships/nihtraininggrant/ |
| Research |
77707 |
/stritch/surgery/research/ |
| right_column |
88724 |
/stritch/surgery/research/rightcolumn/ |
| Faculty |
88391 |
/stritch/surgery/faculty/ |
| profiles |
203263 |
/stritch/surgery/faculty/profiles/ |
| Services |
88390 |
https://www.loyolamedicine.org/surgical-services |
| Stritch - Thoracic and Cardiovascular Surgery |
85031 |
/stritch/tcvs/ |
| site_logo |
203299 |
/stritch/tcvs/sitelogo/ |
| Footer |
203300 |
/stritch/tcvs/footer/ |
| social media |
203302 |
/stritch/tcvs/socialmedia/ |
| cta |
203303 |
/stritch/tcvs/cta/ |
| About |
85046 |
/stritch/tcvs/about/ |
| Chair's Message |
85099 |
/stritch/tcvs/about/chairsmessage/ |
| Events |
85103 |
/stritch/tcvs/about/events/ |
| Contact Us |
85102 |
/stritch/tcvs/about/contactus/ |
| Make A Gift |
85101 |
https://loyolauniversitychicago3.my.site.com/ascendportal/s/give?appeal=25Y02 |
| Residency / Fellowships |
85043 |
/stritch/tcvs/residencyfellowships/ |
| Research |
85044 |
/stritch/tcvs/research/ |
| Basic Science Research |
85689 |
/stritch/tcvs/research/basicscienceresearch/ |
| Active Clinical Trials |
85690 |
/stritch/tcvs/research/activeclinicaltrials/ |
| right_column |
85692 |
/stritch/tcvs/research/activeclinicaltrials/rightcolumn/ |
| Enrolling CV Trials |
85691 |
/stritch/tcvs/research/enrollingcvtrials/ |
| right_column |
85385 |
/stritch/tcvs/research/rightcolumn/ |
| Faculty |
85045 |
/stritch/tcvs/faculty/ |
| profiles |
203304 |
/stritch/tcvs/faculty/profiles/ |
| Services |
85042 |
http://www.loyolamedicine.org/heart-vascular |
| Stritch - Urology |
92393 |
/stritch/urology/ |
| site_logo |
203322 |
/stritch/urology/sitelogo/ |
| Footer |
203323 |
/stritch/urology/footer/ |
| social media |
203325 |
/stritch/urology/socialmedia/ |
| cta |
203326 |
/stritch/urology/cta/ |
| right_column |
203328 |
/stritch/urology/rightcolumn/ |
| About |
92406 |
/stritch/urology/about/ |
| Message from the Chair |
92412 |
/stritch/urology/about/messagefromthechair/ |
| Mission Statement |
92413 |
/stritch/urology/about/missionstatement/ |
| Our Facilities |
92414 |
/stritch/urology/about/ourfacilities/ |
| Locations & Maps |
92415 |
/stritch/urology/about/locationsmaps/ |
| Chicago Area Information |
92416 |
/stritch/urology/about/chicagoareainformation/ |
| Giving |
92417 |
/stritch/urology/about/giving/ |
| News |
92419 |
/stritch/urology/about/news/ |
| Divisions / Specialties |
92399 |
/stritch/urology/divisionsspecialties/ |
| Cancer / Oncology |
92449 |
/stritch/urology/divisionsspecialties/canceroncology/ |
| Endourology and Laparoscopic Surgery |
92450 |
/stritch/urology/divisionsspecialties/endourologyandlaparoscopicsurgery/ |
| Female Pelvic Medicine and Reconstructive Surgery |
92451 |
/stritch/urology/divisionsspecialties/femalepelvicmedicineandreconstructivesurgery/ |
| General Urology |
92452 |
/stritch/urology/divisionsspecialties/generalurology/ |
| Minimally Invasive Surgery and Robotics |
92454 |
/stritch/urology/divisionsspecialties/minimallyinvasivesurgeryandrobotics/ |
| Neurourology |
92455 |
/stritch/urology/divisionsspecialties/neurourology/ |
| Pediatric Urology |
92456 |
/stritch/urology/divisionsspecialties/pediatricurology/ |
| Renal (Kidney) Transplantation |
92457 |
/stritch/urology/divisionsspecialties/renalkidneytransplantation/ |
| Urologic Trauma and Reconstruction |
92458 |
/stritch/urology/divisionsspecialties/urologictraumaandreconstruction/ |
| Residency / Fellowships |
92400 |
/stritch/urology/residencyfellowships/ |
| Research |
92401 |
/stritch/urology/research/ |
| Current Research Projects |
92420 |
/stritch/urology/research/currentresearchprojects/ |
| Faculty |
92402 |
/stritch/urology/faculty/ |
| profiles |
92404 |
/stritch/urology/faculty/profiles/ |
| Services |
92405 |
https://www.loyolamedicine.org/urology |
| Contact Us |
92408 |
/stritch/urology/contactus/ |
| Student Academic Services |
101189 |
/sas/ |
| site_logo |
101193 |
/sas/sitelogo/ |
| social media |
101194 |
/sas/socialmedia/ |
| Footer |
198785 |
/sas/footer/ |
| modules-programming |
101190 |
/sas/modules-programming/ |
| About Us |
101195 |
/sas/aboutus/ |
| Mission, Vision, and Values |
101199 |
/sas/aboutus/missionvisionandvalues/ |
| Stories & News |
198779 |
/sas/aboutus/storiesnews/ |
| archive |
198780 |
/sas/aboutus/storiesnews/archive/ |
| Staff Directory |
200727 |
/sas/aboutus/staffdirectory/ |
| Departments |
101197 |
/sas/departments/ |
| First and Second Year Advising |
101206 |
http://luc.edu/fsya/ |
| New Student Programs |
101210 |
http://luc.edu/nsp/ |
| Scholars Programs |
101203 |
https://www.luc.edu/scholarsprograms/ |
| Student Accessibility Center |
101208 |
http://luc.edu/sac/ |
| Student-Athlete Academic Services |
102440 |
http://www.luc.edu/athleteadvising/index.shtml |
| Tutoring Center |
101204 |
http://luc.edu/tutoring/ |
| Resources |
149775 |
/sas/resources/ |
| Resource Rundown |
152156 |
/sas/resources/resourcerundown/ |
| Summer Get On Track |
151938 |
/sas/resources/sgot/ |
| Student Accessibility Center |
17236 |
/sac/ |
| site_logo |
17243 |
/sac/site_logo/ |
| Apply with SAC |
71496 |
/sac/applywithsac/ |
| Housing Information |
146853 |
/sac/applywithsac/housinginformation/ |
| Documentation Guidelines |
101690 |
/sac/applywithsac/documentationguidelines/ |
| Assistance for Temporary Disabilities |
184997 |
/sac/applywithsac/assistancefortemporarydisabilities/ |
| Questions About Temporary Assistance? |
184998 |
/sac/applywithsac/assistancefortemporarydisabilities/questionsabouttemporaryassistance/ |
| Stritch School of Medicine |
101522 |
/sac/applywithsac/stritchschoolofmedicine/ |
| Students |
201378 |
/sac/students/ |
| Faculty |
101306 |
/sac/faculty/ |
| Faculty Role |
105039 |
/sac/faculty/facultyrole/ |
| Facilitating Accommodations |
105040 |
/sac/faculty/facilitatingaccommodations/ |
| Implementing Testing Accommodations |
106961 |
/sac/faculty/facilitatingaccommodations/implementingtestingaccommodations/ |
| Implementing Note Taking Accommodations |
106962 |
/sac/faculty/facilitatingaccommodations/implementingnotetakingaccommodations/ |
| Implementing Accommodations for Students with Hearing Impairments |
106963 |
/sac/faculty/facilitatingaccommodations/implementingaccommodationsforstudentswithhearingimpairments/ |
| Testing and Final Exam Accommodations |
106639 |
/sac/faculty/testingandfinalexamaccommodations/ |
| Accessibility Guidelines |
110840 |
/sac/faculty/accessibilityguidelines/ |
| Panopto Accessibility |
110847 |
/sac/faculty/accessibilityguidelines/panoptoaccessibility/ |
| PowerPoint Accessibility |
110846 |
/sac/faculty/accessibilityguidelines/powerpointaccessibility/ |
| Sakai Accessibility |
110845 |
/sac/faculty/accessibilityguidelines/sakaiaccessibility/ |
| VoiceThread Accessibility |
110844 |
/sac/faculty/accessibilityguidelines/voicethreadaccessibility/ |
| Word Accessibility |
110843 |
/sac/faculty/accessibilityguidelines/wordaccessibility/ |
| Glossary |
110841 |
/sac/faculty/accessibilityguidelines/glossary/ |
| FAQ |
195930 |
/sac/faculty/faq/ |
| Forms and Policies & Procedures |
187758 |
/sac/formsandpoliciesprocedures/ |
| SAC Newsletters |
191316 |
/sac/sacnewsletters/ |
| modules-programming |
198886 |
/sac/modules-programming/ |
| cta |
199187 |
/sac/cta/ |
| social media |
199189 |
/sac/socialmedia/ |
| Footer |
17246 |
/sac/footer/ |
| Student Academic Services |
202512 |
/sac/studentacademicservices/ |
| First and Second Year Advising |
202514 |
https://www.luc.edu/fsya/index.shtml |
| New Student Programs |
202516 |
https://www.luc.edu/nsp/index.shtml |
| Scholars Programs |
202515 |
https://www.luc.edu/scholarsprograms/ |
| Student-Athlete Academic Services |
202517 |
https://www.luc.edu/athleteadvising |
| Tutoring Center |
202513 |
https://www.luc.edu/tutoring |
| Student Complex |
71637 |
/studentcomplex/ |
| About Us |
72357 |
/studentcomplex/aboutus/ |
| AVP's Welcome |
72465 |
/studentcomplex/aboutus/avpswelcome/ |
| Contact Us |
72387 |
/studentcomplex/aboutus/contactus/ |
| Profiles |
202978 |
/studentcomplex/aboutus/contactus/profiles/ |
| Mission and Vision |
81779 |
/studentcomplex/aboutus/missionandvision/ |
| Reservations |
71684 |
/studentcomplex/aboutus/reservations/ |
| Important Links |
72469 |
/campus_reservations/importantlinks/ |
| Policies and Procedures |
72470 |
/campus_reservations/policiesandprocedures/ |
| 25Live |
72471 |
/campus_reservations/25livepro/ |
| Contact Us |
83363 |
/campus_reservations/importantlinks/contactus/ |
| Student Centers |
71696 |
/studentcomplex/studentcenters/ |
| Damen Student Center |
71697 |
/damenstudentcenter/index.shtml |
| Terry Student Center |
83003 |
/tsc/ |
| Halas Rec Center |
71683 |
/studentcomplex/halasreccenter/ |
| Overview & FAQ's |
72472 |
/studentcomplex/halasreccenter/overviewfaqs/ |
| Facility Features |
82992 |
/studentcomplex/halasreccenter/facilityfeatures/ |
| Directions and Parking |
83000 |
/studentcomplex/halasreccenter/directionsandparking/ |
| Rental Information |
83001 |
/studentcomplex/halasreccenter/rentalinformation/ |
| Policies |
83002 |
/studentcomplex/halasreccenter/policies/ |
| Gentile Arena |
71685 |
/studentcomplex/gentilearena/ |
| Overview & FAQs |
71689 |
/studentcomplex/gentilearena/overviewfaqs/ |
| Directions and Parking |
72457 |
/studentcomplex/gentilearena/directionsandparking/ |
| Box Office |
72458 |
/studentcomplex/gentilearena/boxoffice/ |
| Rental Information |
72461 |
/studentcomplex/gentilearena/rentalinformation/ |
| Arena Policies |
72463 |
/studentcomplex/gentilearena/arenapolicies/ |
| Fan Code of Conduct |
72464 |
/studentcomplex/gentilearena/fancodeofconduct/ |
| Outdoor |
71690 |
/studentcomplex/outdoor/ |
| Hoyne Field |
71691 |
/studentcomplex/outdoor/hoynefield/ |
| Sean Earl Field |
71692 |
/studentcomplex/outdoor/seanearlfield/ |
| West Quad |
71694 |
/studentcomplex/outdoor/westquad/ |
| Winthrop Playlot |
71695 |
/studentcomplex/outdoor/winthropplaylot/ |
| Footer |
71640 |
/studentcomplex/footer/ |
| site_logo |
202970 |
/studentcomplex/sitelogo/ |
| News |
71643 |
/studentcomplex/news/ |
| modules-programming |
202974 |
/studentcomplex/modules-programming/ |
| documents |
202986 |
/studentcomplex/documents/ |
| Student Employment & Work-Study |
194154 |
/career/studentemployment/ |
| social media |
194202 |
/career/studentemployment/socialmedia/ |
| site_logo |
194156 |
/career/studentemployment/sitelogo/ |
| Footer |
194155 |
/career/studentemployment/footer/ |
| Student Employment |
194157 |
/career/studentemployment/studentemployment/ |
| FAQs |
194161 |
/career/studentemployment/studentemployment/faqs/ |
| Videos |
194165 |
/career/studentemployment/studentemployment/videos/ |
| Contact Us |
194158 |
/career/studentemployment/studentemployment/contactus/ |
| Internship Credit |
194160 |
/career/studentemployment/studentemployment/internshipcredit/ |
| Manager Updates |
194159 |
/career/studentemployment/studentemployment/managerupdates/ |
| right_column |
194164 |
/career/studentemployment/studentemployment/rightcolumn/ |
| Student Resources |
194167 |
/career/studentemployment/studentresources/ |
| Job Search Steps |
194173 |
/career/studentemployment/studentresources/jobsearchsteps/ |
| Understand Work-Study |
194170 |
/career/studentemployment/studentresources/understandwork-study/ |
| Safety & Work |
194168 |
/career/studentemployment/studentresources/safetywork/ |
| Other Career Services |
194172 |
/career/studentemployment/studentresources/othercareerservices/ |
| right_column |
194228 |
/career/studentemployment/studentresources/rightcolumn/ |
| Manager Resources |
194175 |
/career/studentemployment/managerresources/ |
| Hiring Overview |
194176 |
/career/studentemployment/managerresources/hiringoverview/ |
| Manager Support |
194177 |
/career/studentemployment/managerresources/managersupport/ |
| GROW at Loyola |
204516 |
/career/studentemployment/managerresources/growatloyola/ |
| Marketing Your Position |
194178 |
/career/studentemployment/managerresources/marketingyourposition/ |
| Work-Study 101 |
194179 |
/career/studentemployment/managerresources/work-study101/ |
| Policy & Guidelines |
194180 |
/career/studentemployment/managerresources/policyguidelines/ |
| right_column |
194234 |
/career/studentemployment/managerresources/rightcolumn/ |
| Community Work-Study |
194182 |
/career/studentemployment/communitywork-study/ |
| Reimbursement |
194183 |
/career/studentemployment/communitywork-study/reimbursement/ |
| Manager Support |
194230 |
/career/studentemployment/managerresources/managersupport/ |
| Marketing Your Position |
194231 |
/career/studentemployment/managerresources/marketingyourposition/ |
| Work-Study 101 |
194184 |
/career/studentemployment/communitywork-study/work-study101/ |
| Student Recognition Programs |
194195 |
/career/studentemployment/studentrecognitionprograms/ |
| National Student Employment Week |
194196 |
/career/studentemployment/studentrecognitionprograms/nationalstudentemploymentweek/ |
| Student Government of Loyola Chicago |
28207 |
/sglc/ |
| site_logo |
202623 |
/sglc/sitelogo/ |
| Footer |
28210 |
/sglc/footer/ |
| About Us |
30753 |
/sglc/aboutus/ |
| Budget |
30769 |
/sglc/aboutus/budget/ |
| Structure |
30754 |
/sglc/structure/ |
| Senate Meetings |
200513 |
/sglc/structure/senatemeetings/ |
| Join SGLC |
101805 |
/sglc/joinsglc/ |
| How do Elections Work? |
124204 |
/sglc/joinsglc/howdoelectionswork/ |
| Learn More about the Three Branches |
156354 |
/sglc/joinsglc/learnmoreaboutthethreebranches/ |
| Committees |
124216 |
/sglc/joinsglc/learnmoreaboutthethreebranches/committees/ |
| Open Positions |
159048 |
/sglc/joinsglc/openpositions/ |
| DSD Areas |
186720 |
/sglc/dsdareas/ |
| Campus Recreation |
186721 |
/campusrec/ |
| Campus Reservations |
186722 |
/campus_reservations/ |
| Community Coalition on Gender-Based Violence |
186726 |
/coalition/ |
| Conference Services |
186727 |
/conference/index.shtml |
| CTA U-Pass |
186728 |
/upass/ |
| Damen Student Center |
186730 |
/damenstudentcenter/index.shtml |
| Family Weekend |
186732 |
/familyweekend/ |
| Graduate, Professional, and Adult Student Life |
186733 |
/gpasl/ |
| Loyola University Museum of Art |
186734 |
/luma/ |
| Office of Student Conduct and Conflict Resolution |
186735 |
/osccr/ |
| Student Government |
186737 |
/sglc/ |
| Terry Student Center |
186738 |
/tsc/ |
| Wellness Center |
186740 |
/wellness/ |
| Resources |
202637 |
/sglc/resources/ |
| Press and Media |
124634 |
/sglc/resources/pressandmedia/ |
| Past Press and Media |
159044 |
/sglc/resources/pressandmedia/pastpressandmedia/ |
| 2019-2020 Press and Media |
147895 |
/sglc/resources/pressandmedia/pastpressandmedia/2019-2020pressandmedia/ |
| Press Release: On behalf of Student Government of Loyola University Chicago |
128624 |
/sglc/resources/pressandmedia/pastpressandmedia/2019-2020pressandmedia/pressreleaseonbehalfofstudentgovernmentofloyolauniversitychicago/ |
| Press Release: On behalf of the Spring Elections Committee |
128625 |
/sglc/resources/pressandmedia/pastpressandmedia/2019-2020pressandmedia/pressreleaseonbehalfofthespringelectionscommittee/ |
| Press Release: Announcement of the Provost |
126836 |
/sglc/resources/pressandmedia/pastpressandmedia/2019-2020pressandmedia/pressreleaseannouncementoftheprovost/ |
| Press Release: Acknowledging Sexual and Gender Based Violence |
126444 |
/sglc/resources/pressandmedia/pastpressandmedia/2019-2020pressandmedia/pressreleaseacknowledgingsexualandgenderbasedviolence/ |
| Press Release: Acknowledging Trans Lives |
126443 |
/sglc/resources/pressandmedia/pastpressandmedia/2019-2020pressandmedia/pressreleaseacknowledgingtranslives/ |
| In Support of the Dream Act of 2019 |
126442 |
/sglc/resources/pressandmedia/pastpressandmedia/2019-2020pressandmedia/insupportofthedreamactof2019/ |
| 2020-2021 Press and Media |
149841 |
/sglc/resources/pressandmedia/pastpressandmedia/2020-2021pressandmedia/ |
| Press Release: SGLC Support for International Students |
149842 |
/sglc/resources/pressandmedia/pastpressandmedia/2020-2021pressandmedia/pressreleasesglcsupportforinternationalstudents/ |
| Chicago Sun-Times Article |
152110 |
/sglc/resources/pressandmedia/pastpressandmedia/2020-2021pressandmedia/chicagosun-timesarticle/ |
| Chicago Tribune Article |
154013 |
/sglc/resources/pressandmedia/pastpressandmedia/2020-2021pressandmedia/chicagotribunearticle/ |
| Building Bridges: Statement Following Events on 6/2/20 |
154342 |
/sglc/resources/pressandmedia/pastpressandmedia/2020-2021pressandmedia/buildingbridgesstatementfollowingeventson6220/ |
| SGLC Signature on BCC Action Items |
154350 |
/sglc/resources/pressandmedia/pastpressandmedia/2020-2021pressandmedia/sglcsignatureonbccactionitems/ |
| Recognizing Indigenous Peoples' Day |
155384 |
/sglc/resources/pressandmedia/pastpressandmedia/2020-2021pressandmedia/recognizingindigenouspeoplesday/ |
| In Lieu of Accountability: How Black Loyola Students Work For Inclusivity |
156251 |
/sglc/resources/pressandmedia/pastpressandmedia/2020-2021pressandmedia/inlieuofaccountabilityhowblackloyolastudentsworkforinclusivity/ |
| Recognizing Black History Month 2021 |
158261 |
/sglc/resources/pressandmedia/pastpressandmedia/2020-2021pressandmedia/recognizingblackhistorymonth2021/ |
| Statement in Solidarity with the AAPI Community |
159351 |
/sglc/resources/pressandmedia/pastpressandmedia/2020-2021pressandmedia/statementinsolidaritywiththeaapicommunity/ |
| Statement Regarding Police Brutality & Anti-Blackness |
159433 |
/sglc/resources/pressandmedia/pastpressandmedia/2020-2021pressandmedia/statementregardingpolicebrutalityanti-blackness/ |
| Statement Addressing Allyship |
159434 |
/sglc/resources/pressandmedia/pastpressandmedia/2020-2021pressandmedia/statementaddressingallyship/ |
| March Madness and COVID-19 Responsibility |
159494 |
/sglc/resources/pressandmedia/pastpressandmedia/2020-2021pressandmedia/marchmadnessandcovid-19responsibility/ |
| Present Press and Media |
159821 |
/sglc/resources/pressandmedia/presentpressandmedia/ |
| Documents and Forms |
198533 |
/sglc/resources/documentsandforms/ |
| Forms |
198535 |
/sglc/resources/documentsandforms/forms/ |
| Archive |
58742 |
/sglc/resources/documentsandforms/archive/ |
| site_home_slideshow |
28209 |
/sglc/resources/documentsandforms/archive/sitehomeslideshow/ |
| home_right_column |
28211 |
/sglc/resources/documentsandforms/archive/homerightcolumn/ |
| documents |
116859 |
/sglc/documents/ |
| Student-Athlete Academic Services |
16143 |
/athleteadvising/index.shtml |
| About Us |
16144 |
/athleteadvising/about_us.shtml |
| Norville Academic Center Staff |
104412 |
/athleteadvising/norvilleacademiccenterstaff/ |
| Services Offered |
160424 |
/athleteadvising/servicesoffered/ |
| UNIV 101 |
16148 |
/athleteadvising/first_year.shtml |
| Sport Eligibility |
16154 |
/athleteadvising/sport_eligibility.shtml |
| Resources |
16187 |
/athleteadvising/resources.shtml |
| Academic Success Tools |
31920 |
/athleteadvising/academicsuccesstools/ |
| Upcoming Events |
16191 |
/athleteadvising/upcoming_events.shtml |
| Photos |
18198 |
/athleteadvising/photos/ |
| Footer |
16208 |
/athleteadvising/footer/ |
| site_logo |
16209 |
/athleteadvising/sitelogo/ |
| Travel & Competition Excusal Policy |
199622 |
/athleteadvising/academics.shtml |
| Travel & Competition Policy |
199626 |
/athleteadvising/travelcompetitionpolicy/ |
| Student Academic Services |
202518 |
/athleteadvising/studentacademicservices/ |
| Scholars Programs |
202521 |
https://www.luc.edu/scholarsprograms/ |
| Student Accessibility Center |
202523 |
https://www.luc.edu/sac/ |
| Tutoring Center |
202519 |
https://www.luc.edu/tutoring |
| Student Success |
202329 |
/studentsuccess/ |
| site_logo |
202333 |
/studentsuccess-dev/sitelogo/ |
| Footer |
202334 |
/studentsuccess-dev/footer/ |
| About |
202571 |
/studentsuccess-dev/about/ |
| Welcome |
203666 |
/studentsuccess/about/welcome/ |
| Vision and Mission |
203661 |
/studentsuccess-dev/about/visionandmission/ |
| Org Chart |
204006 |
https://www.luc.edu/media/lucedu/officeofstudentsuccess/Student_Success_Org_Charts.pdf |
| Leadership staff directory |
204352 |
/studentsuccess/about/leadershipstaffdirectory/ |
| Profiles |
204353 |
/studentsuccess/about/leadershipstaffdirectory/profiles/ |
| Stay Connected |
202330 |
/studentsuccess-dev/stayconnected/ |
| Student Outcomes |
202806 |
/studentsuccess-dev/studentoutcomes/ |
| Framework |
202350 |
/studentsuccess-dev/framework/ |
| 2024-25 Annual Report |
202332 |
/studentsuccess/studentoutcomes/2024-25annualreport/ |
| Career Outcomes |
204036 |
/career/about/careeroutcomes/ |
| Academic and Career Mapping for First Years |
203999 |
/studentsuccess/academicandcareermappingforfirstyears/ |
| Middle Years Academic and Career Mapping |
203656 |
/studentsuccess/academicandcareermappingforfirstyears/middleyearsacademicandcareermapping/ |
| Last Year Academic and Career Mapping |
204000 |
/studentsuccess/academicandcareermappingforfirstyears/lastyearacademicandcareermapping/ |
| documents |
204005 |
/studentsuccess-dev/documents/ |
| Study Abroad |
185369 |
/studyabroad/ |
| site_logo |
185370 |
/studyabroad-dev2025/sitelogo/ |
| Footer |
185371 |
/studyabroad-dev2025/footer/ |
| social media |
185404 |
/studyabroad-dev2025/socialmedia/ |
| cta |
204117 |
/studyabroad-dev2025/cta/ |
| I Links |
185405 |
/studyabroad-dev2025/ilinks/ |
| modules-programming |
203210 |
/studyabroad-dev2025/modules-programming/ |
| About Us |
203273 |
/studyabroad-dev2025/aboutus/ |
| Contact Us |
203279 |
/studyabroad-dev2025/aboutus/contactus/ |
| Undergraduate Students |
203216 |
/studyabroad-dev2025/undergraduatestudents/ |
| How to Apply |
203340 |
/studyabroad-dev2025/undergraduatestudents/howtoapply/ |
| Why Study Abroad? |
203217 |
/studyabroad-dev2025/undergraduatestudents/whystudyabroad/ |
| Choosing a Program |
203218 |
/studyabroad-dev2025/undergraduatestudents/choosingaprogram/ |
| Program Types |
203231 |
/studyabroad-dev2025/undergraduatestudents/choosingaprogram/programtypes/ |
| Internships |
203232 |
/studyabroad-dev2025/undergraduatestudents/choosingaprogram/internships/ |
| Research and Community Engagement |
203233 |
/studyabroad-dev2025/undergraduatestudents/choosingaprogram/researchandcommunityengagement/ |
| Scholarships |
204026 |
/studyabroad-dev2025/undergraduatestudents/moneymatters/scholarships/ |
| Frequently Asked Questions |
203281 |
/studyabroad-dev2025/undergraduatestudents/choosingaprogram/frequentlyaskedquestions/ |
| Meet with Loyola Study Abroad |
203219 |
/studyabroad-dev2025/undergraduatestudents/meetwithloyolastudyabroad/ |
| Academics |
203243 |
/studyabroad-dev2025/undergraduatestudents/academics/ |
| Academic Policies and Procedures |
203244 |
/studyabroad-dev2025/undergraduatestudents/academics/academicpoliciesandprocedures/ |
| Course Approval and Credit Transfer |
203248 |
/studyabroad-dev2025/undergraduatestudents/academics/courseapprovalandcredittransfer/ |
| Credit and Grade Conversion |
203269 |
/studyabroad-dev2025/undergraduatestudents/academics/courseapprovalandcredittransfer/creditandgradeconversion/ |
| Course Approval Process |
203270 |
/studyabroad-dev2025/undergraduatestudents/academics/courseapprovalandcredittransfer/courseapprovalprocess/ |
| Course Approvers Table |
204091 |
/studyabroad-dev2025/undergraduatestudents/academics/courseapprovalandcredittransfer/courseapprovalprocess/courseapproverstable/ |
| Registration and Transcripts |
203246 |
/studyabroad-dev2025/undergraduatestudents/academics/registrationandtranscripts/ |
| Study Abroad Expectations and Community Standards |
203247 |
/studyabroad-dev2025/undergraduatestudents/academics/studyabroadexpectationsandcommunitystandards/ |
| Loyola Community Standards |
204078 |
/deanofstudents/communitystandards/ |
| Money Matters |
203234 |
/studyabroad-dev2025/undergraduatestudents/moneymatters/ |
| Financial Aid |
203236 |
/studyabroad-dev2025/undergraduatestudents/moneymatters/financialaid/ |
| Scholarships |
203235 |
/studyabroad-dev2025/undergraduatestudents/moneymatters/scholarships/ |
| Budgeting Abroad |
203237 |
/studyabroad-dev2025/undergraduatestudents/moneymatters/budgetingabroad/ |
| Billing and Program Costs |
203238 |
/studyabroad-dev2025/undergraduatestudents/moneymatters/billingandprogramcosts/ |
| How to Apply? |
204004 |
/studyabroad-dev2025/undergraduatestudents/howtoapply/ |
| Payment and Withdrawal Policies |
204027 |
/studyabroad-dev2025/undergraduatestudents/policiesandprocedures/paymentandwithdrawalpolicies/ |
| Health and Safety |
203249 |
/studyabroad-dev2025/undergraduatestudents/healthandsafety/ |
| Identities Abroad |
203250 |
/studyabroad-dev2025/undergraduatestudents/healthandsafety/identitiesabroad/ |
| Medical Insurance |
203252 |
/studyabroad-dev2025/undergraduatestudents/healthandsafety/medicalinsurance/ |
| Accommodations Abroad |
203253 |
/studyabroad-dev2025/undergraduatestudents/healthandsafety/accommodationsabroad/ |
| Emergencies Abroad |
203265 |
/studyabroad-dev2025/undergraduatestudents/healthandsafety/emergenciesabroad/ |
| Safety Abroad |
203266 |
/studyabroad-dev2025/undergraduatestudents/healthandsafety/safetyabroad/ |
| Travel Resources |
203267 |
/studyabroad-dev2025/undergraduatestudents/healthandsafety/travelresources/ |
| Before You Leave |
203274 |
/studyabroad-dev2025/undergraduatestudents/beforeyouleave/ |
| While Abroad |
203275 |
/studyabroad-dev2025/undergraduatestudents/whileabroad/ |
| Families |
203282 |
/studyabroad-dev2025/families/ |
| Explore Programs |
204079 |
https://abroad.luc.edu/index.cfm?FuseAction=Programs.AdvancedSearch |
| Study Abroad Alumni |
203283 |
/studyabroad-dev2025/undergraduatestudents/studyabroadalumni/ |
| Re-entry Resources |
203284 |
/studyabroad-dev2025/undergraduatestudents/studyabroadalumni/re-entryresources/ |
| Go Abroad Again |
203332 |
/studyabroad-dev2025/undergraduatestudents/studyabroadalumni/goabroadagain/ |
| Get Involved |
203333 |
/studyabroad-dev2025/undergraduatestudents/studyabroadalumni/getinvolved/ |
| Policies and Procedures |
203285 |
/studyabroad-dev2025/undergraduatestudents/policiesandprocedures/ |
| Payment and Withdrawal Policies |
203286 |
/studyabroad-dev2025/undergraduatestudents/policiesandprocedures/paymentandwithdrawalpolicies/ |
| Registration and Transcripts |
203288 |
/studyabroad-dev2025/undergraduatestudents/policiesandprocedures/registrationandtranscripts/ |
| Visa Support |
203289 |
/studyabroad-dev2025/undergraduatestudents/policiesandprocedures/visasupport/ |
| Loyola Community Standards |
204028 |
/deanofstudents/communitystandards/ |
| Academic Policies and Procedures |
204075 |
/studyabroad-dev2025/undergraduatestudents/academics/academicpoliciesandprocedures/ |
| right_column |
204068 |
/studyabroad-dev2025/rightcolumn/ |
| Graduate and Independent Students |
203298 |
/studyabroad-dev2025/graduateandindependentstudents/ |
| Faculty and Staff |
185377 |
/studyabroad-dev2025/facultyandstaff/ |
| Develop a Faculty-Led Program |
185383 |
/studyabroad-dev2025/facultyandstaff/developafaculty-ledprogram/ |
| Faculty-Led Programs Overview |
185384 |
/studyabroad-dev2025/facultyandstaff/faculty-ledprogramsoverview/ |
| Proposal Process Overview |
204023 |
/studyabroad-dev2025/facultyandstaff/proposalprocessoverview/ |
| Register Independent/Graduate Programs |
185385 |
/studyabroad-dev2025/facultyandstaff/registerindependentgraduateprograms/ |
| Travel Registration for University-Affiliated International Activities |
204022 |
/ogce/travelresources/travelregistrationforuniversity-affiliatedinternationalactivities/ |
| Rome Center |
185379 |
/rome/ |
| style assets |
369 |
/styleassets/ |
| Top Links |
370 |
/styleassets/toplinks/ |
| Home |
371 |
http://www.luc.edu |
| A-Z Index |
372 |
http://www.luc.edu/a-z/index.html |
| Contact Us |
373 |
http://www.luc.edu/about/contactus.shtml |
| Directories |
374 |
http://www.luc.edu/directories/index.shtml |
| LOCUS |
375 |
http://www.luc.edu/locus/ |
| Quick Links Top |
376 |
/styleassets/quicklinkstop/ |
| E-Mail |
377 |
https://webaccess.luc.edu/gw/webacc |
| Blackboard |
378 |
http://blackboard.luc.edu/ |
| KRONOS Timecard |
379 |
https://kronoslucweb.luhs.org/wfc/logon |
| LOCUS |
380 |
http://www.luc.edu/locus/ |
| Personal Account Manager |
381 |
https://pellonia.luc.edu/iuadmin |
| Quick Links Bottom |
382 |
/styleassets/quicklinksbottom/ |
| Academic Affairs |
383 |
http://www.luc.edu/academicaffairs/index.shtml |
| Advising |
4080 |
http://luc.edu/advising/ |
| Admission: Adult B.A. |
4088 |
http://www.luc.edu/scps |
| Admission: Grad/Prof |
4089 |
http://www.luc.edu/gpem |
| Admission: International |
4090 |
http://www.luc.edu/internationaladmission/ |
| Admission: Undergrad |
7242 |
http://www.luc.edu/undergrad/ |
| Alumni Relations |
4106 |
http://alumni.luc.edu |
| Athletics |
4109 |
http://loyolaramblers.cstv.com |
| Bookstore |
4111 |
http://www.luc.edu/info/bookstore.shtml |
| Bursar's Office |
4114 |
http://www.luc.edu/bursar |
| Career Centers |
4117 |
http://www.luc.edu/students/career/ |
| Choice. Control. Character. |
4118 |
http://www.luc.edu/ccc |
| Colleges and Schools |
4121 |
http://www.luc.edu/academics/schools.shtml |
| Continuing Education |
4124 |
http://www.luc.edu/continuum |
| Cuneo Campus |
25227 |
http://www.cuneomansion.org |
| Dining Services |
4126 |
http://www.luc.edu/dining |
| ePortfolio |
5182 |
http://eportfolio.luc.edu |
| Executive Education |
4128 |
http://www.luc.edu/exec-ed |
| Finance |
4127 |
http://www.luc.edu/finance |
| Financial Assistance |
4125 |
http://www.luc.edu/finaid |
| Office of First Year Experience |
4105 |
http://www.luc.edu/firstyearexperience |
| Hub |
4123 |
http://www.luc.edu/hub |
| Human Resources |
4122 |
http://www.luc.edu/hr |
| Iggy's List |
4119 |
http://www.luc.edu/iggy |
| igNation |
4116 |
http://ignation.luc.edu/ |
| Information Technology Services |
4120 |
http://www.luc.edu/its |
| Libraries |
4115 |
http://libraries.luc.edu/ |
| Loyola Alert |
4113 |
http://luc.edu/alert/ |
| Loyola Flats |
4112 |
http://www.loyolaflats.com/ |
| LUMA |
4110 |
http://www.luc.edu/luma/ |
| Media Relations |
4108 |
http://webapps.luc.edu/newsevents/public/news.cfm |
| Meetings and Events |
4107 |
http://www.luc.edu/conference |
| Parents Resources |
4104 |
http://alumni.luc.edu/site/PageNavigator/lucpa |
| The Phoenix |
4103 |
http://www.loyolaphoenix.com |
| Pre-collegiate Summer |
4102 |
http://www.luc.edu/summerscholars |
| President's Office |
4101 |
http://www.luc.edu/president |
| RamblerLink |
4100 |
https://luc-csm.symplicity.com/ |
| Registration and Records |
4099 |
http://www.luc.edu/regrec |
| Residence Life |
4098 |
http://www.luc.edu/reslife |
| Retreat & Ecology Campus |
25228 |
http://www.luc.edu/retreatcampus |
| Rome Center |
4097 |
http://www.luc.edu/romecenter |
| Sacramental Life |
4096 |
http://www.luc.edu/sacramental_life |
| Security/Police |
4095 |
http://www.luc.edu/safety |
| Senior Leadership Calendar |
6226 |
http://webapps.luc.edu/newsevents/public/skins/leadershipcalendar/index.cfm?siteid=1078 |
| Student Development |
4094 |
http://www.luc.edu/studentdevelopment |
| Summer Sessions |
4093 |
http://www.luc.edu/summer |
| Tutoring |
4092 |
http://www.luc.edu/tutoring |
| University Policies |
4091 |
http://www.luc.edu/policy |
| Writing Center |
8820 |
http://www.luc.edu/writing/ |
| Analytics code |
384 |
/styleassets/analyticscode/ |
| Summer Sessions |
129406 |
/summer/index.shtml |
| home_content |
129685 |
/summer/homecontent/ |
| About |
129541 |
/summer/about/ |
| About Summer Sessions |
191669 |
/summer/about/aboutsummersessions/ |
| Tuition & Financial Aid |
129509 |
/summer/about/tuitionfinancialaid/ |
| right_column |
129513 |
/summer/about/tuitionfinancialaid/rightcolumn/ |
| FAQS |
129546 |
/summer/about/faqs/ |
| right_column |
129557 |
/summer/about/faqs/rightcolumn/ |
| Registration Policies |
146789 |
/summer/about/registrationpolicies/ |
| right_column |
146796 |
/summer/about/registrationpolicies/rightcolumn/ |
| Courses |
129540 |
/summer/courses/ |
| right_column |
129559 |
/summer/courses/rightcolumn/ |
| All Summer Courses |
129421 |
/summer/courses/allsummercourses/ |
| Courses |
129524 |
/summer/courses/courses/ |
| right_column |
129561 |
/summer/courses/courses/rightcolumn/ |
| Courses Report |
129562 |
/summer/courses/coursesreport/ |
| International Summer Programs |
168147 |
/summer/courses/internationalsummerprograms/ |
| Register |
129415 |
/summer/register/ |
| Current Students |
129498 |
/summer/register/currentstudents/ |
| right_column |
129505 |
/summer/register/currentstudents/rightcolumn/ |
| New Students |
129501 |
/summer/register/newstudents/ |
| right_column |
129503 |
/summer/register/newstudents/rightcolumn/ |
| Visiting Students |
146762 |
/summer/register/visitingstudents/ |
| right_column |
146764 |
/summer/register/visitingstudents/rightcolumn/ |
| Visiting Student Transcripts |
159482 |
/summer/register/visitingstudents/visitingstudenttranscripts/ |
| Students |
129539 |
/summer/students/ |
| Current Students |
129423 |
/summer/students/currentstudents/ |
| New Students |
129425 |
/summer/students/newstudents/ |
| Visiting Students |
129427 |
/summer/students/visitingstudents/ |
| Session Schedules |
129518 |
/summer/sessionschedules/ |
| Early Session |
167597 |
/summer/sessionschedules/earlysession/ |
| Session A |
167616 |
/summer/sessionschedules/sessiona/ |
| Session B |
167622 |
/summer/sessionschedules/sessionb/ |
| Session C |
167623 |
/summer/sessionschedules/sessionc/ |
| Columns - TEST |
129444 |
/summer/columns-test/ |
| CTA |
129564 |
/summer/cta/ |
| I Links |
146543 |
/summer/ilinks/ |
| site_logo |
129436 |
/summer/sitelogo/ |
| Footer |
146545 |
/summer/footer/ |
| custom_css |
129441 |
/summer/customcss/ |
| custom_js |
129431 |
/summer/customjs/ |
| Request for Information |
146847 |
/summer/requestinformation/index.shtml |
| Supply Chain and Sustainability Center |
152226 |
/supplychaincenter/ |
| right_column |
154073 |
/supplychaincenter/rightcolumn/ |
| site_logo |
154071 |
/supplychaincenter/sitelogo/ |
| social media |
198142 |
/supplychaincenter/socialmedia/ |
| footer |
154397 |
/supplychaincenter/footer/ |
| I Links |
154165 |
/supplychaincenter/ilinks/ |
| cta |
154167 |
/supplychaincenter/cta/ |
| About |
154079 |
/supplychaincenter/about/ |
| Overview |
154132 |
/supplychaincenter/about/overview/ |
| Rob Liss |
201521 |
/supplychaincenter/about/overview/robliss/ |
| Community |
154113 |
/supplychaincenter/about/community/ |
| archive |
198150 |
/supplychaincenter/about/community/archive/ |
| Contact us |
154231 |
/supplychaincenter/about/contactus/ |
| Services |
154074 |
/supplychaincenter/services/ |
| Our Offerings |
154082 |
/supplychaincenter/services/ourofferings/ |
| Past Consulting Projects |
154149 |
/supplychaincenter/services/pastconsultingprojects/ |
| Insights |
154077 |
/supplychaincenter/insights/ |
| Articles and Videos |
154115 |
/supplychaincenter/insights/articlesandvideos/ |
| archive |
198151 |
/supplychaincenter/insights/articlesandvideos/archive/ |
| Gebrüder Weiss invests in future supply chain leaders |
202812 |
/supplychaincenter/insights/articlesandvideos/gebruderweissinvestsinfuturesupplychainleaders/ |
| Article Links |
161447 |
/supplychaincenter/insights/articlelinks/ |
| Newsletter |
201059 |
/supplychaincenter/insights/newsletter/ |
| Events |
154087 |
/supplychaincenter/events/ |
| Upcoming Events |
154133 |
/supplychaincenter/events/upcomingevents/ |
| Supply Chain and Sustainability Summit |
184286 |
/supplychaincenter/events/supplychainandsustainabilitysummit/ |
| Supply Chain Speaker Series |
168234 |
/supplychaincenter/events/supplychainspeakerseries/ |
| archive |
168238 |
/supplychaincenter/events/supplychainspeakerseries/archive/ |
| Past Events |
154089 |
/supplychaincenter/events/pastevents/ |
| 2026 |
206291 |
/supplychaincenter/events/pastevents/2026/ |
| A Paradigm Shift in Global Supply Chain Risk Management |
205885 |
/supplychaincenter/events/upcomingevents/aparadigmshiftinglobalsupplychainriskmanagement/ |
| Top Technology Supply Chain Trends and Headwinds |
206926 |
/supplychaincenter/events/upcomingevents/toptechnologysupplychaintrendsandheadwinds/ |
| Behind the Daily Miracle: McDonalds Supply Chain |
206095 |
/supplychaincenter/events/upcomingevents/behindthedailymiraclemcdonaldssupplychain/ |
| Introduction to Barge Freight Transportation |
206617 |
/supplychaincenter/events/upcomingevents/introductiontobargefreighttransportation/ |
| 2025 |
205351 |
/supplychaincenter/events/pastevents/2025/ |
| Ocean Network Express |
201375 |
/supplychaincenter/events/pastevents/oceannetworkexpress/ |
| Supply Chain Resilience in a Decade of Disruptions |
202363 |
/supplychaincenter/events/pastevents/supplychainresilienceinadecadeofdisruptions/ |
| The Power of Purpose |
204644 |
/supplychaincenter/events/upcomingevents/thepowerofpurpose/ |
| Supply Chain Value Creation in the Cold Chain |
205206 |
/supplychaincenter/events/upcomingevents/supplychainvaluecreationinthecoldchain/ |
| Inside the McDonald’s Supply Chain: A Franchise Perspective |
204272 |
/supplychaincenter/events/upcomingevents/insidethemcdonaldssupplychainafranchiseperspective/ |
| Innovations in Sustainable Agriculture |
201634 |
/supplychaincenter/events/pastevents/innovationsinsustainableagriculture/ |
| Supply Chains in Flux |
201795 |
/supplychaincenter/events/pastevents/supplychainsinflux/ |
| Sustainability and Environmental Law |
204971 |
/supplychaincenter/events/upcomingevents/sustainabilityandenvironmentallaw/ |
| 2024 |
205352 |
/supplychaincenter/events/pastevents/2024/ |
| Canada-U.S. Relations |
198728 |
/supplychaincenter/events/pastevents/canada-usrelations/ |
| Let's Talk Logistics |
197635 |
/supplychaincenter/events/pastevents/letstalklogistics/ |
| What to Expect When You're Expecting to Enter the Job Market |
207254 |
/supplychaincenter/events/pastevents/2024/whattoexpectwhenyoureexpectingtoenterthejobmarket/ |
| Supply Chain in the United Nations |
207255 |
/supplychaincenter/events/pastevents/2024/supplychainintheunitednations/ |
| Ethical Supply Chains within the Catholic Ethical Purchasing Alliance |
207286 |
/supplychaincenter/events/pastevents/2024/ethicalsupplychainswithinthecatholicethicalpurchasingalliance/ |
| 2023 |
205353 |
/supplychaincenter/events/pastevents/2023/ |
| How to Better Orchestrate Distribution Center Activities |
207293 |
/supplychaincenter/events/pastevents/2023/howtobetterorchestratedistributioncenteractivities/ |
| Workflow Orchestration as a Key Enabler of Digital Supply Chain Management |
207294 |
/supplychaincenter/events/pastevents/2023/workfloworchestrationasakeyenablerofdigitalsupplychainmanagement/ |
| Talk to Action |
207295 |
/supplychaincenter/events/pastevents/2023/talktoaction/ |
| Get to know Gebrüder Weiss |
207296 |
/supplychaincenter/events/pastevents/2023/gettoknowgebruderweiss/ |
| Supply Chain Transformation and Adaptation to COVID-19 at UChicago Medicine |
207297 |
/supplychaincenter/events/pastevents/2023/supplychaintransformationandadaptationtocovid-19atuchicagomedicine/ |
| Supply Chain Impact Accounting: The Workforce Value Premium |
207298 |
/supplychaincenter/events/pastevents/2023/supplychainimpactaccountingtheworkforcevaluepremium/ |
| CPKC: Continuous Rail Movement from Mexico through Canada |
207299 |
/supplychaincenter/events/pastevents/2023/cpkccontinuousrailmovementfrommexicothroughcanada/ |
| Agribusiness: The Complete Value Chain |
207300 |
/supplychaincenter/events/pastevents/2023/agribusinessthecompletevaluechain/ |
| Kroger Delivery |
207301 |
/supplychaincenter/events/pastevents/2023/krogerdelivery/ |
| 2022 |
205354 |
/supplychaincenter/events/pastevents/2022/ |
| Designing Flexibility to Address Uncertainty in the Supply Chain with AI |
202773 |
/supplychaincenter/events/pastevents/designingflexibilitytoaddressuncertaintyinthesupplychainwithai/ |
| Developing Regenerative Supply Chains |
207271 |
/supplychaincenter/events/pastevents/2022/developingregenerativesupplychains/ |
| The Sustainability Journey at Barilla |
207272 |
/supplychaincenter/events/pastevents/2022/thesustainabilityjourneyatbarilla/ |
| Why Supply Chain? |
207273 |
/supplychaincenter/events/pastevents/2022/whysupplychain/ |
| Category, Sourcing & Supplier Management at Allstate |
207274 |
/supplychaincenter/events/pastevents/2022/categorysourcingsuppliermanagementatallstate/ |
| Life Cycle Analysis |
207275 |
/supplychaincenter/events/pastevents/2022/lifecycleanalysis/ |
| Supply Chain Consulting in the New World |
207278 |
/supplychaincenter/events/pastevents/2022/supplychainconsultinginthenewworld/ |
| Heavy Duty On-Road Vehicles |
207280 |
/supplychaincenter/events/pastevents/2022/heavydutyon-roadvehicles/ |
| Harvest Sporting Group |
207281 |
/supplychaincenter/events/pastevents/2022/harvestsportinggroup/ |
| Exelon’s Vision for a Cleaner & Brighter Future |
207282 |
/supplychaincenter/events/pastevents/2022/exelonsvisionforacleanerbrighterfuture/ |
| Supply Chain and Sustainability Summit 2022 |
207283 |
/supplychaincenter/events/pastevents/2022/supplychainandsustainabilitysummit2022/ |
| Indirect Procurement |
207284 |
/supplychaincenter/events/pastevents/2022/indirectprocurement/ |
| 2021 |
205355 |
/supplychaincenter/events/pastevents/2021/ |
| Supplier Diversity 101: Understanding the Business Case and Approach |
207241 |
/supplychaincenter/events/pastevents/2021/supplierdiversity101understandingthebusinesscaseandapproach/ |
| Morton Salt Supply Chain: Keeping the Roads Clear |
207242 |
/supplychaincenter/events/pastevents/2021/mortonsaltsupplychainkeepingtheroadsclear/ |
| Supply Chain in the Not-for-Profit and Service Industry Sectors |
207243 |
/supplychaincenter/events/pastevents/2021/supplychaininthenot-for-profitandserviceindustrysectors/ |
| A Career in Supply Chain that Began at Loyola |
207244 |
/supplychaincenter/events/pastevents/2021/acareerinsupplychainthatbeganatloyola/ |
| A Conversation with Tom Southall |
207245 |
/supplychaincenter/events/pastevents/2021/aconversationwithtomsouthall/ |
| Reverse Logistics: The Dynamic State of Returns |
207246 |
/supplychaincenter/events/pastevents/2021/reverselogisticsthedynamicstateofreturns/ |
| Accelerating Sustainability 2021 |
207247 |
/supplychaincenter/events/pastevents/2021/acceleratingsustainability2021/ |
| Responsible Supply Chains and Greenhouse Gasses |
207248 |
/supplychaincenter/events/pastevents/2021/responsiblesupplychainsandgreenhousegasses/ |
| What Happened to the Toilet Paper? |
207249 |
/supplychaincenter/events/pastevents/2021/whathappenedtothetoiletpaper/ |
| Supply Chain and Sustainability Summit 2021 |
207250 |
/supplychaincenter/events/pastevents/2021/supplychainandsustainabilitysummit2021/ |
| Supply Chain and Sustainability Summit 2021 |
207250 |
/supplychaincenter/events/pastevents/2021/supplychainandsustainabilitysummit2021/ |
| Man and Machine: The Role of Automation in the Modern Warehouse |
207251 |
/supplychaincenter/events/pastevents/2021/manandmachinetheroleofautomationinthemodernwarehouse/ |
| Man and Machine: The Role of Automation in the Modern Warehouse |
207251 |
/supplychaincenter/events/pastevents/2021/manandmachinetheroleofautomationinthemodernwarehouse/ |
| Supply Chain Market Update |
207252 |
/supplychaincenter/events/pastevents/2021/supplychainmarketupdate/ |
| Supply Chain Market Update |
207252 |
/supplychaincenter/events/pastevents/2021/supplychainmarketupdate/ |
| The Future of Supply Chains |
207253 |
/supplychaincenter/events/pastevents/2021/thefutureofsupplychains/ |
| The Future of Supply Chains |
207253 |
/supplychaincenter/events/pastevents/2021/thefutureofsupplychains/ |
| 2020 |
205356 |
/supplychaincenter/events/pastevents/2020/ |
| Workforce 2020 Series |
154090 |
/supplychaincenter/events/pastevents/workforce2020series/ |
| Workforce 2020: Engaging Your Millennial Workforce with a Modern Digital Workplace |
154091 |
/supplychaincenter/events/pastevents/workforce2020engagingyourmillennialworkforcewithamoderndigitalworkplace/ |
| Data Analytics Competition 2020 |
207237 |
/supplychaincenter/events/pastevents/2020/dataanalyticscompetition2020/ |
| Supply Chain Program: Responsible Sourcing |
207238 |
/supplychaincenter/events/pastevents/2020/supplychainprogramresponsiblesourcing/ |
| Supply Chain and Sustainability Summit 2020 |
207239 |
/supplychaincenter/events/pastevents/2020/supplychainandsustainabilitysummit2020/ |
| Global Sustainability Initiatives |
207240 |
/supplychaincenter/events/pastevents/2020/globalsustainabilityinitiatives/ |
| 2019 |
205357 |
/supplychaincenter/events/pastevents/2019/ |
| Supply Chain Strategies for Middle-Market Companies |
154107 |
/supplychaincenter/events/pastevents/supplychainstrategiesformiddle-marketcompanies/ |
| Solutions Workshop: Evolving Supply Chains for New Global Challenges |
205423 |
/supplychaincenter/events/pastevents/2019/solutionsworkshopevolvingsupplychainsfornewglobalchallenges/ |
| Blockchain Summit 2019 |
205431 |
/supplychaincenter/events/pastevents/2019/blockchainsummit2019/ |
| Annual Leadership Conference 2019 |
205432 |
/supplychaincenter/events/pastevents/2019/annualleadershipconference2019/ |
| Data Analytics Competition 2019 |
205433 |
/supplychaincenter/events/pastevents/2019/dataanalyticscompetition2019/ |
| 2018 |
205358 |
/supplychaincenter/events/pastevents/2018/ |
| Solutions Workshop: Transportation |
154093 |
/supplychaincenter/events/pastevents/solutionsworkshoptransportation/ |
| Blockchain Conference |
154094 |
/supplychaincenter/events/pastevents/blockchainconference/ |
| Supply Chain Leadership Conference |
154106 |
/supplychaincenter/events/pastevents/supplychainleadershipconference/ |
| Solutions Workshop: Hot Topics in Supply Chain Management |
154098 |
/supplychaincenter/events/pastevents/solutionsworkshophottopicsinsupplychainmanagement/ |
| Global Student Challenge |
205420 |
/supplychaincenter/events/pastevents/2018/globalstudentchallenge/ |
| Faculty and students team up with Northern Illinois Food Bank |
205422 |
/supplychaincenter/events/pastevents/2018/facultyandstudentsteamupwithnorthernillinoisfoodbank/ |
| 2017 |
205359 |
/supplychaincenter/events/pastevents/2017/ |
| Annual Leadership Conference |
154092 |
/supplychaincenter/events/pastevents/annualleadershipconference/ |
| Solutions Workshop: McDonald's |
154095 |
/supplychaincenter/events/pastevents/solutionsworkshopmcdonalds/ |
| Workforce 2020 |
205360 |
/supplychaincenter/events/pastevents/2017/workforce2020/ |
| Supply Chain and Sustainability Summit 2022 |
185151 |
/supplychaincenter/events/supplychainandsustainabilitysummit2022/ |
| Membership |
154078 |
/supplychaincenter/membership/ |
| Membership Benefits |
154083 |
/supplychaincenter/membership/membershipbenefits/ |
| Apply |
154081 |
/supplychaincenter/membership/newmemberapplication/ |
| Support |
154080 |
/supplychaincenter/support/ |
| Make a Gift |
154085 |
https://securelb.imodules.com/s/1548/alumni/giving.aspx?sid=1548&gid=2&pgid=4385&cid=7791 |
| Videos |
154389 |
/supplychaincenter/videos/ |
| Women and Boards of Directors |
154391 |
/supplychaincenter/videos/womenandboardsofdirectors/ |
| Bringing Balance to the Workplace |
154390 |
/supplychaincenter/videos/bringingbalancetotheworkplace/ |
| Building a Diverse Workforce |
154392 |
/supplychaincenter/videos/buildingadiverseworkforce/ |
| Opportunities for Doing Business with the City of Chicago |
166236 |
/supplychaincenter/videos/opportunitiesfordoingbusinesswiththecityofchicago/ |
| ESG Reporting 101 and Why It Matters for Supply Chain |
166237 |
/supplychaincenter/videos/esgreporting101andwhyitmattersforsupplychain/ |
| Building a Sustainable and Equitable Green Infrastructure |
166238 |
/supplychaincenter/videos/buildingasustainableandequitablegreeninfrastructure/ |
| Bios |
154957 |
/supplychaincenter/bios/ |
| Tanvee Agrawal |
154959 |
/supplychaincenter/bios/tanveeagrawal/ |
| Hussam Bachour |
154958 |
/supplychaincenter/bios/hussambachour/ |
| Adam Becker |
154969 |
/supplychaincenter/bios/adambecker/ |
| Sarah Burke |
166082 |
/supplychaincenter/bios/sarahburke/ |
| Jamie Burr |
160083 |
/supplychaincenter/bios/jamieburr/ |
| John Davies |
159805 |
/supplychaincenter/bios/johndavies/ |
| Francesca DeBiase |
159097 |
/supplychaincenter/bios/francescadebiase/ |
| Dennis Donelon |
154978 |
/supplychaincenter/bios/dennisdonelon/ |
| Abe Eshkenazi |
154965 |
/supplychaincenter/bios/abeeshkenazi/ |
| Craig Espevik |
163084 |
/supplychaincenter/bios/craigespevik/ |
| Kevin Fehring |
154975 |
/supplychaincenter/bios/kevinfehring/ |
| Jason Feldman |
163020 |
/supplychaincenter/bios/jasonfeldman/ |
| Karen Fleshman |
154974 |
/supplychaincenter/bios/karenfleshman/ |
| Dave Foell |
154973 |
/supplychaincenter/bios/davefoell/ |
| Dave Galatte |
159961 |
/supplychaincenter/bios/davegalatte/ |
| Natasha Galavotti |
159639 |
/supplychaincenter/bios/natashagalavotti/ |
| Ryan Hartz |
154976 |
/supplychaincenter/bios/ryanhartz/ |
| Daniela Hendricks |
154971 |
/supplychaincenter/bios/danielahendricks/ |
| Cory Hooks |
163618 |
/supplychaincenter/bios/coryhooks/ |
| Trista Jones |
154962 |
/supplychaincenter/bios/tristajones/ |
| Chris Kitzman |
163839 |
/supplychaincenter/bios/chriskitzman/ |
| Kiki Kouris |
154972 |
/supplychaincenter/bios/kikikouris/ |
| Jenna Kunde |
163646 |
/supplychaincenter/bios/jennakunde/ |
| Tracy Lampert |
154968 |
/supplychaincenter/bios/tracylampert/ |
| Pamelyn Lindsey |
154977 |
/supplychaincenter/bios/pamelynlindsey/ |
| Lauren Loew |
163638 |
/supplychaincenter/bios/laurenloew/ |
| James MacDonnell |
154964 |
/supplychaincenter/bios/jamesmacdonnell/ |
| Marquis Miller |
163021 |
/supplychaincenter/bios/marquismiller/ |
| Desiree Paoli-Pupillo |
159782 |
/supplychaincenter/bios/desireepaoli-pupillo/ |
| Kim Peterson |
159640 |
/supplychaincenter/bios/kimpeterson/ |
| Fabio Pettenati |
159338 |
/supplychaincenter/bios/fabiopettenati/ |
| Cathy Pieters |
163644 |
/supplychaincenter/bios/cathypieters/ |
| Paul Rizzo |
163619 |
/supplychaincenter/bios/paulrizzo/ |
| Mari Roberts |
163055 |
/supplychaincenter/bios/mariroberts/ |
| Roy Scheck |
154960 |
/supplychaincenter/bios/royscheck/ |
| Meg Stowe |
163709 |
/supplychaincenter/bios/megstowe/ |
| Shannon Thomas Carroll |
160109 |
/supplychaincenter/bios/shannonthomascarroll/ |
| Pete Tomasi |
163645 |
/supplychaincenter/bios/petetomasi/ |
| Edward Tymick |
154970 |
/supplychaincenter/bios/edwardtymick/ |
| Amanda von Almen |
159804 |
/supplychaincenter/bios/amandavonalmen/ |
| Liz Walker |
154967 |
/supplychaincenter/bios/lizwalker/ |
| Donna Warton |
154961 |
/supplychaincenter/bios/donnawarton/ |
| Danielle Wood |
154966 |
/supplychaincenter/bios/daniellewood/ |
| Kristopher Wilson |
159783 |
/supplychaincenter/bios/kristopherwilson/ |
| John Caltagirone |
167175 |
/supplychaincenter/bios/johncaltagirone/ |
| Gita Taherkhani |
167176 |
/supplychaincenter/bios/gitataherkhani/ |
| Çerağ Pinçe |
167177 |
/supplychaincenter/bios/erapine/ |
| Vinny Donnelly |
167178 |
/supplychaincenter/bios/vinnydonnelly/ |
| Maciek Nowak |
167309 |
/supplychaincenter/bios/macieknowak/ |
| John Nicholas |
167348 |
/supplychaincenter/bios/johnnicholas/ |
| Grace Sperr |
168371 |
/supplychaincenter/bios/gracesperr/ |
| Jeffrey Leppert |
168372 |
/supplychaincenter/bios/jeffreyleppert/ |
| Yasemin Oder |
168373 |
/supplychaincenter/bios/yaseminoder/ |
| John Martin |
168374 |
/supplychaincenter/bios/johnmartin/ |
| Casey McDowell |
168755 |
/supplychaincenter/bios/caseymcdowell/ |
| Joseph Raphael |
168756 |
/supplychaincenter/bios/josephraphael/ |
| Mark Peters |
180025 |
/supplychaincenter/bios/markpeters/ |
| Sustainability Committee |
97506 |
/sustainabilitycommittee/ |
| About the Committee |
96060 |
/sustainabilitycommittee/aboutthecommittee/ |
| Members |
96058 |
/sustainabilitycommittee/aboutthecommittee/members/ |
| Background |
97454 |
/sustainabilitycommittee/aboutthecommittee/background/ |
| Schedule of Meetings |
96063 |
/sustainabilitycommittee/aboutthecommittee/scheduleofmeetings/ |
| Project Support |
96064 |
/sustainabilitycommittee/projectsupport/ |
| Sustainability Project Proposal Application |
96069 |
/sustainabilitycommittee/projectsupport/sustainabilityprojectproposalapplication/ |
| Example Projects |
96070 |
/sustainabilitycommittee/projectsupport/exampleprojects/ |
| Other Project Funding Resources |
96156 |
/sustainabilitycommittee/projectsupport/otherprojectfundingresources/ |
| Loyola's Commitments & Recognitions |
96065 |
/sustainabilitycommittee/loyolascommitmentsrecognitions/ |
| A Just Future – Loyola’s Climate Action Plan |
96128 |
https://www.luc.edu/media/lucedu/sustainability-new/pdfs/IES15-05%20Climate%20Action%20Plan%20Booklet_v7.pdf |
| To the Greater Good - Loyola's Strategic Plan |
96134 |
https://www.luc.edu/strategicplan/ |
| Sustainability at Loyola |
96066 |
/sustainabilitycommittee/sustainabilityatloyola/ |
| Climate Action Plan |
198437 |
/sustainabilitycommittee/climateactionplan/ |
| A Just Future – Loyola’s Climate Action Plan |
198439 |
https://www.luc.edu/media/lucedu/sustainability-new/pdfs/IES15-05%20Climate%20Action%20Plan%20Booklet_v7.pdf |
| Solar at Loyola |
202199 |
/sustainabilitycommittee/climateactionplan/solaratloyola/ |
| iFrame Dashboard Sample Page |
202272 |
/sustainabilitycommittee/climateactionplan/dashboard/ |
| Air Travel |
204483 |
/sustainabilitycommittee/climateactionplan/airtravel/ |
| site_logo |
201860 |
/sustainabilitycommittee/sitelogo/ |
| social media |
201863 |
/sustainabilitycommittee/socialmedia/ |
| Footer |
97517 |
/sustainabilitycommittee/footer/ |
| right_column |
97460 |
/sustainabilitycommittee/rightcolumn/ |
| modules-programming |
201864 |
/sustainabilitycommittee/modules-programming/ |
| Documents |
205769 |
/sustainabilitycommittee/documents/ |
| T4 TEST - DEV |
185678 |
/t4test-dev/ |
| cta |
185803 |
/t4test-dev/cta/ |
| I Links |
185804 |
/t4test-dev/ilinks/ |
| site_logo |
185805 |
/t4test-dev/sitelogo/ |
| Gallery |
185773 |
/t4test-dev/gallery/ |
| Tabs Child Section One |
185808 |
/t4test-dev/gallery/tabschildsectionone/ |
| Tabs Child Sub Section One |
185809 |
/t4test-dev/gallery/tabschildsectionone/tabschildsubsectionone/ |
| Tabs Child Section Two |
185810 |
/t4test-dev/gallery/tabschildsectiontwo/ |
| Modal |
185770 |
/t4test-dev/modal/ |
| Modal Content One |
185680 |
/t4test-dev/modal/modalcontentone/ |
| Modal Carousel |
185799 |
/t4test-dev/modal/modalcarousel/ |
| Modal Table Accordion |
185800 |
/t4test-dev/modal/modaltableaccordion/ |
| Table |
185772 |
/t4test-dev/table/ |
| Table Accordion |
185831 |
/t4test-dev/tableaccordion/ |
| Tabs |
185771 |
/t4test-dev/tabs/ |
| Tabs Child Section One |
185801 |
/t4test-dev/tabs/tabschildsectionone/ |
| Tabs Child Sub Section One |
185807 |
/t4test-dev/tabs/tabschildsectionone/tabschildsubsectionone/ |
| Tabs Child Section Two |
185802 |
/t4test-dev/tabs/tabschildsectiontwo/ |
| sample page |
186181 |
/t4test-dev/samplepage/ |
| Interior Page 1 (PCO) |
191817 |
/t4test-dev/samplepage/interiorpage1pco/ |
| Terminal Four (T4) |
12004 |
/t4/index.shtml |
| site_logo |
12659 |
/t4/sitelogo/ |
| Footer |
12005 |
/t4/footer/ |
| Assets |
122234 |
/t4/assets/ |
| modules-programming |
184559 |
/t4/modules-programming/ |
| Videos |
191897 |
/t4/videos/ |
| List Items |
191898 |
/t4/videos/listitems/ |
| Users List |
188610 |
/t4/userslist/ |
| Content Types |
191912 |
/t4/contenttypes/ |
| For Carnegie |
205222 |
/t4/contenttypes/forcarnegie/ |
| Accordion Item 1 |
205223 |
/t4/contenttypes/forcarnegie/accordionitem1/ |
| Accordion Item 2 |
205275 |
/t4/contenttypes/forcarnegie/accordionitem2/ |
| Section Template Demo |
205276 |
/t4/contenttypes/forcarnegie/sectiontemplatedemo/ |
| Full Width Page |
205277 |
/t4/contenttypes/forcarnegie/sectiontemplatedemo/fullwidthpage/ |
| Interior Page |
205278 |
/t4/contenttypes/forcarnegie/sectiontemplatedemo/interiorpage/ |
| Universal Buttons Panels |
205285 |
/t4/contenttypes/forcarnegie/universalbuttonspanels/ |
| Universal Hero Video |
205287 |
/t4/contenttypes/forcarnegie/universalherovideo/ |
| Feature Link |
191913 |
/t4/contenttypes/featurelink/ |
| Gallery Item |
191914 |
/t4/contenttypes/galleryitem/ |
| Modal |
191916 |
/t4/contenttypes/modal/ |
| Modal Content One |
191917 |
/t4/contenttypes/modal/modalcontentone/ |
| Social Networking Links |
191928 |
/t4/contenttypes/socialnetworkinglinks/ |
| Staff Profile |
192066 |
/t4/contenttypes/staffprofile/ |
| Deploy Process |
58990 |
/t4/deploy/ |
| Resources |
122230 |
/t4/resources/ |
| interior_left |
122232 |
/t4/resources/interiorleft/ |
| custom_js |
122233 |
/t4/resources/customjs/ |
| Release Notes |
207447 |
/t4/releasenotes/ |
| Current T4 Version |
207458 |
/t4/releasenotes/currentt4version/ |
| Announcements |
207457 |
/t4/releasenotes/announcements/ |
| Terry Student Center |
182267 |
/tsc/ |
| site_logo |
182268 |
/tsc/sitelogo/ |
| Footer |
182269 |
/tsc/footer/ |
| cta |
183856 |
/tsc/cta/ |
| About Us |
182270 |
/tsc/aboutus/ |
| Welcome |
182271 |
/tsc/aboutus/welcome/ |
| Contact Us |
182272 |
/tsc/aboutus/contactus/ |
| Hours of Operation |
182273 |
/tsc/aboutus/hoursofoperation/ |
| Location and Directions |
182274 |
/tsc/aboutus/locationanddirections/ |
| Parking |
182275 |
/tsc/aboutus/parking/ |
| Facility Policies |
182276 |
/tsc/aboutus/facilitypolicies/ |
| Fitness Studio |
182277 |
/tsc/fitnessstudio/ |
| Lu's Deli & Pub |
182278 |
/tsc/lusdelipub/ |
| WLUW |
182279 |
/tsc/wluw/ |
| All Saints Chapel |
182280 |
/tsc/allsaintschapel/ |
| Services |
182281 |
/tsc/services/ |
| Reservations |
182282 |
/tsc/services/reservations/ |
| The Building Bridges Initiative |
188110 |
/buildingbridges/ |
| site_logo |
188111 |
/buildingbridges/sitelogo/ |
| Footer |
188112 |
/buildingbridges/footer/ |
| social media |
188115 |
/buildingbridges/socialmedia/ |
| Events |
188161 |
/buildingbridges/events/ |
| Building Bridges Across the Americas |
188153 |
/buildingbridges/acrosstheamericas/ |
| Building Bridges Across Africa |
188154 |
/buildingbridges/acrossafrica/ |
| Building Bridges Across South Asia |
188160 |
/buildingbridges/acrosssouthasia/ |
| Building Bridges Across Asia Pacific |
194236 |
/buildingbridges/acrossasiapacific/ |
| The Center for Data Science and Consulting (CDSC) |
185130 |
/cdsc/ |
| site_logo |
185131 |
/cdsc/sitelogo/ |
| Footer |
185132 |
/cdsc/footer/ |
| modules-programming |
185136 |
/cdsc/modules-programming/ |
| About |
185137 |
/cdsc/about/ |
| People |
185138 |
/cdsc/people/ |
| Meet the Director |
185716 |
/cdsc/people/meetthedirector/ |
| Faculty |
185711 |
/cdsc/people/faculty/ |
| Students |
185714 |
/cdsc/people/students/ |
| Partners |
185712 |
/cdsc/people/partners/ |
| Projects |
185139 |
/cdsc/projects/ |
| Current Projects |
185713 |
/cdsc/projects/currentprojects/ |
| Publications |
185715 |
/cdsc/projects/publications/ |
| Resources |
185140 |
/cdsc/resources/ |
| Events |
185141 |
/cdsc/events/ |
| Introduction to R |
186032 |
/cdsc/events/introductiontor/ |
| Introduction to GIS |
189923 |
/cdsc/events/introductiontogis/ |
| The Graduate School |
190172 |
/gradschool/ |
| site_logo |
190173 |
/gradschool/sitelogo/ |
| Footer |
190174 |
/gradschool/footer/ |
| cta |
190175 |
/gradschool/cta/ |
| I Links |
190176 |
/gradschool/ilinks/ |
| social media |
190177 |
/gradschool/socialmedia/ |
| modules-programming |
190178 |
/gradschool/modules-programming/ |
| About |
190181 |
/gradschool/about/ |
| Mission and Vision |
190187 |
/gradschool/about/missionandvision/ |
| Dean's Message |
190763 |
/gradschool/about/deansmessage/ |
| Awards and Recognition |
190764 |
/gradschool/about/awardsandrecognition/ |
| Graduate Faculty Resources |
190765 |
/gradschool/about/graduatefacultyresources/ |
| Graduate Faculty Handbook |
190768 |
/gradschool/about/graduatefacultyresources/graduatefacultyhandbook/ |
| Graduate Program Director Handbook |
207515 |
/gradschool/about/graduatefacultyresources/graduateprogramdirectorhandbook/ |
| Alumni Outcomes |
190770 |
/gradschool/about/alumnioutcomes/ |
| Graduate School Academic Calendar |
190771 |
/gradschool/about/graduateschoolacademiccalendar/ |
| News & Events |
190192 |
/gradschool/about/newsevents/ |
| archive |
204358 |
/gradschool/about/newsevents/archive/ |
| Gaining a Competitive Edge in Cybersecurity |
198606 |
/gradschool/about/announcements/gainingacompetitiveedgeincybersecurity/ |
| Graduate Faculty of the Year 2025 |
197116 |
/gradschool/about/announcements/graduatefacultyoftheyear2025/ |
| Graduate School Fellows 2024-2025 |
197117 |
/gradschool/about/announcements/graduateschoolfellows2024-2025/ |
| Graduate School Interdisciplinary Research Symposium Award Winners |
197118 |
/gradschool/about/announcements/graduateschoolinterdisciplinaryresearchsymposiumawardwinners/ |
| 2025 Council of Graduate School Programs Awards |
190193 |
/gradschool/about/announcements/2025councilofgraduateschoolprogramsawards/ |
| Fundamentals and Strategies of Equity-based Holistic Admissions Online Workshops |
198625 |
/gradschool/about/announcements/fundamentalsandstrategiesofequity-basedholisticadmissionsonlineworkshops/ |
| 3MT 2025 |
201759 |
/gradschool/about/announcements/3mt2025/ |
| Networking to Gain Competitive Advantage in Your Job Search |
204132 |
/gradschool/about/newsevents/networkingtogaincompetitiveadvantageinyourjobsearch/ |
| Graduate School Alumni Mentorship Program |
204134 |
/gradschool/about/announcements/graduateschoolalumnimentorshipprogram/ |
| right_column |
204356 |
/gradschool/about/newsevents/rightcolumn/ |
| A Discussion with LUC MA Alum Rachel Ramirez of the Wilmette History Museum |
204359 |
/gradschool/about/newsevents/adiscussionwithlucmaalumrachelramirezofthewilmettehistorymuseum/ |
| Leveraging Research and Real-World Experience in Computer Science |
204360 |
/gradschool/about/newsevents/leveragingresearchandreal-worldexperienceincomputerscience/ |
| 2024 Graduate Faculty of the Year |
204361 |
/gradschool/about/newsevents/2024graduatefacultyoftheyear/ |
| Preparing Students to Address Complex Global Challenges |
204362 |
/gradschool/about/newsevents/preparingstudentstoaddresscomplexglobalchallenges/ |
| Unlocking the Power of Data at Loyola |
204365 |
/gradschool/about/newsevents/unlockingthepowerofdataatloyola/ |
| Doctoral Student Wins Top Prize at Regional Three Minute Thesis Finals |
204366 |
/gradschool/about/newsevents/doctoralstudentwinstopprizeatregionalthreeminutethesisfinals/ |
| Introduction to Graduate Writing |
204386 |
/gradschool/about/newsevents/introductiontograduatewriting/ |
| Graduate School 100th Anniversary Celebration |
204519 |
/gradschool/about/newsevents/graduateschool100thanniversarycelebration/ |
| Understanding the Academic Job Search |
204521 |
/gradschool/about/newsevents/understandingtheacademicjobsearch/ |
| Academic Grant Writing for the Humanities/Social Sciences |
204759 |
/gradschool/about/newsevents/academicgrantwritingforthehumanitiessocialsciences/ |
| A Discussion with LUC MA Alum Matthew Prochilo – College of the Holy Cross |
204760 |
/gradschool/about/newsevents/adiscussionwithlucmaalummatthewprochilocollegeoftheholycross/ |
| St. Albert’s Day 2025 Award Recipients |
205198 |
/gradschool/about/newsevents/stalbertsday2025awardrecipients/ |
| Making a Statement Workshop |
205291 |
/gradschool/about/newsevents/makingastatementworkshop/ |
| Summer Paid Internships for Humanities/Social Sciences PhD Students |
205663 |
/gradschool/about/newsevents/summerpaidinternshipsforhumanitiessocialsciencesphdstudents/ |
| Preparing Your Job Search for an AI-Driven Market |
205734 |
/gradschool/about/newsevents/preparingyourjobsearchforanai-drivenmarket/ |
| How to Succeed at 3MT |
205735 |
/gradschool/about/newsevents/howtosucceedat3mt/ |
| Opening New Doors to Medical School |
205820 |
/gradschool/about/newsevents/openingnewdoorstomedicalschool/ |
| Three Minute Thesis 2026 |
205821 |
/gradschool/about/newsevents/threeminutethesis2026/ |
| Humanities and Social Sciences PhD Career Cohort |
206307 |
/gradschool/about/newsevents/humanitiesandsocialsciencesphdcareercohort/ |
| A Discussion with LUC PhD Alum Hope Shannon |
206714 |
/gradschool/about/newsevents/adiscussionwithlucphdalumhopeshannon/ |
| Council of Graduate School Programs Awards 2026 |
206715 |
/gradschool/about/newsevents/councilofgraduateschoolprogramsawards2026/ |
| Graduate School Programs Recognized in U.S. News & World Report |
206882 |
/gradschool/about/newsevents/graduateschoolprogramsrecognizedinusnewsworldreport/ |
| Graduate School Interdisciplinary Research Symposium 2026 Winners |
206969 |
/gradschool/about/newsevents/graduateschoolinterdisciplinaryresearchsymposium2026winners/ |
| Stritch School of Medicine - The Graduate School |
202067 |
https://www.luc.edu/stritch/graduateschool/ |
| 100 Years of the Graduate School |
204786 |
/gradschool/about/100yearsofthegraduateschool/ |
| Contact Us |
190772 |
/gradschool/about/contactus/ |
| Future Students |
190182 |
/gradschool/futurestudents/ |
| Apply |
204154 |
https://gpem.luc.edu/portal/admission?tab=admission-process |
| Financial Assistance and Funding |
190773 |
/gradschool/futurestudents/financialassistanceandfunding/ |
| financial policy_archive |
204388 |
/gradschool/futurestudents/financialassistanceandfunding/financialpolicyarchive/ |
| Tuition and Fees |
190797 |
/gradschool/futurestudents/tuitionandfees/ |
| Orientation |
190796 |
/gradschool/futurestudents/orientation/ |
| Admitted Students |
190798 |
/gradschool/futurestudents/admittedstudents/ |
| modules-programming |
191557 |
/gradschool/futurestudents/admittedstudents/modules-programming/ |
| Academics |
190183 |
/gradschool/academics/ |
| Degree Programs |
190189 |
/gradschool/academics/degreeprograms/ |
| Accelerated Masters Pathway (AMP) |
190801 |
/gradschool/academics/acceleratedmasterspathwayamp/ |
| Academic Policies |
190802 |
/gradschool/academics/academicpolicies/ |
| Graduation |
190803 |
/gradschool/academics/graduation/ |
| modules-programming |
191558 |
/gradschool/academics/graduation/modules-programming/ |
| Milestones |
190804 |
/gradschool/academics/milestones/ |
| Research |
190805 |
/gradschool/academics/research/ |
| Graduate School Interdisciplinary Research Symposium |
190823 |
/gradschool/academics/research/graduateschoolinterdisciplinaryresearchsymposium/ |
| Research Mentoring Project Abstracts |
190824 |
/gradschool/academics/research/researchmentoringprojectabstracts/ |
| Dissertation and Thesis |
190806 |
/gradschool/academics/dissertationandthesis/ |
| Formatting FAQs |
190827 |
/gradschool/academics/dissertationandthesis/formattingfaqs/ |
| Formatting Examples |
190828 |
/gradschool/academics/dissertationandthesis/formattingexamples/ |
| Forms |
190807 |
/gradschool/academics/forms/ |
| Student Experience |
190184 |
/gradschool/studentexperience/ |
| Current Students |
190190 |
/gradschool/studentexperience/currentstudents/ |
| modules-programming |
190191 |
/gradschool/studentexperience/currentstudents/modules-programming/ |
| DEI |
190834 |
/gradschool/studentexperience/dei/ |
| Financial Assistance and Funding |
199509 |
/gradschool/futurestudents/financialassistanceandfunding/ |
| Graduate Assistant Handbook |
204217 |
/gradschool/studentexperience/graduateassistanthandbook/ |
| Community |
190835 |
/gradschool/studentexperience/community/ |
| Professional Development |
190836 |
/gradschool/studentexperience/professionaldevelopment/ |
| Resources for Student Concerns |
198511 |
/gradschool/studentexperience/resourcesforstudentconcerns/ |
| Alumni Outcomes |
199511 |
/gradschool/about/alumnioutcomes/ |
| News |
204357 |
/gradschool/news/ |
| The Hank Center for The Catholic Intellectual Heritage |
18263 |
/ccih/ |
| site_logo |
18327 |
/ccih/sitelogo/ |
| Footer |
18326 |
/ccih/footer/ |
| cta |
201894 |
/ccih/cta/ |
| social media |
201896 |
/ccih/socialmedia/ |
| modules-programming |
201893 |
/ccih/modules-programming/ |
| Events |
203067 |
/ccih/events/ |
| Upcoming Events |
203068 |
/ccih/events/upcomingevents/ |
| Past Events |
203069 |
/ccih/events/pastevents/ |
| 2025-2026 Past Events |
207104 |
/ccih/events/pastevents/2025-2026pastevents/ |
| archive |
207105 |
/ccih/events/pastevents/2025-2026/archive/ |
| 2024-2025 Past Events |
207116 |
/ccih/events/pastevents/2024-2025pastevents/ |
| archive |
207117 |
/ccih/events/pastevents/2024-2025/archive/ |
| 2023-2024 Past Events |
207126 |
/ccih/events/pastevents/2023-2024pastevents/ |
| archive |
207127 |
/ccih/events/pastevents/2023-2024pastevents/archive/ |
| 2022-2023 Past Events |
207130 |
/ccih/events/pastevents/2022-2023pastevents/ |
| archive |
207131 |
/ccih/events/pastevents/2022-2023pastevents/archive/ |
| 2021-2022 Past Events |
207132 |
/ccih/events/pastevents/2021-2022pastevents/ |
| archive |
207133 |
/ccih/events/pastevents/2021-2022pastevents/archive/ |
| Distinguished Lecture Series |
203070 |
/ccih/events/distinguishedlectureseries/ |
| The Saint John Henry Newman Lecture |
52099 |
/ccih/communicating/thesaintjohnhenrynewmanlecture/ |
| archive |
97739 |
/ccih/communicating/thesaintjohnhenrynewmanlecture/archive/ |
| Cardinal Bernardin Common Cause Series |
109154 |
/ccih/communicating/cardinalbernardincommoncauseseries/ |
| archive |
120895 |
/ccih/communicating/cardinalbernardincommoncauseseries/archive/ |
| Pierre Teilhard de Chardin Lecture Series |
100720 |
/ccih/researching/teilharddechardinsjfellowship/pierreteilharddechardinlectureseries/ |
| archive |
101187 |
/ccih/researching/teilharddechardinsjfellowship/pierreteilharddechardinlectureseries/archive/ |
| Jesuit Lecture Series |
204002 |
/ccih/events/distinguishedlectureseries/jesuitlectureseries/ |
| archive |
204003 |
/ccih/events/distinguishedlectureseries/jesuitlectureseries/archive/ |
| Partner Conferences |
203071 |
/ccih/events/partnerconferences/ |
| archive |
203354 |
/ccih/events/partnerconferences/archive/ |
| The Way Forward Conference |
196116 |
/ccih/communicating/thewayforwardconference/ |
| The Way Forward 2025 |
201335 |
/ccih/communicating/thewayforwardconference/thewayforward2025/ |
| The Way Forward 2024 |
196187 |
/ccih/communicating/thewayforwardconference/thewayforward2024/ |
| The Way Forward 2023 |
196190 |
/ccih/communicating/thewayforwardconference/thewayforward2023/ |
| The Way Forward 2022 |
196433 |
/ccih/communicating/thewayforwardconference/thewayforward2022/ |
| The Catholic Imagination Conference |
203320 |
/ccih/events/partnerconferences/thecatholicimaginationconference/ |
| 2019 Catholic Imagination Conference |
119888 |
/ccih/2019catholicimaginationconference/ |
| Conference Archive, Program, and Media |
126514 |
/ccih/2019catholicimaginationconference/conferencearchiveprogramandmedia/ |
| Registration and Fees |
119892 |
/ccih/2019catholicimaginationconference/registrationandfees/ |
| Pre-Conference Day |
124026 |
/ccih/2019catholicimaginationconference/pre-conferenceday/ |
| Conference Schedule |
119909 |
/ccih/2019catholicimaginationconference/conferenceschedule/ |
| Conference Speakers |
119889 |
/ccih/2019catholicimaginationconference/conferencespeakers/ |
| Featured Speakers |
123292 |
/ccih/2019catholicimaginationconference/featuredspeakers/ |
| Feature Friday Archive |
122392 |
/ccih/2019catholicimaginationconference/featuredspeakers/featurefridayarchive/ |
| Hotels and Travel Information |
120926 |
/ccih/2019catholicimaginationconference/hotelsandtravelinformation/ |
| Information for Vendors |
120925 |
/ccih/2019catholicimaginationconference/informationforvendors/ |
| About the Biennial Catholic Imagination Conference |
122257 |
/ccih/2019catholicimaginationconference/aboutthebiennialcatholicimaginationconference/ |
| Call For Papers (Closed) |
119893 |
/ccih/2019catholicimaginationconference/callforpapersclosed/ |
| archive |
203321 |
/ccih/events/partnerconferences/thecatholicimaginationconference/archive/ |
| All Events By Series |
203081 |
/ccih/events/ |
| Catholic Q&A Program |
19976 |
/ccih/connecting/Catholic_QA_Program.shtml |
| archive |
97733 |
/ccih/connecting/catholicqaprogram/archive/ |
| Faith in Focus Film Series |
18289 |
/ccih/connecting/FaithinFocusFilmSeries.shtml |
| archive |
57964 |
/ccih/connecting/faithinfocusfilmseries/archive/ |
| Graduate Summer Institute on the Catholic Imagination |
125595 |
/ccih/researching/graduatesummerinstituteonthecatholicimagination/ |
| Catholic Minds, Catholic Matters |
18276 |
/ccih/communicating/CatholicMindsCatholicMatters.shtml |
| archive |
58089 |
/ccih/communicating/catholicmindscatholicmatters/archive/ |
| Publication Luncheons |
18290 |
/ccih/connecting/PublicationLuncheons.shtml |
| archive |
57984 |
/ccih/connecting/publicationluncheons/archive/ |
| Catholicism and the Arts |
67706 |
/ccih/connecting/catholicismandthearts/ |
| archive |
97909 |
/ccih/connecting/catholicismandthearts/archive/ |
| Catholicism and the Professional Life |
18294 |
/ccih/connecting/Intercampus_Conversa.shtml |
| archive |
97908 |
/ccih/connecting/catholicismandtheprofessionallife/archive/ |
| Catholicism in Dialogue |
69095 |
/ccih/connecting/catholicismindialogue/ |
| archive |
97910 |
/ccih/connecting/catholicismindialogue/archive/ |
| Living Tradition Award |
101275 |
/ccih/connecting/livingtraditionaward/ |
| archive |
101770 |
/ccih/connecting/livingtraditionaward/archive/ |
| Colloquia, Symposia, and Public Events |
18277 |
/ccih/communicating/Colloquia.shtml |
| archive |
73213 |
/ccih/communicating/colloquiasymposiaandpublicevents/archive/ |
| Past Colloquia |
58118 |
/ccih/communicating/colloquiasymposiaandpublicevents/pastcolloquia/ |
| Global 1968 Symposium |
117088 |
/ccih/communicating/colloquiasymposiaandpublicevents/global1968symposium/ |
| Video archive |
117796 |
/ccih/communicating/colloquiasymposiaandpublicevents/global1968symposium/videoarchive/ |
| Berrigan Week |
116247 |
/ccih/communicating/colloquiasymposiaandpublicevents/berriganweek/ |
| Video archive |
117435 |
/ccih/communicating/colloquiasymposiaandpublicevents/berriganweek/videoarchive/ |
| Conferences |
100117 |
/ccih/communicating/conferences/ |
| archive |
100710 |
/ccih/communicating/conferences/archive/ |
| Other Events |
100118 |
/ccih/communicating/otherevents/ |
| Research & Initiatives |
203072 |
/ccih/researchinitiatives/ |
| Research |
203073 |
/ccih/researchinitiatives/research/ |
| Michael J. Garanzini, S.J. Fellowships in the Catholic Intellectual Tradition |
157038 |
/ccih/researchinitiatives/research/michaeljgaranzinisjfellowshipsinthecatholicintellectualtradition/ |
| Course Development |
18302 |
/ccih/researching/Course_Development_P.shtml |
| Current Courses |
106578 |
/ccih/researching/coursedevelopment/currentcourses/ |
| Past Courses |
106579 |
/ccih/researching/coursedevelopment/pastcourses/ |
| Research Projects |
18306 |
/ccih/researching/ResearchProjects.shtml |
| Current Research Projects |
106846 |
/ccih/researching/researchprojects/currentresearchprojects/ |
| Past Research Projects |
106847 |
/ccih/researching/researchprojects/pastresearchprojects/ |
| Jesuit Studies |
154009 |
/ccih/communicating/jesuitstudies/ |
| archive |
154168 |
/ccih/communicating/jesuitstudies/archive/ |
| Applications for Funding |
18310 |
/ccih/researching/ApplicationsforFunding.shtml |
| Undergraduate Research Fellowship |
18304 |
/ccih/researching/ccih_fellows.shtml |
| Reading for Research Groups |
18303 |
/ccih/researching/ReadingGroups.shtml |
| Initiatives |
203074 |
/ccih/researchinitiatives/initiatives/ |
| Catholic Thought, Citizenship, and the Common Good |
126943 |
/ccih/communicating/catholicthoughtcitizenshipandthecommongood/ |
| archive |
126944 |
/ccih/communicating/catholicthoughtcitizenshipandthecommongood/archive/ |
| Teilhard de Chardin, S.J. Fellowship |
68956 |
/ccih/researching/teilharddechardinsjfellowship/ |
| archive |
97558 |
/ccih/researching/teilharddechardinsjfellowship/archive/ |
| Initiative on Faith, Science & Technology |
154010 |
/ccih/researchinitiatives/initiatives/initiativeonfaithsciencetechnology/ |
| archive |
154169 |
/ccih/communicating/initiativeonfaithscience/archive/ |
| The Initiative on Peace & Restorative Justice |
162106 |
/ccih/communicating/theinitiativeonpeacerestorativejustice/ |
| archive |
162117 |
/ccih/communicating/theinitiativeonpeacerestorativejustice/archive/ |
| St. John Berchmans Prize |
185474 |
/ccih/connecting/stjohnberchmansprize/ |
| Faculty Reading Groups |
185475 |
/ccih/researchinitiatives/initiatives/stjohnberchmansprize/facultyreadinggroups/ |
| Workshops & Seminars |
203075 |
/ccih/researchinitiatives/workshopsseminars/ |
| Faculty Seminar |
97550 |
/ccih/connecting/facultyseminar/ |
| Ongoing Formation Series |
204102 |
/ccih/researchinitiatives/workshopsseminars/ongoingformationseries/ |
| Resources |
18314 |
/ccih/Resources.shtml |
| Nexus Journal |
203086 |
https://www.hanknexusjournal.com |
| Hank Center Publications |
125913 |
/ccih/communicating/hankcenterpublications/ |
| CCIH Reading Groups |
56484 |
/ccih/connecting/ccihreadinggroups/ |
| Faculty Reading Groups |
18288 |
/ccih/connecting/ccihreadinggroups/facultyreadinggroups/ |
| archive |
101188 |
/ccih/connecting/ccihreadinggroups/facultyreadinggroups/archive/ |
| Student Reading Groups |
18291 |
/ccih/connecting/ccihreadinggroups/StudentReadingGroups.shtml |
| Catholic Heritage Library |
18301 |
/ccih/resources/CatholicHeritageLibrary.shtml |
| Catholic Classics Reading List |
18284 |
/ccih/resources/CatholicClassicsReadingList.shtml |
| Catholic Studies at Loyola |
119781 |
/catholicstudies/index.shtml |
| Newsletter Archive |
147718 |
/ccih/resources/newsletterarchive/ |
| Recommended Reading |
203170 |
/ccih/resources/recommendedreading/ |
| archive |
203171 |
/ccih/resources/recommendedreading/archive/ |
| All Videos |
203174 |
http://www.youtube.com/@hankcenterforthecatholicin5932 |
| Graphic Calendar Archive |
206096 |
/ccih/resources/graphiccalendararchive/ |
| archive |
206097 |
/ccih/resources/graphiccalendararchive/archive/ |
| About |
203077 |
/ccih/about/ |
| About the Hank Center |
203168 |
/ccih/about/ |
| News |
203120 |
/ccih/about/news/ |
| archive |
203121 |
/ccih/about/news/archive/ |
| Contact |
18272 |
/ccih/contact/ |
| A Catholic Origin of Human Rights |
18264 |
/ccih/robert_araujo.shtml |
| CCIH |
18269 |
/ccih/ccih.shtml |
| Contact the Center By December 17th for Spring Faculty Reading Groups |
18271 |
/ccih/SpringFacultyReadingGroupsAnnouncement.shtml |
| Spring Reading group to Focus on Charles Taylor's A Secular Age |
18274 |
/ccih/SecularAgeAnnouncement.shtml |
| Democracy, Culture and Catholicism International Research Project |
18292 |
/ccih/DCCIRP.shtml |
| Stories |
18319 |
/ccih/stories/ |
| archive |
79644 |
/ccih/stories/archive/ |
| archive |
18323 |
/ccih/archive/ |
| Building Bridges Initiative |
168426 |
/ccih/buildingbridgesinitiative/ |
| Test Page |
195162 |
/ccih/testpage/ |
| THEA Institute |
99025 |
/thea/ |
| About Us |
99124 |
/thea/aboutus/ |
| Mission, Goals, and Learning Outcomes |
99505 |
/thea/aboutus/missiongoalsandlearningoutcomes/ |
| Meet Our Team |
99130 |
/thea/aboutus/meetourteam/ |
| Contact Us |
99141 |
/thea/aboutus/contactus/ |
| News |
200115 |
/thea/aboutus/news/ |
| archive |
200116 |
/thea/aboutus/news/archive/ |
| Summer Institute |
99327 |
/thea/summerinstitute/ |
| Summer Institute Review |
181254 |
/thea/summerinstitute/summerinstitutereview/ |
| THEA Highlights |
99330 |
/thea/summerinstitute/theahighlights/ |
| Gallery |
99332 |
/thea/gallery/ |
| Footer |
99551 |
/thea/footer/ |
| site_logo |
200109 |
/thea/sitelogo/ |
| social media |
200113 |
/thea/socialmedia/ |
| modules-programming |
200114 |
/thea/modules-programming/ |
| Theology |
201648 |
/theology/ |
| site_logo |
201655 |
/theology/sitelogo/ |
| Footer |
201656 |
/theology/footer/ |
| social media |
201658 |
/theology/socialmedia/ |
| cta |
201659 |
/theology/cta/ |
| modules-programming |
201660 |
/theology/modules-programming/ |
| About Us |
201649 |
/theology/aboutus/ |
| Contact Us |
201667 |
/theology/aboutus/contactus/ |
| Faculty & Staff |
201668 |
/theology/aboutus/facultystaff/ |
| Faculty Directory - Gallery |
201700 |
/theology/aboutus/facultystaff/facultydirectory-gallery/ |
| profiles |
201698 |
/theology/aboutus/facultystaff/facultydirectory-gallery/profiles/ |
| right_column |
201699 |
/theology/aboutus/facultystaff/facultydirectory-gallery/profiles/rightcolumn/ |
| Faculty Directory - Alphabetical |
201880 |
/theology/aboutus/facultystaff/facultydirectory-alphabetical/ |
| Faculty Research Interests |
201902 |
/theology/aboutus/facultystaff/facultyresearchinterests/ |
| Part Time Faculty |
201725 |
/theology/aboutus/facultystaff/parttimefaculty/ |
| Faculty emeriti |
205536 |
/theology/aboutus/facultystaff/facultyemeriti/ |
| News |
201669 |
/theology/aboutus/news/ |
| Mary McAleese |
201662 |
/theology/aboutus/news/marymcaleese/ |
| A Dialogue on Gene Editing |
201664 |
/theology/aboutus/news/adialogueongeneediting/ |
| Maureen Junker-Kenny |
201665 |
/theology/aboutus/news/maureenjunker-kenny/ |
| Alumni Stories |
206588 |
/theology/aboutus/alumnistories/ |
| Graduate Programs |
201650 |
/theology/graduateprograms/ |
| Graduate Course Listings |
201675 |
/theology/graduateprograms/graduatecourselistings/ |
| Accelerated Bachelor's/Master's |
201676 |
/theology/graduateprograms/acceleratedbachelorsmasters/ |
| MA Programs |
201671 |
/theology/graduateprograms/maprograms/ |
| PhD Programs |
201670 |
/theology/graduateprograms/phdprograms/ |
| Integrative Studies in Ethics and Theology |
201708 |
/theology/graduateprograms/phdprograms/integrativestudiesinethicsandtheology/ |
| ISET Faculty |
203629 |
/theology/graduateprograms/phdprograms/integrativestudiesinethicsandtheology/isetfaculty/ |
| Conference Presentations |
203630 |
/theology/graduateprograms/phdprograms/integrativestudiesinethicsandtheology/conferencepresentations/ |
| Recent Dissertations and Publications |
203631 |
/theology/graduateprograms/phdprograms/integrativestudiesinethicsandtheology/recentdissertationsandpublications/ |
| New Testament and Early Christianity |
201710 |
/theology/graduateprograms/phdprograms/newtestamentandearlychristianity/ |
| Virtual Open House |
203220 |
/theology/graduateprograms/phdprograms/newtestamentandearlychristianity/virtualopenhouse/ |
| NTEC Faculty |
203222 |
/theology/graduateprograms/phdprograms/newtestamentandearlychristianity/ntecfaculty/ |
| NTEC Colloquium |
203224 |
/theology/graduateprograms/phdprograms/newtestamentandearlychristianity/research/nteccolloquium/ |
| Conference Presentations |
203225 |
/theology/graduateprograms/phdprograms/newtestamentandearlychristianity/research/conferencepresentations/ |
| Recent Dissertations and Publications |
203226 |
/theology/graduateprograms/phdprograms/newtestamentandearlychristianity/recentdissertationsandpublications/ |
| Current Students |
201673 |
/theology/graduateprograms/currentstudents/ |
| Profiles |
202070 |
/theology/graduateprograms/currentgraduatestudents/profiles/ |
| Archived profiles |
203165 |
/theology/graduateprograms/currentstudents/graduatestudentdirectory/archivedprofiles/ |
| Financial Aid |
201674 |
/theology/graduateprograms/financialaid/ |
| Graduate Student Resources |
201682 |
/theology/resources/graduatestudentresources/ |
| Theology Graduate Student Caucus |
201714 |
/theology/resources/graduatestudentresources/theologygraduatestudentcaucus/ |
| University Resources |
203662 |
/theology/graduateprograms/graduatestudentresources/universityresources/ |
| Prospective Students |
203093 |
/theology/graduateprograms/prospectivestudents/ |
| Application Requirements |
201672 |
/theology/graduateprograms/applicationrequirements/ |
| right_column |
203268 |
/theology/graduateprograms/rightcolumn/ |
| Undergraduate Programs |
201651 |
/theology/undergraduateprograms/ |
| Major and Minor Programs |
204139 |
/theology/undergraduateprograms/majorandminorprograms/ |
| Pastoral Leadership Minor |
201677 |
/theology/undergraduateprograms/pastoralleadershipminor/ |
| Undergraduate Course Listings |
201680 |
/theology/undergraduateprograms/undergraduatecourselistings/ |
| Core Curriculum |
201679 |
/theology/undergraduateprograms/corecurriculum/ |
| Interdisciplinary Degree Programs |
201678 |
/theology/undergraduateprograms/interdisciplinarydegreeprograms/ |
| Awards, Honors & Graduates |
201681 |
/theology/undergraduateprograms/awardshonorsgraduates/ |
| Undergraduate Student Resources |
201683 |
/theology/resources/undergraduatestudentresources/ |
| Academic Grievance Appeals Process |
202881 |
/theology/resources/undergraduatestudentresources/academicgrievanceappealsprocess/ |
| Scholars and Skeptics! |
204389 |
/theology/undergraduateprograms/scholarsandskeptics/ |
| Intellectual Life |
201653 |
/theology/intellectuallife/ |
| Lectures and Conferences |
201688 |
/theology/intellectuallife/lecturesandconferences/ |
| John Cardinal Cody Chair of Theology |
201686 |
/theology/intellectuallife/johncardinalcodychairoftheology/ |
| Cody Chair Events |
204677 |
/theology/intellectuallife/johncardinalcodychairoftheology/codychairevents/ |
| Richard A. McCormick, S.J., Chair of Catholic Moral Theology |
201687 |
/theology/intellectuallife/richardamccormicksjchairofcatholicmoraltheology/ |
| McCormick Chair Events |
204308 |
/theology/intellectuallife/richardamccormicksjchairofcatholicmoraltheology/mccormickchairevents/ |
| Archive |
204513 |
/theology/intellectuallife/richardamccormicksjchairofcatholicmoraltheology/mccormickchairevents/archive/ |
| Speaking Engagements, lectures, etc. |
204309 |
/theology/intellectuallife/richardamccormicksjchairofcatholicmoraltheology/speakingengagementslecturesetc/ |
| Podcasts |
204515 |
/theology/intellectuallife/richardamccormicksjchairofcatholicmoraltheology/speakingengagementslecturesetc/podcasts/ |
| Research |
204310 |
/theology/intellectuallife/richardamccormicksjchairofcatholicmoraltheology/research/ |
| Entangled Responsibility |
204512 |
/theology/intellectuallife/richardamccormicksjchairofcatholicmoraltheology/research/entangledresponsibility/ |
| Publications |
204517 |
/theology/intellectuallife/richardamccormicksjchairofcatholicmoraltheology/research/publications/ |
| John Courtney Murray S.J. University Chair in Public Service |
204312 |
/theology/intellectuallife/johncourtneymurraysjuniversitychairinpublicservice/ |
| Recent Publications |
201654 |
/theology/recentpublications/ |
| Recent Books by Faculty |
201693 |
/theology/recentpublications/recentbooksbyfaculty/ |
| News |
201661 |
/theology/news/ |
| Stories Archive |
201666 |
/theology/aboutus/news/storiesarchive/ |
| 2025 |
201696 |
/theology/aboutus/news/storiesarchive/2025/ |
| archive |
201697 |
/theology/aboutus/news/storiesarchive/2025/archive/ |
| 2024 |
201694 |
/theology/aboutus/news/storiesarchive/2024/ |
| archive |
201695 |
/theology/aboutus/news/storiesarchive/2024/archive/ |
| Why Study Theology Articles |
204697 |
/theology/whystudytheologyarticles/ |
| Tutoring Center |
28527 |
/tutoring/index.shtml |
| Who We Are |
28486 |
/tutoring/whoweare/ |
| Mission and Vision |
28491 |
/tutoring/whoweare/missionandvision/ |
| Join Our Team |
28489 |
/tutoring/whoweare/joinourteam/ |
| Policies |
82210 |
/tutoring/whoweare/policies/ |
| Contact Us |
28487 |
/tutoring/whoweare/contactus/ |
| Our Staff |
201912 |
/tutoring/whoweare/ourstaff/ |
| Profiles |
201913 |
/tutoring/whoweare/ourstaff/profiles/ |
| Our Services |
28499 |
/tutoring/ourservices/ |
| Supplemental Instruction |
81901 |
/tutoring/ourservices/supplementalinstruction/ |
| Peer Tutoring |
28496 |
/tutoring/ourservices/peertutoring/ |
| Success Coaching |
28495 |
/tutoring/ourservices/successcoaching/ |
| Success Coach Blog |
195750 |
/tutoring/ourservices/successcoaching/successcoachblog/ |
| Success in Seconds |
129568 |
/tutoring/ourservices/successcoaching/successinseconds/ |
| Our Team |
205589 |
/tutoring/ourservices/successcoaching/ourteam/ |
| Foreign Language Tutoring |
28497 |
/tutoring/ourservices/foreignlanguagetutoring/ |
| UNIV 112-Strategies for Learning |
81946 |
/tutoring/ourservices/univ112-strategiesforlearning/ |
| STEM Center |
118737 |
/tutoring/ourservices/stemcenter/ |
| Rambler Resource Referral |
205912 |
/tutoring/ourservices/ramblerresourcereferral/ |
| Rambler Resource Referral |
205912 |
/tutoring/ourservices/ramblerresourcereferral/ |
| Subject-Specific Support |
120772 |
/tutoring/subject-specificsupport/ |
| Biology |
120773 |
/tutoring/subject-specificsupport/biology/ |
| Business |
120774 |
/tutoring/subject-specificsupport/business/ |
| Chemistry |
120775 |
/tutoring/subject-specificsupport/chemistry/ |
| Computer Science |
120777 |
/tutoring/subject-specificsupport/computerscience/ |
| Engineering |
120778 |
/tutoring/subject-specificsupport/engineering/ |
| Environmental Science |
120779 |
/tutoring/subject-specificsupport/environmentalscience/ |
| Liberal Arts |
120784 |
/tutoring/subject-specificsupport/liberalarts/ |
| Math and Statistics |
120783 |
/tutoring/subject-specificsupport/mathandstatistics/ |
| Modern Languages |
120785 |
/tutoring/subject-specificsupport/modernlanguages/ |
| Nursing |
120780 |
/tutoring/subject-specificsupport/nursing/ |
| Physics |
120781 |
/tutoring/subject-specificsupport/physics/ |
| Writing |
120816 |
/tutoring/subject-specificsupport/writing/ |
| Learning Strategy Resources |
122313 |
/tutoring/learningstrategyresources/ |
| Virtual Open House |
28528 |
/tutoring/virtualopenhouse/ |
| Our Services |
28529 |
/tutoring/virtualopenhouse/ourservices/ |
| Our Space |
28530 |
/tutoring/virtualopenhouse/ourspace/ |
| Our Tutors |
28531 |
/tutoring/virtualopenhouse/ourtutors/ |
| Forms |
28536 |
/tutoring/forms/ |
| Small Group Tutoring |
28519 |
/tutoring/forms/smallgrouptutoring/ |
| Thank You for Your Submission |
28525 |
/tutoring/forms/thankyou-visit/ |
| Thank You for Your Submission |
28524 |
/tutoring/forms/thankyou-group/ |
| Request form work around |
28517 |
/tutoring/forms/requestformworkaround/ |
| Policies & Information |
28512 |
/tutoring/policies-info/ |
| Employment Information |
28513 |
/tutoring/policies-info/employmentinformation/ |
| Policy & Procedures |
28514 |
/tutoring/policies-info/policyprocedures/ |
| Strategic Planning |
28515 |
/tutoring/policies-info/strategicplanning/ |
| Training Supplements |
28516 |
/tutoring/policies-info/trainingsupplements/ |
| About You |
28492 |
/tutoring/aboutyou/ |
| Virtual Tour |
28493 |
/tutoring/aboutyou/virtualtour/ |
| cta |
198764 |
/tutoring/cta/ |
| social media |
198766 |
/tutoring/socialmedia/ |
| modules-programming |
198767 |
/tutoring/modules-programming/ |
| Footer |
28545 |
/tutoring/footer/ |
| site_logo |
28546 |
/tutoring/sitelogo/ |
| Student Academic Services |
202506 |
/tutoring/studentacademicservices/ |
| Scholars Programs |
202509 |
https://www.luc.edu/scholarsprograms/ |
| Student Accessibility Center |
202511 |
https://www.luc.edu/sac/ |
| Student-Athlete Academic Services |
202507 |
https://www.luc.edu/athleteadvising |
| Undergraduate Admission |
195910 |
/undergrad/ |
| Documents |
204452 |
/undergrad/documents/ |
| site_logo |
195911 |
/undergrad/sitelogo/ |
| Footer |
202861 |
/undergrad/footer/ |
| cta |
200527 |
/undergrad/cta/ |
| social media |
198267 |
/undergrad/socialmedia/ |
| Admissions |
195912 |
/undergrad/admissions/ |
| First-Year Students |
196099 |
/undergrad/admissions/first-yearstudents/ |
| Transfer Students |
196110 |
/undergrad/admissions/transferstudents/ |
| International Students |
196153 |
/undergrad/admissions/internationalstudents/ |
| Graduate and Professional Enrollment |
202421 |
https://gpem.luc.edu/portal/admission?tab=home |
| Veterans |
195919 |
/undergrad/admissions/veterans/ |
| Rome Start |
195917 |
/undergrad/admissions/romestart/ |
| Other Students |
195921 |
/undergrad/admissions/otherstudents/ |
| Transfer Credit Guidelines |
195918 |
/undergrad/admissions/transfercreditguidelines/ |
| Transfer Recommended Courses |
199513 |
/undergrad/admissions/transfercreditguidelines/transferrecommendedcourses/ |
| right_column |
199577 |
/undergrad/admissions/transfercreditguidelines/transferrecommendedcourses/rightcolumn/ |
| Arrupe College |
199544 |
/undergrad/admissions/transfercreditguidelines/transferrecommendedcourses/arrupecollege/ |
| City Colleges of Chicago |
199546 |
/undergrad/admissions/transfercreditguidelines/transferrecommendedcourses/citycollegesofchicago/ |
| College of DuPage |
199547 |
/undergrad/admissions/transfercreditguidelines/transferrecommendedcourses/collegeofdupage/ |
| College of Lake County |
199550 |
/undergrad/admissions/transfercreditguidelines/transferrecommendedcourses/collegeoflakecounty/ |
| Elgin Community College |
199551 |
/undergrad/admissions/transfercreditguidelines/transferrecommendedcourses/elgincommunitycollege/ |
| Harper College |
199552 |
/undergrad/admissions/transfercreditguidelines/transferrecommendedcourses/harpercollege/ |
| Joliet Junior College |
199553 |
/undergrad/admissions/transfercreditguidelines/transferrecommendedcourses/jolietjuniorcollege/ |
| McHenry County College |
199555 |
/undergrad/admissions/transfercreditguidelines/transferrecommendedcourses/mchenrycountycollege/ |
| Moraine Valley Community College |
199556 |
/undergrad/admissions/transfercreditguidelines/transferrecommendedcourses/morainevalleycommunitycollege/ |
| Morton College |
199557 |
/undergrad/admissions/transfercreditguidelines/transferrecommendedcourses/mortoncollege/ |
| Oakton College |
199558 |
/undergrad/admissions/transfercreditguidelines/transferrecommendedcourses/oaktoncollege/ |
| South Suburban College |
199559 |
/undergrad/admissions/transfercreditguidelines/transferrecommendedcourses/southsuburbancollege/ |
| Triton College |
199568 |
/undergrad/admissions/transfercreditguidelines/transferrecommendedcourses/tritoncollege/ |
| Waubonsee Community College |
199569 |
/undergrad/admissions/transfercreditguidelines/transferrecommendedcourses/waubonseecommunitycollege/ |
| right_column |
197092 |
/undergrad/admissions/transfercreditguidelines/rightcolumn/ |
| Tools and Resources for Transfer Students |
199512 |
/undergrad/admissions/transfercreditguidelines/toolsandresourcesfortransferstudents/ |
| Transfer Core Guide |
207037 |
/undergrad/admissions/transfercreditguidelines/transfercoreguide/ |
| Loyola at a Glance |
195914 |
/undergrad/admissions/loyolaataglance/ |
| right_column |
195927 |
/undergrad/admissions/rightcolumn/ |
| Academics |
196012 |
/undergrad/academics/ |
| Majors and Minors |
196015 |
/undergrad/academics/majorsandminors/ |
| programs |
196340 |
/undergrad/academics/majorsandminors/programs/ |
| Outcomes |
196016 |
/undergrad/academics/outcomes/ |
| Experiential Learning |
196014 |
/undergrad/academics/experientiallearning/ |
| Honors |
196013 |
/undergrad/academics/honors/ |
| Study Abroad |
196017 |
/undergrad/academics/studyabroad/ |
| Rome Start |
198486 |
/undergrad/academics/studyabroad/romestart/ |
| Major Quiz |
198408 |
/undergrad/academiclife/whatsmymajorquiz/index.html |
| custom_css |
198410 |
/undergrad/academiclife/whatsmymajorquiz/customcss/ |
| Majors - WORKING |
206651 |
/undergrad/academics/majors-working/ |
| College of Arts and Sciences |
206782 |
/undergrad/academics/majors-working/collegeofartsandsciences/ |
| Anthropology (BA) |
206812 |
/undergrad/academics/majors-working/collegeofartsandsciences/anthropologyba/ |
| Quinlan School of Business |
206783 |
/undergrad/academics/majors-working/quinlanschoolofbusiness/ |
| Accounting (BBA) |
206813 |
/undergrad/academics/majors-working/quinlanschoolofbusiness/accountingbba/ |
| School of Communication |
206784 |
/undergrad/academics/majors-working/schoolofcommunication/ |
| Advertising and Public Relations (BA) |
206814 |
/undergrad/academics/majors-working/schoolofcommunication/advertisingandpublicrelationsba/ |
| School of Education |
206785 |
/undergrad/academics/majors-working/schoolofeducation/ |
| Bilingual/Bicultural Education (BSEd) |
206869 |
/undergrad/academics/majors-working/schoolofeducation/bilingualbiculturaleducationbsed/ |
| School of Environmental Sustainability |
206786 |
/undergrad/academics/majors-working/schoolofenvironmentalsustainability/ |
| Environmental Economics and Sustainability (BA) |
206878 |
/undergrad/academics/majors-working/schoolofenvironmentalsustainability/environmentaleconomicsandsustainabilityba/ |
| Parkinson School of Health Sciences and Public Health |
206787 |
/undergrad/academics/majors-working/parkinsonschoolofhealthsciencesandpublichealth/ |
| Exercise Science (BS) |
206890 |
/undergrad/academics/majors-working/parkinsonschoolofhealthsciencesandpublichealth/exercisesciencebs/ |
| School of Nursing |
206788 |
/undergrad/academics/majors-working/schoolofnursing/ |
| Nursing (BSN) |
206862 |
/undergrad/academics/majors-working/schoolofnursing/nursingbsn/ |
| School of Social Work |
206789 |
/undergrad/academics/majors-working/schoolofsocialwork/ |
| Social Work (BSW) |
206834 |
/undergrad/academics/majors-working/schoolofsocialwork/socialworkbsw/ |
| Life at Loyola |
196412 |
/undergrad/lifeatloyola/ |
| Student Life |
196413 |
/undergrad/lifeatloyola/studentlife/ |
| Residence Life |
196414 |
/undergrad/lifeatloyola/residencelife/ |
| Residence Halls |
197904 |
/undergrad/lifeatloyola/residencelife/residencehalls/ |
| Jesuit Education |
196161 |
/undergrad/lifeatloyola/jesuiteducation/ |
| Life in Chicago |
196416 |
/undergrad/lifeatloyola/lifeinchicago/ |
| Chicago Map |
197887 |
/undergrad/lifeatloyola/lifeinchicago/chicagomap/ |
| Campus Life |
196417 |
/undergrad/lifeatloyola/campuslife/ |
| modules-programming |
197921 |
/undergrad/lifeatloyola/modules-programming/ |
| Tuition, Scholarships, and Aid |
197915 |
/undergrad/tuitionscholarshipsandaid/ |
| Value of a Loyola Education |
197917 |
/undergrad/tuitionscholarshipsandaid/valueofaloyolaeducation/ |
| modules-programming |
197933 |
/undergrad/tuitionscholarshipsandaid/valueofaloyolaeducation/modules-programming/ |
| Scholarships and Financial Aid |
197918 |
/undergrad/tuitionscholarshipsandaid/scholarshipsandfinancialaid/ |
| Tuition and Fees |
197919 |
/undergrad/tuitionscholarshipsandaid/tuitionandfees/ |
| Net Price Calculator |
197920 |
/undergrad/tuitionscholarshipsandaid/netpricecalculator/ |
| Connect |
197922 |
/undergrad/connect/ |
| Visit |
197923 |
/undergrad/connect/visit/ |
| Meet Your Admission Counselor |
207356 |
https://uao.luc.edu/portal/find_my_counselor |
| Admission Counselors |
197924 |
/undergrad/connect/admissioncounselors/ |
| Admission Counselors |
198426 |
/undergrad/connect/meetyouradmissioncounselor/admissioncounselors/ |
| profiles |
207353 |
/undergrad/connect/meetyouradmissioncounselor/admissioncounselors/profiles/ |
| right_column |
202870 |
/undergrad/connect/meetyouradmissioncounselor/admissioncounselors/profiles/rightcolumn/ |
| Request Information |
197934 |
https://uao.luc.edu/register/?id=09e1ac8b-c620-43cc-afe7-325cad54eec2 |
| For School Counselors |
197927 |
/undergrad/connect/forschoolcounselors/ |
| For Transfer Students |
197938 |
/undergrad/connect/fortransferstudents/ |
| Welcome! |
203179 |
/undergrad/connect/welcome/ |
| Publications |
206450 |
/undergrad/connect/publications/ |
| Neighborhood Recommendations |
207056 |
/undergrad/connect/neighborhoodrecommendations/ |
| Stories |
205524 |
/undergrad/stories/ |
| items |
205525 |
/undergrad/stories/items/ |
| Sample Story Page |
205526 |
/undergrad/stories/samplestorypage/ |
| right_column |
205527 |
/undergrad/stories/rightcolumn/ |
| Story Pages |
207412 |
/undergrad/stories/storypages/ |
| Love Life and Press on With Peace |
207413 |
/undergrad/stories/storypages/lovelifeandpressonwithpeace/ |
| Sandbox |
204245 |
/undergrad/sandbox/ |
| DRAFT - UAO Stories |
204260 |
/undergrad/sandbox/v1/ |
| Profiles |
204261 |
/undergrad/sandbox/v1/profiles/ |
| Steve M's test page |
204638 |
/undergrad/sandbox/stevemstestpage/ |
| Majors Draft |
204772 |
/undergrad/sandbox/majorsdraft/ |
| Layanne's Draft Majors Pages |
204841 |
/undergrad/sandbox/layannesdraftmajorspages/ |
| UAO Recommendations Draft |
204959 |
/undergrad/sandbox/uaorecommendationsdraft/ |
| Publications |
206283 |
/undergrad/sandbox/publications/ |
| Majors Draft v2 |
206314 |
/undergrad/sandbox/majorsdraftv2/ |
| University Convocation |
203064 |
/universityconvocation/ |
| site_logo |
203066 |
/-dev/sitelogo/ |
| Footer |
203575 |
/universityconvocation/footer/ |
| Program Overview |
203082 |
/universityconvocation/programoverview/ |
| Spotlights |
203919 |
/universityconvocation/spotlights/ |
| University Leadership |
186952 |
/universityleadership/ |
| site_logo |
186954 |
/universityleadership/sitelogo/ |
| Office of the President |
186955 |
/president/ |
| Board of Trustees |
177872 |
/universityleadership/boardoftrustees/ |
| Leadership and Administration |
191987 |
/universityleadership/leadershipandadministration/ |
| Council of Deans |
192243 |
/universityleadership/leadershipandadministration/councilofdeans/ |
| Michele Alexandre |
197003 |
/universityleadership/leadershipandadministration/councilofdeans/michelealexandre/ |
| Emily Barman |
197006 |
/universityleadership/leadershipandadministration/councilofdeans/emilybarman/ |
| Michael Behnam |
197005 |
/universityleadership/leadershipandadministration/councilofdeans/michaelbehnam/ |
| Patricia Findley |
197007 |
/universityleadership/leadershipandadministration/councilofdeans/patriciafindley/ |
| Lorna Finnegan |
197008 |
/universityleadership/leadershipandadministration/councilofdeans/lornafinnegan/ |
| Malik Henfield |
197011 |
/universityleadership/leadershipandadministration/councilofdeans/malikhenfield/ |
| Peter Jones |
197012 |
/universityleadership/leadershipandadministration/councilofdeans/peterjones/ |
| Sam J. Marzo |
197013 |
/universityleadership/leadershipandadministration/councilofdeans/samjmarzo/ |
| Virginia McDermott |
197015 |
/universityleadership/leadershipandadministration/councilofdeans/virginiamcdermott/ |
| David E. McIntosh |
197016 |
/universityleadership/leadershipandadministration/councilofdeans/davidemcintosh/ |
| Peter Schraeder |
191995 |
/universityleadership/leadershipandadministration/councilofdeans/peterschraeder/ |
| Elaine Morrato |
197017 |
/universityleadership/leadershipandadministration/councilofdeans/elainemorrato/ |
| Nancy Tuchman |
197021 |
/universityleadership/leadershipandadministration/councilofdeans/nancytuchman/ |
| Jeanne Widen |
197023 |
/universityleadership/leadershipandadministration/councilofdeans/jeannewiden/ |
| Martin T. Connell, S.J. |
197063 |
/universityleadership/leadershipandadministration/councilofdeans/martintconnellsj/ |
| image assets |
197064 |
/universityleadership/leadershipandadministration/councilofdeans/imageassets/ |
| James V. Parenti, EdD |
199320 |
/universityleadership/leadershipandadministration/councilofdeans/jamesvparentiedd/ |
| Malini Suchak |
203349 |
/universityleadership/leadershipandadministration/councilofdeans/malinisuchak/ |
| Jamie Wittenberg |
205812 |
/universityleadership/leadershipandadministration/councilofdeans/jamiewittenberg/ |
| University Leadership Council |
197004 |
/universityleadership/leadershipandadministration/universityleadershipcouncil/ |
| LeRoy Butler |
191992 |
/universityleadership/leadershipandadministration/universityleadershipcouncil/leroybutler/ |
| Pamela G. Costas |
191994 |
/universityleadership/leadershipandadministration/universityleadershipcouncil/pamelagcostas/ |
| Thomas M. Kelly |
191990 |
/universityleadership/leadershipandadministration/universityleadershipcouncil/thomasmkelly/ |
| Jeremy Langford |
191996 |
/universityleadership/leadershipandadministration/universityleadershipcouncil/jeremylangford/ |
| Wayne Magdziarz |
191988 |
/universityleadership/leadershipandadministration/universityleadershipcouncil/waynemagdziarz/ |
| Claire Noonan |
191991 |
/universityleadership/leadershipandadministration/universityleadershipcouncil/clairenoonan/ |
| Janice K. Parks |
191999 |
/universityleadership/leadershipandadministration/universityleadershipcouncil/janicekparks/ |
| Dominique Jordan Turner |
191997 |
/universityleadership/leadershipandadministration/councilofdeans/dominiquejordanturner/ |
| Stephen Watson |
191998 |
/universityleadership/leadershipandadministration/universityleadershipcouncil/stephenwatson/ |
| Kana Henning |
192445 |
/universityleadership/leadershipandadministration/universityleadershipcouncil/kanahenning/ |
| Thomas W. Neitzke, S.J. |
192446 |
/universityleadership/leadershipandadministration/universityleadershipcouncil/thomaswneitzkesj/ |
| Philip D. Hale |
192447 |
/universityleadership/leadershipandadministration/universityleadershipcouncil/philipdhale/ |
| Keith Champagne |
192448 |
/universityleadership/leadershipandadministration/universityleadershipcouncil/keithchampagne/ |
| Margaret Callahan |
192449 |
/universityleadership/leadershipandadministration/universityleadershipcouncil/margaretcallahan/ |
| George A. Trone |
192511 |
/universityleadership/leadershipandadministration/universityleadershipcouncil/georgeatrone/ |
| Douglas W. Woods |
196197 |
/universityleadership/leadershipandadministration/universityleadershipcouncil/douglaswwoods/ |
| Luigi B. Amendola |
202841 |
/universityleadership/leadershipandadministration/universityleadershipcouncil/luigibamendola/ |
| Danielle D. Ianni |
206352 |
/universityleadership/leadershipandadministration/universityleadershipcouncil/danielledianni/ |
| Administrative Offices |
186953 |
/universityleadership/administrativeoffices/ |
| Organizational Charts |
180105 |
/universityleadership/organizationalcharts/ |
| University Newsroom |
57355 |
/news/index.shtml |
| Policies and Guidelines |
57381 |
/news/policiesandguidelines/ |
| Media Relations Policy |
107570 |
/news/policiesandguidelines/mediarelationspolicy/ |
| Op-Ed Guidelines |
109785 |
/news/policiesandguidelines/op-edguidelines/ |
| Campus Safety Response Guidelines |
57483 |
http://www.luc.edu/safety/active_shooter.html |
| More University Policies |
57490 |
http://www.luc.edu/policy/ |
| Brand and Graphic Standards |
79742 |
http://luc.edu/umc/guidelines/brandandgraphicstandards/ |
| Social Media Policy |
79743 |
https://www.luc.edu/umc/policies/socialmediapolicy/ |
| Digital Signage Policies and Procedures |
79744 |
http://luc.edu/umc/menuofservices/digitalscreens/ |
| About Loyola |
57378 |
http://www.luc.edu/about_loyola.shtml |
| Key Leaders |
57379 |
/news/keyleaders/ |
| University Leadership Council |
84115 |
/universityleadership/leadershipandadministration/ |
| Council of Deans |
84116 |
/universityleadership/leadershipandadministration/councilofdeans/ |
| President |
79736 |
/president/aboutthepresident/ |
| Board of Trustees |
79741 |
/universityleadership/boardoftrustees/ |
| University Media |
57380 |
/news/universitymedia/ |
| Loyola Magazine |
57480 |
http://www.luc.edu/loyolamagazine |
| WLUW-FM |
57482 |
http://wluw.org/ |
| right_column |
57491 |
/news/rightcolumn/ |
| Features Archive |
58358 |
/news/featuresarchive/ |
| archive |
183493 |
/news/featuresarchive/archive/ |
| site_logo |
57360 |
/news/sitelogo/ |
| social media |
206861 |
/news/socialmedia/ |
| Footer |
57361 |
/news/footer/ |
| Documents |
95324 |
/news/documents/ |
| University Policies |
18872 |
/policy/index.shtml |
| site_logo |
19062 |
/policy/site_logo/ |
| right_column |
196100 |
/policy/rightcolumn/ |
| site_background |
55936 |
/policy/sitebackground/ |
| Footer |
19065 |
/policy/footer/ |
| interior_left |
53186 |
/policy/interiorleft/ |
| University Policies by Category |
18875 |
/policy/category.shtml |
| General University Policies |
94812 |
/policy/general/index.shtml |
| Financial Policies |
96193 |
/policy/financialpolicies/ |
| Budgeting |
103557 |
/policy/financialpolicies/budgeting/ |
| Bursar Services |
103558 |
/policy/financialpolicies/bursarservices/ |
| Controller |
103559 |
/policy/financialpolicies/controller/ |
| Purchasing |
103560 |
/policy/financialpolicies/purchasing/ |
| Sponsored Program Accounting |
103561 |
/policy/financialpolicies/sponsoredprogramaccounting/ |
| Treasury & Risk Management |
103562 |
/policy/financialpolicies/treasuryriskmanagement/ |
| Investment |
196140 |
/policy/financialpolicies/investment/ |
| Advancement Policies |
197097 |
/policy/advancementpolicies/ |
| Human Resources Policies |
23755 |
/policy/humanresourcespolicies/ |
| Information Technology Services Policies |
23757 |
/policy/informationtechnologyservicespolicies/ |
| Academic Policies |
23759 |
/policy/academicpolicies/ |
| Faculty Administration |
96222 |
/policy/academicpolicies/facultyadministration/ |
| Graduate School |
96223 |
/policy/academicpolicies/graduateschool/ |
| Stritch School of Medicine (SSOM) Policies |
23762 |
/policy/stritchschoolofmedicinessompolicies/ |
| Loyola University Health System (LUHS) Policies |
23767 |
/policy/loyolauniversityhealthsystemluhspolicies/ |
| Student Affairs Policies |
23769 |
/policy/studentaffairspolicies/ |
| University Councils |
23772 |
/policy/universitycouncils/ |
| University Handbooks |
23774 |
/policy/universityhandbooks/ |
| Wedding Ceremonies at Loyola Facilities |
63183 |
/policy/facilities/ |
| custom_js |
95669 |
/policy/customjs/ |
| interior_left |
95670 |
/policy/interiorleft/ |
| Loyola Policy for Reporting Official Internal and External Information |
107419 |
/policy/loyolapolicyforreportingofficialinternalandexternalinformation/ |
| University Policies in Alphabetical Order |
198612 |
/policy/alphabetical.shtml |
| University Policies in Alphabetical Order (Archived) |
18876 |
/policy/universitypoliciesinalphabeticalorderarchived/ |
| Anti-Nepotism Policy |
72206 |
/policy/anti-nepotismpolicy/ |
| Gift Acceptance Policy |
18873 |
/policy/gift_acceptance.shtml |
| Guidelines for Political Activities for Students, Faculty, and Staff |
18874 |
/policy/guidelines.shtml |
| University Senate |
48126 |
/universitysenate/ |
| About |
199369 |
/universitysenate/about/ |
| Bylaws |
160679 |
/universitysenate/about/bylaws/ |
| Membership |
62448 |
/universitysenate/about/membership/ |
| Meetings |
104878 |
/universitysenate/about/meetings/ |
| Past Meeting Minutes |
48516 |
/universitysenate/about/pastmeetingminutes/ |
| Shared Governance Involvement |
70188 |
/universitysenate/sharedgovernanceinvolvement/ |
| Measures of the Senate: Resolutions |
122179 |
/universitysenate/measuresofthesenateresolutions/ |
| Candidacy Statements |
179808 |
/universitysenate/candidacystatements/ |
| Lake Shore Campus - Faculty Senators |
179810 |
/universitysenate/candidacystatements/lakeshorecampus-facultysenators/ |
| Lake Shore Campus - Staff Senators |
179811 |
/universitysenate/candidacystatements/lakeshorecampus-staffsenators/ |
| Water Tower Campus - Faculty Senators |
179812 |
/universitysenate/candidacystatements/watertowercampus-facultysenators/ |
| Water Tower Campus - Staff Senators |
179813 |
/universitysenate/candidacystatements/watertowercampus-staffsenators/ |
| Health Sciences Campus - Faculty Senators |
179814 |
/universitysenate/candidacystatements/healthsciencescampus-facultysenators/ |
| Health Sciences Campus - Staff Senators |
179815 |
/universitysenate/candidacystatements/healthsciencescampus-staffsenators/ |
| 2014 Staff Nominations |
66306 |
/universitysenate/nominations/staff.shtml |
| Footer |
48134 |
/universitysenate/footer/ |
| site_logo |
48135 |
/universitysenate/sitelogo/ |
| 2018-2019 Shared Governance Resolution |
124241 |
/universitysenate/2018-2019sharedgovernanceresolution/ |
| 2018-2019 English Language Learning Program |
124242 |
/universitysenate/2018-2019englishlanguagelearningprogram/ |
| 2018-2019 Loyola University Museum of Art Resolution |
124243 |
/universitysenate/2018-2019loyolauniversitymuseumofartresolution/ |
| 2018-2019 Speaker Policy Resolution |
124244 |
/universitysenate/2018-2019speakerpolicyresolution/ |
| 2018-2019 Tobacco Use Policy |
124245 |
/universitysenate/2018-2019tobaccousepolicy/ |
| University Staff Council |
34549 |
/staffcouncil/index.shtml |
| About Us |
34550 |
/staffcouncil/aboutus/ |
| Charter & By-Laws |
157871 |
/staffcouncil/aboutus/charterby-laws/ |
| Membership |
34577 |
/staffcouncil/aboutus/membership/ |
| Committees |
34578 |
/staffcouncil/aboutus/committees/ |
| Meeting Schedule |
34576 |
/staffcouncil/aboutus/meetingschedule/ |
| Contact Us |
34551 |
/staffcouncil/aboutus/contactus/ |
| Partnership with Human Resources |
61272 |
/staffcouncil/aboutus/partnershipwithhumanresources/ |
| News |
201818 |
/staffcouncil/aboutus/news/ |
| Governance |
206280 |
/staffcouncil/governance/ |
| Staff Development |
206281 |
/staffcouncil/staffdevelopment/ |
| Staff Recognition |
34581 |
/staffcouncil/staffrecognition/ |
| Monthly Commitment to Excellence Award |
34583 |
/staffcouncil/programs/monthlycommitmenttoexcellenceaward/ |
| Commitment to Excellence - Monthly Staff Award Nominations |
34677 |
/staffcouncil/programs/monthlycommitmenttoexcellenceaward/commitmenttoexcellence-monthlystaffawardnominations/ |
| Staff Awards Nomination Confirmation |
127254 |
/staffcouncil/programs/monthlycommitmenttoexcellenceaward/commitmenttoexcellence-monthlystaffawardnominations/confirmation/ |
| Commitment to Excellence Monthly Award Winners |
47943 |
/staffcouncil/programs/monthlycommitmenttoexcellenceaward/awardwinners.shtml |
| Recently retired not deleted |
206448 |
/staffcouncil/staffrecognition/monthlycommitmenttoexcellenceaward/commitmenttoexcellencemonthlyawardwinners/recentlyretirednotdeleted/ |
| 2026 Monthly Award Winner Profiles |
206441 |
/staffcouncil/staffrecognition/monthlycommitmenttoexcellenceaward/2026monthlyawardwinnerprofiles/ |
| profiles |
206442 |
/staffcouncil/staffrecognition/monthlycommitmenttoexcellenceaward/2026monthlyawardwinnerprofiles/profiles/ |
| 2025 Monthly Award Winners |
201820 |
/staffcouncil/programs/monthlycommitmenttoexcellenceaward/2025/ |
| Profiles |
201821 |
/staffcouncil/programs/monthlycommitmenttoexcellenceaward/2025/profiles/ |
| 2024 Monthly Award Winners |
201824 |
/staffcouncil/programs/monthlycommitmenttoexcellenceaward/2024/ |
| Profiles |
201825 |
/staffcouncil/programs/monthlycommitmenttoexcellenceaward/2024/profiles/ |
| 2023 Monthly Award Winners |
201822 |
/staffcouncil/programs/monthlycommitmenttoexcellenceaward/2023/ |
| Profiles |
201823 |
/staffcouncil/programs/monthlycommitmenttoexcellenceaward/2023/profiles/ |
| 2022 Monthly Award Winners |
201826 |
/staffcouncil/programs/monthlycommitmenttoexcellenceaward/2022/ |
| Profiles |
201827 |
/staffcouncil/programs/monthlycommitmenttoexcellenceaward/2022/profiles/ |
| 2021 Monthly Award Winners |
201828 |
/staffcouncil/programs/monthlycommitmenttoexcellenceaward/2021/ |
| Profiles |
201829 |
/staffcouncil/programs/monthlycommitmenttoexcellenceaward/2021/profiles/ |
| 2020 Monthly Award Winners |
201830 |
/staffcouncil/programs/monthlycommitmenttoexcellenceaward/2020/ |
| Profiles |
201831 |
/staffcouncil/programs/monthlycommitmenttoexcellenceaward/2020/profiles/ |
| 2019 Monthly Award Winners |
201833 |
/staffcouncil/programs/monthlycommitmenttoexcellenceaward/2019/ |
| Profiles |
201834 |
/staffcouncil/programs/monthlycommitmenttoexcellenceaward/2019/profiles/ |
| 2018 Monthly Award Winners |
201839 |
/staffcouncil/programs/monthlycommitmenttoexcellenceaward/2018/ |
| Profiles |
201840 |
/staffcouncil/programs/monthlycommitmenttoexcellenceaward/2018/profiles/ |
| 2017 Monthly Award Winners |
201835 |
/staffcouncil/programs/monthlycommitmenttoexcellenceaward/2017/ |
| Profiles |
201836 |
/staffcouncil/programs/monthlycommitmenttoexcellenceaward/2017/profiles/ |
| 2016 Monthly Award Winners |
201837 |
/staffcouncil/programs/monthlycommitmenttoexcellenceaward/2016/ |
| Profiles |
201838 |
/staffcouncil/programs/monthlycommitmenttoexcellenceaward/2016/profiles/ |
| Monthly Excellence Awards past winners |
206288 |
/staffcouncil/staffrecognition/monthlycommitmenttoexcellenceaward/monthlyexcellenceawardspastwinners/ |
| Annual Staff Recognition |
34585 |
/staffcouncil/programs/annualstaffrecognition/ |
| 2005 Staff Recognition & Excellence Award Recipients |
35189 |
/staffcouncil/programs/annualrecognitionexcellenceawards/2005staffrecognitionexcellenceawardrecipients/ |
| 2006 Staff Recognition & Excellence Award Recipients |
35196 |
/staffcouncil/programs/annualrecognitionexcellenceawards/2006staffrecognitionexcellenceawardrecipients/ |
| 2007 Staff Recognition & Excellence Award Recipients |
35195 |
/staffcouncil/programs/annualrecognitionexcellenceawards/2007staffrecognitionexcellenceawardrecipients/ |
| 2008 Staff Recognition & Excellence Award Recipients |
35194 |
/staffcouncil/programs/annualrecognitionexcellenceawards/2008staffrecognitionexcellenceawardrecipients/ |
| 2009 Staff Recognition & Excellence Award Recipients |
35193 |
/staffcouncil/programs/annualrecognitionexcellenceawards/2009staffrecognitionexcellenceawardrecipients/ |
| 2010 Staff Recognition & Excellence Award Recipients |
35192 |
/staffcouncil/programs/annualrecognitionexcellenceawards/2010staffrecognitionexcellenceawardrecipients/ |
| 2014 Staff Recognition and Excellence Award Winners |
88761 |
/staffcouncil/programs/annualrecognitionexcellenceawards/2014staffrecognitionandexcellenceawardwinners/ |
| 2015 Staff Recognition and Excellence Award Winners |
99265 |
/staffcouncil/programs/annualrecognitionexcellenceawards/2015-winners/ |
| 2016 Staff Recognition Awards |
106736 |
/staffcouncil/programs/annualrecognitionexcellenceawards/2016staffrecognitionawards/ |
| 2017 Staff Recognition Awards |
106734 |
/staffcouncil/programs/annualrecognitionexcellenceawards/2017staffrecognitionawards/ |
| 2018 Staff Recognition Awards |
118249 |
/staffcouncil/programs/annualrecognitionexcellenceawards/2018staffrecognitionawards/ |
| 2019 Staff Recognition Awards |
124796 |
/staffcouncil/programs/annualrecognitionexcellenceawards/2019staffrecognitionawards/ |
| 2021 Staff Recognition Awards |
167506 |
/staffcouncil/programs/annualrecognitionexcellenceawards/2021staffrecognitionawards/ |
| LEEF |
34582 |
/staffcouncil/leef/ |
| Community and Events |
62998 |
/staffcouncil/events/ |
| Holiday Spirit Contest |
99530 |
/staffcouncil/events/holidayspirit/ |
| Pizza with the President Review |
101020 |
/staffcouncil/events/pizzawiththepresidentreview/ |
| Lunch and Learn |
118627 |
/staffcouncil/events/lunchandlearn/ |
| Campus Walks |
163739 |
/staffcouncil/events/campus-walks/ |
| USC Elections |
34573 |
/staffcouncil/uscelections/ |
| USC Elections Nomination Form |
35895 |
/staffcouncil/uscelections/nomination/ |
| Staff Council Newsletter |
35509 |
/staffcouncil/staffcouncilnewsletter/ |
| right_column |
59897 |
/staffcouncil/rightcolumn/ |
| documents |
64608 |
/staffcouncil/documents/ |
| Footer |
35486 |
/staffcouncil/footer/ |
| site_logo |
35487 |
/staffcouncil/sitelogo/ |
| modules-programming |
201810 |
/staffcouncil/modules-programming/ |
| cta |
201811 |
/staffcouncil/cta/ |
| Urban Affairs and Public Policy |
92749 |
/muapp/ |
| About |
92750 |
/muapp/about/ |
| Faculty |
190023 |
/muapp/about/faculty/ |
| Contact |
92759 |
/muapp/about/contact/ |
| Frequently Asked Questions |
93014 |
/muapp/about/faqs/ |
| Admissions |
190026 |
/muapp/admissions/ |
| Schedules and Courses |
92984 |
/muapp/admissions/schedulesandcourses/ |
| Financing |
92988 |
/muapp/admissions/financing/ |
| Apply |
93003 |
https://gpem.luc.edu/apply/ |
| Academics |
92751 |
/muapp/academics/ |
| Graduate Degrees |
92781 |
/muapp/academics/graduatedegrees/ |
| Graduate Certificate |
190036 |
/muapp/academics/graduatecertificate/ |
| Bachelor’s/Master’s |
190037 |
/muapp/academics/bachelorsmasters/ |
| JD/MPP |
190038 |
/muapp/academics/jdmpp/ |
| Internships |
93004 |
/muapp/academics/internships/ |
| Outcomes |
190186 |
/muapp/outcomes/ |
| Alumni Profiles |
92765 |
/muapp/outcomes/alumniprofiles/ |
| Student Experience |
93008 |
/muapp/outcomes/studentexperience/ |
| Alumni Panel |
188281 |
/muapp/outcomes/alumnipanel/ |
| site_logo |
92755 |
/muapp/sitelogo/ |
| cta |
198558 |
/muapp/cta/ |
| social media |
198536 |
/muapp/socialmedia/ |
| right_column |
92771 |
/muapp/rightcolumn/ |
| modules-programming |
198537 |
/muapp/modules-programming/ |
| Footer |
92756 |
/muapp/footer/ |
| Voter Information |
178708 |
/vote/ |
| site_logo |
178710 |
/vote/site_logo/ |
| Footer |
178711 |
/vote/footer/ |
| modules-programming |
178858 |
/vote/modules-programming/ |
| social media |
178859 |
/vote/socialmedia/ |
| About |
178861 |
/vote/about/ |
| The LUPE Task Force |
178862 |
/vote/about/thelupetaskforce/ |
| Important Dates |
178865 |
/vote/about/importantdates/ |
| Contact Us |
178866 |
/vote/about/contactus/ |
| FAQs |
178867 |
/vote/about/faqs/ |
| Voting Guide |
178868 |
/vote/votingguide/ |
| Step One: Register to Vote |
178869 |
/vote/votingguide/steponeregistertovote/ |
| Step Two: Get Informed |
178870 |
/vote/votingguide/steptwogetinformed/ |
| Step Three: Make a Voting Plan and Vote! |
178871 |
/vote/votingguide/stepthreemakeavotingplanandvote/ |
| Get Involved |
178872 |
/vote/getinvolved/ |
| Get Involved on Election Day |
178873 |
/vote/getinvolved/getinvolvedonelectionday/ |
| Host a Voting Event |
178874 |
/vote/getinvolved/hostavotingevent/ |
| Student Volunteers |
178875 |
/vote/getinvolved/studentvolunteers/ |
| Faculty and Staff Opportunities |
178876 |
/vote/getinvolved/facultyandstaffopportunities/ |
| Resources |
178877 |
/vote/resources/ |
| The Loyola Votes Toolkit |
178878 |
/vote/resources/toolkit/ |
| Other Resources |
178879 |
/vote/resources/otherresources/ |
| Local Chicago Elections |
179789 |
/vote/localchicagoelections/ |
| Recursos de Español |
180367 |
/vote/recursosdeespaol/ |
| Wellness Center |
183827 |
/wellness/ |
| site_logo |
183828 |
/wellness/sitelogo/ |
| Footer |
183829 |
/wellness/footer/ |
| cta |
183830 |
/wellness/cta/ |
| I Links |
183831 |
/wellness/ilinks/ |
| social media |
183832 |
/wellness/socialmedia/ |
| modules-programming |
183833 |
/wellness/modules-programming/ |
| About Us |
184236 |
/wellness/aboutus/ |
| Director's Message |
184237 |
/wellness/aboutus/directorsmessage/ |
| Mission and Vision |
184238 |
/wellness/aboutus/missionandvision/ |
| Eligibility and Fees |
184239 |
/wellness/aboutus/eligibilityandfees/ |
| No Show Fee |
184240 |
/wellness/aboutus/eligibilityandfees/noshowfee/ |
| FAQs |
184241 |
/wellness/aboutus/faqs/ |
| Contact Us |
184242 |
/wellness/aboutus/contactus/ |
| Meet the Staff |
184243 |
/wellness/aboutus/meetthestaff/ |
| Profiles |
184512 |
/wellness/aboutus/meetthestaff/profiles/ |
| Forms |
184244 |
/wellness/aboutus/forms/ |
| Requirements for Incoming Students |
184246 |
/wellness/aboutus/requirementsforincomingstudents/ |
| Patient Portal |
191265 |
/wellness/aboutus/patientportal/ |
| Mental Health |
184247 |
/wellness/mentalhealth/ |
| Emergency/Crisis Care |
184357 |
/wellness/mentalhealth/emergencycrisiscare/ |
| Nearest Emergency Departments |
184358 |
/wellness/mentalhealth/emergencycrisiscare/nearestemergencydepartments/ |
| Appointments/First Steps |
184248 |
/wellness/mentalhealth/appointmentsfirststeps/ |
| Group Counseling |
184249 |
/wellness/mentalhealth/groupcounseling/ |
| Care Management and Referrals |
184250 |
/wellness/mentalhealth/caremanagementandreferrals/ |
| Insurance information |
184251 |
/wellness/mentalhealth/caremanagementandreferrals/insuranceinformation/ |
| Scheduling an appointment with an off-campus provider |
184252 |
/wellness/mentalhealth/caremanagementandreferrals/schedulinganappointmentwithanoff-campusprovider/ |
| Psychiatry |
184253 |
/wellness/mentalhealth/psychiatry/ |
| Suicide Prevention |
184254 |
/wellness/mentalhealth/suicideprevention/ |
| Guide to Getting Help from a Crisis Hotline |
184255 |
/wellness/mentalhealth/suicideprevention/guidetogettinghelpfromacrisishotline/ |
| Guide to Identifying Emotional Crisis |
184256 |
/wellness/mentalhealth/suicideprevention/guidetoidentifyingemotionalcrisis/ |
| Guide to Understanding Suicide |
184257 |
/wellness/mentalhealth/suicideprevention/guidetounderstandingsuicide/ |
| Outside Resources for BIPOC, LGBTQ+, and Minoritized Students |
184258 |
/wellness/mentalhealth/outsideresourcesforbipoclgbtqandminoritizedstudents/ |
| Mental Health Resources for Asian and Pacific Islander Identified Students |
184259 |
/wellness/mentalhealth/outsideresourcesforbipoclgbtqandminoritizedstudents/mentalhealthresourcesforasianandpacificislanderidentifiedstudents/ |
| Mental Health Resources for Black Students |
184348 |
/wellness/mentalhealth/outsideresourcesforbipoclgbtqandminoritizedstudents/mentalhealthresourcesforblackstudents/ |
| Mental Health Resources for International Students |
184349 |
/wellness/mentalhealth/outsideresourcesforbipoclgbtqandminoritizedstudents/mentalhealthresourcesforinternationalstudents/ |
| Mental Health Resources for Latinx Identified Students |
184350 |
/wellness/mentalhealth/outsideresourcesforbipoclgbtqandminoritizedstudents/mentalhealthresourcesforlatinxidentifiedstudents/ |
| Mental Health Resources for LGBTQIA+ Identified Students |
184351 |
/wellness/mentalhealth/outsideresourcesforbipoclgbtqandminoritizedstudents/mentalhealthresourcesforlgbtqiaidentifiedstudents/ |
| Self-Assessment Tools |
184352 |
/wellness/mentalhealth/self-assessmenttools/ |
| Mindfulness |
184353 |
/wellness/mentalhealth/mindfulness/ |
| Mindfulness Resources |
184355 |
/wellness/mentalhealth/mindfulness/mindfulnessresources/ |
| FAQs |
184356 |
/wellness/mentalhealth/faqs/ |
| For Staff/Faculty |
184359 |
/wellness/mentalhealth/forstafffaculty/ |
| Signs of Distress |
184360 |
/wellness/mentalhealth/forstafffaculty/signsofdistress/ |
| Talking with a Student |
184361 |
/wellness/mentalhealth/forstafffaculty/talkingwithastudent/ |
| Psychological/Behavioral Emergency |
184362 |
/wellness/mentalhealth/forstafffaculty/psychologicalbehavioralemergency/ |
| Sample syllabus language |
184363 |
/wellness/mentalhealth/forstafffaculty/samplesyllabuslanguage/ |
| Therapy Dog |
184364 |
/wellness/mentalhealth/therapydog/ |
| Training Opportunities for Graduate Students |
184365 |
/wellness/mentalhealth/trainingopportunitiesforgraduatestudents/ |
| DSD Areas |
184366 |
/wellness/dsdareas/ |
| DSD Areas Offices |
184367 |
/wellness/dsdareas/dsdareasoffices/ |
| Medical |
184368 |
/wellness/medical/ |
| Emergency/Crisis Care |
184369 |
/wellness/medical/emergencycrisiscare/ |
| Appointments |
184370 |
/wellness/medical/appointments/ |
| Services |
184371 |
/wellness/medical/services/ |
| Pregnancy |
184529 |
/wellness/medical/services/pregnancy/ |
| Dial-a-Nurse |
184372 |
/wellness/medical/dial-a-nurse/ |
| Immunizations |
184373 |
/wellness/medical/immunizations/ |
| Flu Vaccine |
184374 |
/wellness/medical/fluvaccine/ |
| Fees |
184377 |
/wellness/medical/fees/ |
| Respiratory Virus and Covid-19 Guidance |
188265 |
/wellness/medical/respiratoryvirusandcovid-19guidance/ |
| Health Promotion |
184378 |
/wellness/healthpromotion/ |
| Get Involved |
184379 |
/wellness/healthpromotion/getinvolved/ |
| Alcohol and Other Drugs |
184383 |
/wellness/healthpromotion/alcoholandotherdrugs/ |
| Training Menu |
184384 |
/wellness/healthpromotion/trainingmenu/ |
| Online Health Resources |
184385 |
/wellness/healthpromotion/onlinehealthresources/ |
| Health Topics Guide |
184386 |
/wellness/healthpromotion/onlinehealthresources/healthtopicsguide/ |
| Finals Week Virtual Meditation |
184387 |
/wellness/healthpromotion/finalsweekvirtualmeditation/ |
| Annual Wellness Fair |
184388 |
/wellness/healthpromotion/annualwellnessfair/ |
| Hazing Prevention |
188600 |
/wellness/healthpromotion/hazingprevention/ |
| Gender-Based Violence |
184390 |
/wellness/gender-basedviolence/ |
| Resources for Students |
184391 |
/wellness/gender-basedviolence/resourcesforstudents/ |
| Advocacy Line |
184392 |
/wellness/gender-basedviolence/advocacyline/ |
| Community Coalition |
184393 |
/wellness/gender-basedviolence/communitycoalition/ |
| Culture of Respect |
185496 |
/coalition/cultureofrespect/index.shtml |
| Nutrition |
184394 |
/wellness/nutrition/ |
| Appointments & Services |
184395 |
/wellness/nutrition/appointmentsservices/ |
| FAQs |
184396 |
/wellness/nutrition/faqs/ |
| Resources |
184397 |
/wellness/nutrition/resources/ |
| STI-HIV Testing |
184527 |
/wellness/sti-hivtesting/ |
| Welcome Week |
187038 |
/welcomeweek/ |
| site_logo |
187039 |
/welcomeweek/sitelogo/ |
| Footer |
187040 |
/welcomeweek/footer/ |
| Welcome Week 2025 |
187046 |
/welcomeweek/ |
| Events Schedule |
187042 |
/welcomeweek/eventsschedule/ |
| Campus Maps |
187043 |
/welcomeweek/campusmaps/ |
| Welcome Week Leaders |
187044 |
/welcomeweek/welcomeweekleaders/ |
| U-Pass |
187045 |
/upass/ |
| Check-in at Events |
187738 |
/welcomeweek/check-inatevents/ |
| Women and Leadership Archives |
24190 |
/wla/index.shtml |
| site_logo |
24201 |
/wla/sitelogo/ |
| Footer |
24200 |
/wla/footer/ |
| social media |
200517 |
/wla/socialmedia/ |
| I Links |
200515 |
/wla/ilinks/ |
| News |
202753 |
/wla/news/ |
| About Us |
24158 |
/wla/aboutus.shtml |
| Contact Info, Directions, & Hours |
62445 |
/wla/contactinfodirectionshours/ |
| Donating Records |
24161 |
/wla/donatingrecords |
| Staff |
64504 |
/wla/staff/ |
| WLA History |
190334 |
/wla/wlahistory/ |
| Student Employment and Opportunities |
157067 |
/wla/studentemploymentandopportunities |
| Partnerships |
190201 |
/wla/partnerships/ |
| Welcome |
24164 |
/wla/welcome.shtml |
| News and Events |
85395 |
/wla/newsandevents/ |
| archive |
85396 |
/wla/newsandevents/archive/ |
| WLA Newsletter |
200530 |
/wla/newsandevents/wlanewsletter/ |
| right_column |
85431 |
/wla/rightcolumn/ |
| Services & Instruction |
157066 |
/wla/servicesinstruction/ |
| Make an Appointment |
189667 |
/wla/servicesinstruction/makeanappointment/ |
| Using Collections |
24159 |
/wla/using_collections.shtml |
| Class Visits and Instruction |
24160 |
/wla/classvisits.shtml |
| Chicago Metro History Day |
62207 |
/wla/servicesinstruction/chicagometrohistoryday/ |
| Finding a Topic |
62257 |
/wla/servicesinstruction/historyfair/findingatopic/ |
| Using Primary Sources |
62258 |
/wla/servicesinstruction/historyfair/usingprimarysources/ |
| Plan Your Visit |
62260 |
/wla/servicesinstruction/historyfair/planyourvisit/ |
| right_column |
86130 |
/wla/servicesinstruction/historyfair/rightcolumn/ |
| Collections |
24165 |
/wla/collections1.shtml |
| Search the Collections |
24167 |
/wla/collections.shtml |
| Digital Collections |
24166 |
/wla/digital_collections.shtml |
| Collection Policy |
129472 |
/wla/collectionpolicy/ |
| Mundelein College Collection |
24168 |
/wla/mcarchives.shtml |
| Mundelein College Timeline |
24170 |
/wla/wla_timeline.html |
| Oral History Collection |
24171 |
/wla/oral_history_collect.shtml |
| right_column |
86125 |
/wla/rightcolumn/ |
| Mundelein College |
62487 |
/wla/mcarchives.shtml |
| Timeline |
62488 |
/wla/timeline/ |
| Mundelein College Collection |
62489 |
/wla/wla/mcarchives.shtml |
| Digital Collections |
75504 |
/wla/digitalcollections/ |
| Photograph Collection |
75884 |
/wla/photographcollection/ |
| The Skyscraper Newspaper |
75885 |
/wla/theskyscrapernewspaper/ |
| right_column |
86134 |
/wla/rightcolumn/ |
| Voices from Mundelein: Media Portal |
116875 |
/wla/voicesfrommundeleinmediaportal/ |
| Mundelein College Buildings |
162114 |
/wla/mundeleincollegebuildings/ |
| Coffey Hall |
162115 |
/wla/mundeleincollegebuildings/coffeyhall/ |
| The Mundelein College Skyscraper |
162118 |
/wla/mundeleincollegebuildings/themundeleincollegeskyscraper/ |
| Learning Resource Center |
163733 |
/wla/mundeleincollegebuildings/learningresourcecenter/ |
| Green House |
166113 |
/wla/mundeleincollegebuildings/greenhouse/ |
| Piper Hall |
62717 |
/wla/mundeleincollegebuildings/piperhall/ |
| Philomena Hall |
166114 |
/wla/mundeleincollegebuildings/philomenahall/ |
| Northland Hall |
166217 |
/wla/mundeleincollegebuildings/northlandhall/ |
| Yellow House |
168416 |
/wla/mundeleincollegebuildings/yellowhouse/ |
| Digital Exhibits |
65088 |
/wla/digitalexhibits/ |
| Activist Mundelein |
65090 |
/wla/digitalexhibits/activistmundelein/ |
| Legion of Young Polish Women |
69793 |
/wla/digitalexhibits/legionofyoungpolishwomen/ |
| Peace Studies Origins |
111047 |
/wla/digitalexhibits/peacestudiesorigins/ |
| Practical Work: Chicago Woman's Club |
65089 |
/wla/digitalexhibits/practicalworkchicagowomansclub/ |
| Voices from Mundelein: Media Portal |
129700 |
/wla/digitalexhibits/voicesfrommundeleinmediaportal/ |
| Women and Labor Project: Mollie West |
124904 |
/wla/digitalexhibits/womenandlaborprojectmolliewest/ |
| right_column |
86139 |
/wla/digitalexhibits/rightcolumn/ |
| digital |
24173 |
/wla/digital/index.html |
| Programs & Partnerships |
24178 |
/wla/programs.shtml |
| right_column |
86126 |
/wla/rightcolumn/ |
| Special Projects |
163675 |
/wla/specialprojects/ |
| Color Our Collections |
166486 |
/wla/specialprojects/colorourcollections/ |
| Hoellen Family Foundation |
168306 |
/wla/specialprojects/hoellenfamilyfoundation/ |
| Mundelein at 90 |
163674 |
/wla/specialprojects/mundeleinat90/ |
| PWA Preservation Project |
168325 |
/wla/specialprojects/pwapreservationproject/ |
| WLA 30th |
191411 |
/wla/specialprojects/30/ |
| LUC Sesquicentennial |
124520 |
/wla/specialprojects/150th/ |
| Votes for Women |
154324 |
/wla/specialprojects/votesforwomen/ |
| ISHRAB Grant |
190126 |
/wla/specialprojects/ishrabgrant/ |
| Lecture Series |
24182 |
/wla/WLA_Lecture_Series.shtml |
| BMRC |
194783 |
/wla/specialprojects/bmrc/ |
| WLA Valentines |
206270 |
/wla/specialprojects/wlavalentines/ |
| Women's Studies and Gender Studies |
35384 |
/wsgs/index.shtml |
| Who We Are |
98030 |
/wsgs/whoweare/ |
| Our Mission |
98031 |
/wsgs/whoweare/ourmission/ |
| Our Program |
98032 |
/wsgs/whoweare/ourprogram/ |
| Our Faculty and Staff |
98033 |
/wsgs/whoweare/ourfacultyandstaff/ |
| Profiles |
199694 |
/wsgs/whoweare/ourfacultyandstaff/profiles/ |
| Our Affiliate Faculty |
98034 |
/wsgs/whoweare/ouraffiliatefaculty/ |
| Our Alumni |
124215 |
/wsgs/whoweare/ouralumni/ |
| Profiles |
199832 |
/wsgs/whoweare/ouralumni/profiles/ |
| right_column |
203117 |
/wsgs/whoweare/ouralumni/profiles/rightcolumn/ |
| Frequently Asked Questions |
118187 |
/wsgs/whoweare/frequentlyaskedquestions/ |
| Stories |
104890 |
/wsgs/whoweare/stories/ |
| archive |
199678 |
/wsgs/whoweare/stories/archive/ |
| Archived Stories |
199680 |
/wsgs/whoweare/stories/archivedstories/ |
| Donate |
204050 |
/wsgs/whoweare/donate/ |
| Academics |
123677 |
/wsgs/academics/ |
| Undergraduate Program |
123678 |
/wsgs/academics/undergraduateprogram/ |
| Learning Outcomes |
123679 |
/wsgs/academics/undergraduateprogram/learningoutcomes/ |
| Major in WSGS |
123680 |
/wsgs/academics/undergraduateprogram/majorinwsgs/ |
| Minor in WSGS |
123681 |
/wsgs/academics/undergraduateprogram/minorinwsgs/ |
| Dates and Deadlines |
123684 |
/wsgs/academics/undergraduateprogram/datesanddeadlines/ |
| Double Dipping Policy |
123685 |
/wsgs/academics/undergraduateprogram/doubledippingpolicy/ |
| WSGS Internship and Practicum |
154198 |
/wsgs/academics/undergraduateprogram/wsgsinternshipandpracticum/ |
| WSGS Intern Blogs |
126500 |
/wsgs/academics/undergraduateprogram/wsgsinternblogs/ |
| Publications and Conferences |
182023 |
/wsgs/academics/undergraduateprogram/publicationsandconferences/ |
| Study Abroad |
180665 |
/wsgs/academics/undergraduateprogram/studyabroad/ |
| Graduate Program |
123686 |
/wsgs/academics/graduateprogram/ |
| MA in WSGS |
199685 |
https://catalog.luc.edu/graduate-professional/graduate-school/arts-sciences/womens-studies-gender-studies/ |
| MA in WSGS/MSW in Social Work |
199684 |
https://catalog.luc.edu/graduate-professional/dual-degree-programs/womens-studies-gender-studies-ma-social-work-msw/ |
| Mary Griffin Essay Award |
123849 |
/wsgs/academics/graduateprogram/marygriffinessayaward/ |
| Transdisciplinary Colloquium of Gender, Queer, and Trans Studies |
191284 |
/wsgs/academics/graduateprogram/transdisciplinarycolloquiumofgenderqueerandtransstudies/ |
| TCGQT 2025 Overview |
200597 |
/wsgs/academics/graduateprogram/transdisciplinarycolloquiumofgenderqueerandtransstudies/tcgqt2025overview/ |
| TCGQT 2025 Program |
202114 |
/wsgs/academics/graduateprogram/transdisciplinarycolloquiumofgenderqueerandtransstudies/tcgqt2025program/ |
| TCGQ 2024 Overview |
194113 |
/wsgs/academics/graduateprogram/transdisciplinarycolloquiumofgenderqueerandtransstudies/tcgq2024overview/ |
| Images |
194114 |
/wsgs/academics/graduateprogram/transdisciplinarycolloquiumofgenderqueerandtransstudies/images/ |
| Internships and Practicum |
123702 |
/wsgs/academics/graduateprogram/internshipsandpracticum/ |
| WSGS Intern Blogs |
127515 |
/wsgs/academics/graduateprogram/internshipsandpracticum/wsgsinternblogs/ |
| Study Abroad |
98059 |
/wsgs/academics/graduateprogram/studyabroad/ |
| Course Offerings |
199686 |
https://catalog.luc.edu/graduate-professional/graduate-school/arts-sciences/womens-studies-gender-studies/#coursestext |
| Laura Bassi Scholarship |
199688 |
/wsgs/resources/graduatestudentresources/laurabassischolarship/ |
| Accelerated Masters Pathway (AMP) |
207161 |
/wsgs/academics/acceleratedmasterspathwayamp/ |
| Concentration in WSGS for PhD Students |
192062 |
/wsgs/academics/concentrationinwsgsforphdstudents/ |
| Outcomes |
98057 |
/wsgs/outcomes/ |
| Resources |
98065 |
/wsgs/resources/ |
| WSGS Events |
155198 |
/wsgs/resources/wsgsevents/ |
| WSGS Events - Spring 2025 |
204067 |
/wsgs/resources/wsgsevents/wsgsevents-spring2025/ |
| WSGS Events - Fall 2024 |
198778 |
/wsgs/resources/wsgsevents/wsgsevents-fall2024/ |
| WSGS Events - Spring 2024 |
191542 |
/wsgs/resources/wsgsevents/wsgsevents-spring2024/ |
| WSGS Events - Spring 2023 |
190205 |
/wsgs/resources/wsgsevents/wsgsevents-spring2023/ |
| WSGS Events - Fall 2022 |
180248 |
/wsgs/resources/wsgsevents/wsgsevents-fall2022/ |
| WSGS Events - Fall 2021 |
166707 |
/wsgs/resources/wsgsevents/wsgsevents-fall2021/ |
| WSGS Events - Spring 2021 |
159042 |
/wsgs/resources/wsgsevents/wsgsevents-spring2021/ |
| WSGS Events - Fall 2020 |
159043 |
/wsgs/resources/wsgsevents/wsgsevents-fall2020/ |
| Women's Studies and Gender Studies Resources |
124220 |
/wsgs/resources/womensstudiesandgenderstudiesresources/ |
| WSGS Borrowing Library |
124221 |
/wsgs/resources/womensstudiesandgenderstudiesresources/wsgsborrowinglibrary/ |
| Gender Inclusive Language |
124224 |
/wsgs/resources/womensstudiesandgenderstudiesresources/genderinclusivelanguage/ |
| Lili Elbe Digital Archive |
127670 |
/wsgs/resources/womensstudiesandgenderstudiesresources/lilielbedigitalarchive/ |
| Voices from Mundelein: Media Portal |
124225 |
/wsgs/resources/womensstudiesandgenderstudiesresources/voicesfrommundeleinmediaportal/ |
| Undergraduate Summer Research Experience |
189878 |
/wsgs/resources/womensstudiesandgenderstudiesresources/undergraduatesummerresearchexperience/ |
| Graduate Student Resources |
124229 |
/wsgs/resources/graduatestudentresources/ |
| Graduate Handbook |
124230 |
/wsgs/resources/graduatestudentresources/graduatehandbook/ |
| The Council on Social Work Education (CSWE) |
124232 |
/wsgs/resources/graduatestudentresources/thecouncilonsocialworkeducationcswe/ |
| Laura Bassi Scholarship |
123675 |
/wsgs/resources/graduatestudentresources/laurabassischolarship/ |
| Mary Griffin Essay Award |
199689 |
/wsgs/academics/graduateprogram/marygriffinessayaward/ |
| University Resources |
124236 |
/wsgs/resources/universityresources/ |
| Anti-Racism Initiative (ARI) |
181706 |
https://www.luc.edu/ari/ |
| Career Services |
98285 |
http://www.luc.edu/career/ |
| Center for Diversity and Inclusion (CDI) |
98155 |
http://www.luc.edu/diversity/ |
| Center for Engaged Learning, Teaching, and Scholarship (CELTS) |
98286 |
http://www.luc.edu/experiential/ |
| Community Coalition on Gender-Based Violence |
98156 |
http://www.luc.edu/ccrt/ |
| Student Organizations |
98060 |
/wsgs/resources/universityresources/studentorganizations/ |
| The Women's Project |
101058 |
/wsgs/resources/universityresources/studentorganizations/thewomensproject/ |
| Title IX |
98154 |
https://www.luc.edu/equity/titleixequitylaws/titleix/ |
| Wellness Center |
98284 |
http://www.luc.edu/wellness/ |
| Women and Leadership Archives |
181709 |
https://www.luc.edu/wla/ |
| Get Educated and Get Involved |
147822 |
/wsgs/resources/geteducatedandgetinvolved/ |
| Local Resources |
182059 |
/wsgs/resources/geteducatedandgetinvolved/localresources/ |
| Community Organizations |
147834 |
/wsgs/resources/geteducatedandgetinvolved/localresources/communityorganizations/ |
| Local Businesses |
147839 |
/wsgs/resources/geteducatedandgetinvolved/localresources/localbusinesses/ |
| Food Resources |
181827 |
/wsgs/resources/geteducatedandgetinvolved/localresources/foodresources/ |
| Health Resources |
147842 |
/wsgs/resources/geteducatedandgetinvolved/localresources/healthresources/ |
| Housing Providers |
181828 |
/wsgs/resources/geteducatedandgetinvolved/localresources/housingproviders/ |
| Museums, Exhibits, and Artists |
147836 |
/wsgs/resources/geteducatedandgetinvolved/localresources/museumsexhibitsandartists/ |
| Local News |
147838 |
/wsgs/resources/geteducatedandgetinvolved/localresources/localnews/ |
| Read About Chicago's History |
147835 |
/wsgs/resources/geteducatedandgetinvolved/localresources/readaboutchicagoshistory/ |
| National Resources and More |
182060 |
/wsgs/resources/geteducatedandgetinvolved/nationalresourcesandmore/ |
| Books and Reading Lists |
181824 |
/wsgs/resources/geteducatedandgetinvolved/nationalresourcesandmore/booksandreadinglists/ |
| National News Sources |
181822 |
/wsgs/resources/geteducatedandgetinvolved/nationalresourcesandmore/nationalnewssources/ |
| TV Shows and Movies |
181825 |
/wsgs/resources/geteducatedandgetinvolved/nationalresourcesandmore/tvshowsandmovies/ |
| Music and Musicians |
147837 |
/wsgs/resources/geteducatedandgetinvolved/nationalresourcesandmore/musicandmusicians/ |
| Feminisms |
147840 |
/wsgs/resources/geteducatedandgetinvolved/nationalresourcesandmore/feminisms/ |
| History Month Specifc Reources |
181821 |
/wsgs/resources/geteducatedandgetinvolved/historymonthspecifcreources/ |
| Native American History Month 2022 |
181677 |
/wsgs/resources/geteducatedandgetinvolved/historymonthspecifcreources/nativeamericanhistorymonth2022/ |
| History of Feminist Thought |
201964 |
/wsgs/resources/historyoffeministthought/ |
| WSGS Intern Blogs |
159624 |
/wsgs/resources/wsgsinternblogs/ |
| What’s happening |
98075 |
/wsgs/whatshappening/ |
| Keeping Community in Uncertain Times |
98076 |
/wsgs/whatshappening/keepingcommunityinuncertaintimes/ |
| Happening at Loyola |
98077 |
/wsgs/whatshappening/happeningatloyola/ |
| Explore Chicago |
98078 |
/wsgs/whatshappening/explorechicago/ |
| site_logo |
199668 |
/wsgs/sitelogo/ |
| Footer |
199669 |
/wsgs/footer/ |
| cta |
199670 |
/wsgs/cta/ |
| social media |
199672 |
/wsgs/socialmedia/ |
| modules-programming |
199673 |
/wsgs/modules-programming/ |
| Writing Center |
9122 |
/writing/ |
| site_logo |
9131 |
/writing/site_logo/ |
| Footer |
9130 |
/writing/footer/ |
| About |
201897 |
/writing/about/ |
| Schedule an Appointment |
79793 |
https://luc.mywconline.com/ |
| Campus Resources |
195998 |
/writing/campusresources/ |
| Locations |
196000 |
/writing/campusresources/locations/ |
| Information Commons |
197217 |
/writing/campusresources/locations/informationcommons/ |
| Corboy Law Center |
197219 |
/writing/campusresources/locations/corboylawcenter/ |
| Appointment Types |
196001 |
/writing/campusresources/appointmenttypes/ |
| Writing Fellows |
196002 |
/writing/campusresources/writingfellows/ |
| Writing Fellow Bios |
197108 |
/writing/campusresources/writingfellows/writingfellowbios/ |
| Profiles |
205793 |
/writing/campusresources/writingfellows/writingfellowbios/profiles/ |
| Classroom Visits |
196003 |
/writing/campusresources/classroomvisits/ |
| On-Campus Events |
196004 |
/writing/campusresources/on-campusevents/ |
| Find a Tutor |
196005 |
/writing/campusresources/findatutor/ |
| STEM |
196090 |
/writing/campusresources/findatutor/stem/ |
| profiles |
206337 |
/writing/campusresources/findatutor/stem/profiles/ |
| Humanities |
196091 |
/writing/campusresources/findatutor/humanities/ |
| profiles |
206338 |
/writing/campusresources/findatutor/humanities/profiles/ |
| Business |
196092 |
/writing/campusresources/findatutor/business/ |
| Profiles |
206357 |
/writing/campusresources/findatutor/business/profiles/ |
| Education |
196093 |
/writing/campusresources/findatutor/education/ |
| profiles |
206358 |
/writing/campusresources/findatutor/education/profiles/ |
| Social Sciences |
197111 |
/writing/campusresources/findatutor/socialsciences/ |
| profiles |
206359 |
/writing/campusresources/findatutor/socialsciences/profiles/ |
| Honors |
197113 |
/writing/campusresources/findatutor/honors/ |
| profiles |
206360 |
/writing/campusresources/findatutor/honors/profiles/ |
| Online Writing Lab |
195999 |
/writing/onlinewritinglab/ |
| Grammar |
196044 |
/writing/onlinewritinglab/grammar/ |
| Parts of Speech |
196052 |
/writing/onlinewritinglab/grammar/partsofspeech/ |
| Nouns |
196115 |
/writing/onlinewritinglab/grammar/partsofspeech/nouns/ |
| Verbs |
196122 |
/writing/onlinewritinglab/grammar/partsofspeech/verbs/ |
| Tense |
196134 |
/writing/onlinewritinglab/grammar/partsofspeech/verbs/tense/ |
| Style |
196045 |
/writing/onlinewritinglab/style/ |
| Clarity |
196138 |
/writing/onlinewritinglab/style/clarity/ |
| UCWR |
196048 |
/writing/onlinewritinglab/ucwr/ |
| Summary |
196067 |
/writing/onlinewritinglab/ucwr/summary/ |
| Analysis |
196068 |
/writing/onlinewritinglab/ucwr/analysis/ |
| Synthesis |
196069 |
/writing/onlinewritinglab/ucwr/synthesis/ |
| Researched Argument |
196070 |
/writing/onlinewritinglab/ucwr/researchedargument/ |
| Writing Program |
147982 |
/writingprogram/ |
| site_logo |
147983 |
/writingprogram/site_logo/ |
| Footer |
147984 |
/writingprogram/footer/ |
| Who We Are |
147995 |
/writingprogram/whoweare/ |
| Our Team |
148000 |
/writingprogram/whoweare/ourteam/ |
| Writing Faculty |
148019 |
/writingprogram/whoweare/ourteam/writingfaculty/ |
| profiles |
148021 |
/writingprogram/whoweare/ourteam/writingfaculty/profiles/ |
| right_column |
202260 |
/writingprogram/whoweare/ourteam/writingfaculty/rightcolumn/ |
| Books by Our Faculty |
148003 |
/writingprogram/whoweare/ourteam/booksbyourfaculty/ |
| Virginia Bell |
180086 |
/writingprogram/whoweare/ourteam/booksbyourfaculty/virginiabell/ |
| Melissa Bradshaw |
152198 |
/writingprogram/whoweare/ourteam/booksbyourfaculty/melissabradshaw/ |
| Daniel Buckman |
180087 |
/writingprogram/whoweare/ourteam/booksbyourfaculty/danielbuckman/ |
| Cullen Bailey Burns |
180088 |
/writingprogram/whoweare/ourteam/booksbyourfaculty/cullenbaileyburns/ |
| Laura Goldstein |
152199 |
/writingprogram/whoweare/ourteam/booksbyourfaculty/lauragoldstein/ |
| Margaret Hawkins |
152200 |
/writingprogram/whoweare/ourteam/booksbyourfaculty/margarethawkins/ |
| Jacob Hinkson |
152201 |
/writingprogram/whoweare/ourteam/booksbyourfaculty/jacobhinkson/ |
| Nate Hoks |
180089 |
/writingprogram/whoweare/ourteam/booksbyourfaculty/natehoks/ |
| Jaime Hovey |
180090 |
/writingprogram/whoweare/ourteam/booksbyourfaculty/jaimehovey/ |
| Brian Mornar |
180092 |
/writingprogram/whoweare/ourteam/booksbyourfaculty/brianmornar/ |
| Philip Sorenson |
152205 |
/writingprogram/whoweare/ourteam/booksbyourfaculty/philipsorenson/ |
| Snežana Žabić |
152207 |
/writingprogram/whoweare/ourteam/booksbyourfaculty/sneanaabi/ |
| Contact Us |
147999 |
/writingprogram/whoweare/contactus/ |
| Our Yearly Publication |
147998 |
/writingprogram/whoweare/ouryearlypublication/ |
| Achieve eBook |
153989 |
/writingprogram/whoweare/ouryearlypublication/achieveebook/ |
| Writing Placement Assessment |
148004 |
/writingprogram/writingplacementassessment/ |
| Overview |
148005 |
/writingprogram/writingplacementassessment/overview/ |
| Placement |
148007 |
/writingprogram/writingplacementassessment/placement/ |
| Exemptions |
148008 |
/writingprogram/writingplacementassessment/exemptions/ |
| Instructions |
207463 |
/writingprogram/writingplacementassessment/instructions/ |
| Sharon Walsh Essay Contest |
148014 |
/writingprogram/sharonwalshessaycontest/ |
| 2025 Winning Essays |
148015 |
/writingprogram/sharonwalshessaycontest/2025winningessays/ |
| Previous Winners |
185785 |
/writingprogram/essaycontest/previouswinners/ |
| AY 2023-24 |
207142 |
/writingprogram/sharonwalshessaycontest/previouswinners/ay2023-24/ |
| AY 2022-23 |
205083 |
/writingprogram/sharonwalshessaycontest/previouswinners/ay2022-23/ |
| AY 2021-22 |
185784 |
/writingprogram/essaycontest/previouswinners/ay2021-22/ |
| AY 2020-21 |
179505 |
/writingprogram/essaycontest/previouswinners/ay2020-21/ |
| AY 2019-20 |
179506 |
/writingprogram/essaycontest/previouswinners/ay2019-20/ |
| AY 2018-19 |
179507 |
/writingprogram/essaycontest/previouswinners/ay2018-19/ |
| AY 2017-18 |
179508 |
/writingprogram/essaycontest/previouswinners/ay2017-18/ |
| AY 2016-17 |
179509 |
/writingprogram/essaycontest/previouswinners/ay2016-17/ |
| AY 2015-16 |
179510 |
/writingprogram/essaycontest/previouswinners/ay2015-16/ |
| Other Writing Contests |
148016 |
/writingprogram/essaycontest/otherwritingcontests/ |
| Courses |
148009 |
/writingprogram/courses/ |
| Foundations of Writing |
148010 |
/writingprogram/courses/foundationsofwriting/ |
| University Core Writing |
148011 |
/writingprogram/courses/universitycorewriting/ |
| Advanced Writing |
148013 |
/writingprogram/courses/advancedwriting/ |
| Policies & Supports |
148017 |
/writingprogram/policiessupports/ |
| Standards of Good Writing |
154042 |
/writingprogram/policiessupports/standardsofgoodwriting/ |
| Writing-Intensive Designation |
148020 |
/writingprogram/policiessupports/writing-intensivedesignation/ |
| UCWR 110 Exemption |
148018 |
/writingprogram/policiessupports/ucwr110exemption/ |
| Academic Integrity |
149853 |
https://www.luc.edu/academics/catalog/undergrad/reg_academicintegrity.shtml |
| Writing Supports |
148024 |
/writingprogram/policiessupports/writingsupports/ |
| Academic Supports |
154006 |
/writingprogram/policiessupports/academicsupports/ |
| The Writing Center |
179327 |
/writingprogram/thewritingcenter/ |
| custom_css |
70687 |
/customcss/ |
| AudienceNav |
206521 |
/audiencenav/ |
| Homepage Updates - SOE - DEV |
206803 |
/homepageupdates-soe-dev/ |
| Homepage Updates - SOL - DEV |
206805 |
/homepageupdates-sol-dev/ |
| Homepage Updates - SOL - DEV |
206805 |
/homepageupdates-sol-dev/ |
| Homepage Updates - QSB - DEV |
206806 |
/homepageupdates-qsb-dev/ |
